Results: dupa

Query: 1k6wA

MOLECULE: CYTOSINE DEAMINASE;

Select neighbours (check boxes) for viewing as multiple structural alignment or 3D superimposition. The list of neighbours is sorted by Z-score. Similarities with a Z-score lower than 2 are spurious. Each neighbour has links to pairwise structural alignment with the query structure, and to the PDB format coordinate file where the neighbour is superimposed onto the query structure.

Expand gaps

Summary

    No:  Chain   Z    rmsd lali nres  %id PDB  Description
   1:  1k6w-A 75.4  0.0  423   423  100 PDB  MOLECULE: CYTOSINE DEAMINASE;                                        
   2:  4cqb-A 50.0  2.1  382   402   28 PDB  MOLECULE: N-ISOPROPYLAMMELIDE ISOPROPYL AMIDOHYDROLASE;              
   3:  2oof-A 35.0  2.9  356   403   14 PDB  MOLECULE: 4-IMIDAZOLONE-5-PROPANOATE AMIDOHYDROLASE;                 
   4:  1j6p-A 34.3  2.8  350   407   18 PDB  MOLECULE: METAL-DEPENDENT HYDROLASE OF                               
   5:  3ls9-A 32.9  2.8  358   453   16 PDB  MOLECULE: TRIAZINE HYDROLASE;                                        
   6:  2paj-A 32.6  3.0  334   421   19 PDB  MOLECULE: PUTATIVE CYTOSINE/GUANINE DEAMINASE;                       
   7:  3mtw-A 30.5  3.2  331   404   14 PDB  MOLECULE: L-ARGININE CARBOXYPEPTIDASE CC2672;                        
   8:  2uz9-A 30.0  3.2  344   444   13 PDB  MOLECULE: GUANINE DEAMINASE;                                         
   9:  4rdv-B 29.7  3.3  353   451   16 PDB  MOLECULE: N-FORMIMINO-L-GLUTAMATE IMINOHYDROLASE;                    
  10:  3mkv-A 28.7  3.1  327   414   17 PDB  MOLECULE: PUTATIVE AMIDOHYDROLASE;                                   
  11:  4c5y-A 27.2  3.0  328   436   14 PDB  MOLECULE: OCHRATOXINASE;                                             
  12:  3icj-A 26.7  3.5  319   468   16 PDB  MOLECULE: UNCHARACTERIZED METAL-DEPENDENT HYDROLASE;                 
  13:  2vun-A 26.0  3.7  312   385   16 PDB  MOLECULE: ENAMIDASE;                                                 
  14:  2ogj-A 25.4  3.8  309   379   13 PDB  MOLECULE: DIHYDROOROTASE;                                            
  15:  1onx-A 25.4  3.5  316   390   15 PDB  MOLECULE: ISOASPARTYL DIPEPTIDASE;                                   
  16:  3nqb-A 25.0  3.3  302   587   14 PDB  MOLECULE: ADENINE DEAMINASE 2;                                       
  17:  2imr-A 23.5  4.3  298   380   15 PDB  MOLECULE: HYPOTHETICAL PROTEIN DR_0824;                              
  18:  3gri-A 23.4  3.9  317   422   16 PDB  MOLECULE: DIHYDROOROTASE;                                            
  19:  3giq-A 23.3  4.1  336   475   15 PDB  MOLECULE: N-ACYL-D-GLUTAMATE DEACYLASE;                              
  20:  1yrr-B 23.1  3.3  297   334   13 PDB  MOLECULE: N-ACETYLGLUCOSAMINE-6-PHOSPHATE DEACETYLASE;               
  21:  1gkp-A 22.9  3.9  323   458   15 PDB  MOLECULE: HYDANTOINASE;                                              
  22:  3ooq-A 22.8  3.3  281   384   14 PDB  MOLECULE: AMIDOHYDROLASE;                                            
  23:  1a4m-A 21.8  3.1  269   349   13 PDB  MOLECULE: ADENOSINE DEAMINASE;                                       
  24:  4b3z-D 21.7  4.0  323   477   15 PDB  MOLECULE: DIHYDROPYRIMIDINASE-RELATED PROTEIN 1;                     
  25:  3e74-A 21.0  4.0  299   429   18 PDB  MOLECULE: ALLANTOINASE;                                              
  26:  3k2g-B 18.5  3.9  261   358   11 PDB  MOLECULE: RESINIFERATOXIN-BINDING, PHOSPHOTRIESTERASE-               
  27:  2y1h-B 18.1  3.4  235   265   10 PDB  MOLECULE: PUTATIVE DEOXYRIBONUCLEASE TATDN3;                         
  28:  2ob3-A 17.7  4.0  248   329   13 PDB  MOLECULE: PARATHION HYDROLASE;                                       
  29:  2vc5-A 17.3  4.4  251   314   10 PDB  MOLECULE: ARYLDIALKYLPHOSPHATASE;                                    
  30:  1bf6-A 17.3  3.6  238   291   12 PDB  MOLECULE: PHOSPHOTRIESTERASE HOMOLOGY PROTEIN;                       
  31:  3gg7-A 17.2  3.6  222   243   12 PDB  MOLECULE: UNCHARACTERIZED METALLOPROTEIN;                            
  32:  1a5k-C 16.9  3.9  303   566   14 PDB  MOLECULE: UREASE (GAMMA SUBUNIT);                                    
  33:  3cjp-A 16.3  3.4  216   262   13 PDB  MOLECULE: PREDICTED AMIDOHYDROLASE, DIHYDROOROTASE FAMILY;           
  34:  2ffi-A 15.6  3.8  231   273   11 PDB  MOLECULE: 2-PYRONE-4,6-DICARBOXYLIC ACID HYDROLASE, PUTATIV          
  35:  2a3l-A 15.4  3.2  268   616   12 PDB  MOLECULE: AMP DEAMINASE;                                             
  36:  4mup-B 14.8  3.8  226   286   10 PDB  MOLECULE: AMIDOHYDROLASE;                                            
  37:  3irs-A 14.8  4.2  228   281   13 PDB  MOLECULE: UNCHARACTERIZED PROTEIN BB4693;                            
  38:  4ofc-A 14.8  4.0  233   335   13 PDB  MOLECULE: 2-AMINO-3-CARBOXYMUCONATE-6-SEMIALDEHYDE DECARBOX          
  39:  1v77-A 14.5  3.0  185   202   12 PDB  MOLECULE: HYPOTHETICAL PROTEIN PH1877;                               
  40:  4dlf-A 14.4  4.0  237   287   14 PDB  MOLECULE: AMIDOHYDROLASE 2;                                          
  41:  4hk5-D 14.2  4.2  246   380   15 PDB  MOLECULE: URACIL-5-CARBOXYLATE DECARBOXYLASE;                        
  42:  4qrn-A 14.0  3.9  231   352   11 PDB  MOLECULE: 5-CARBOXYVANILLATE DECARBOXYLASE;                          
  43:  2gwg-A 13.9  4.1  243   329   10 PDB  MOLECULE: 4-OXALOMESACONATE HYDRATASE;                               
  44:  2dvt-A 13.9  4.2  232   325   13 PDB  MOLECULE: THERMOPHILIC REVERSIBLE GAMMA-RESORCYLATE DECARBO          
  45:  3pnu-A 13.7  4.8  253   338   15 PDB  MOLECULE: DIHYDROOROTASE;                                            
  46:  1itq-A 13.4  3.6  231   369   13 PDB  MOLECULE: RENAL DIPEPTIDASE;                                         
  47:  2qpx-A 13.1  4.6  237   376   12 PDB  MOLECULE: PREDICTED METAL-DEPENDENT HYDROLASE OF THE TIM-BA          
  48:  4dzi-C 12.7  4.4  233   388   12 PDB  MOLECULE: PUTATIVE TIM-BARREL METAL-DEPENDENT HYDROLASE;             
  49:  3qy6-A 12.1  3.9  203   247    8 PDB  MOLECULE: TYROSINE-PROTEIN PHOSPHATASE YWQE;                         
  50:  1j5s-A 11.8  3.9  224   451    9 PDB  MOLECULE: URONATE ISOMERASE;                                         
  51:  3dcp-A 11.5  3.3  186   277   11 PDB  MOLECULE: HISTIDINOL-PHOSPHATASE;                                    
  52:  3iac-A 10.8  4.0  228   469   10 PDB  MOLECULE: GLUCURONATE ISOMERASE;                                     
  53:  3au2-A 10.1  5.2  194   575   12 PDB  MOLECULE: DNA POLYMERASE BETA FAMILY (X FAMILY);                     
  54:  1m65-A  9.4  3.9  183   234   13 PDB  MOLECULE: HYPOTHETICAL PROTEIN YCDX;                                 
  55:  3f2b-A  9.3  7.0  185   994    9 PDB  MOLECULE: DNA-DIRECTED DNA POLYMERASE III ALPHA CHAIN;               
  56:  1bks-A  7.7  3.7  172   255    9 PDB  MOLECULE: TRYPTOPHAN SYNTHASE;                                       
  57:  2yb1-A  7.2  4.4  162   284   10 PDB  MOLECULE: AMIDOHYDROLASE;                                            
  58:  2anu-A  7.1  3.3  147   224   10 PDB  MOLECULE: HYPOTHETICAL PROTEIN TM0559;                               
  59:  3e38-A  6.4  3.9  167   342    8 PDB  MOLECULE: TWO-DOMAIN PROTEIN CONTAINING PREDICTED PHP-LIKE           


Pairwise Structural Alignments

Notation: three-state secondary structure definitions by DSSP (reduced to H=helix, E=sheet, L=coil) are shown above the amino acid sequence. Structurally equivalent residues are in uppercase, structurally non-equivalent residues (e.g. in loops) are in lowercase. Amino acid identities are marked by vertical bars.

No 1: Query=1k6wA Sbjct=1k6wA Z-score=75.4

back to top
DSSP  LLLEEEEELLLLLLLEEEEEEELLEEEEEEEELLLLLLLLLEEELLLLEEELLEEEEEEL
Query ALQTIINARLPGEEGLWQIHLQDGKISAIDAQSGVMPITENSLDAEQGLVIPPFVEPHIH   60
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct ALQTIINARLPGEEGLWQIHLQDGKISAIDAQSGVMPITENSLDAEQGLVIPPFVEPHIH   60
DSSP  LLLEEEEELLLLLLLEEEEEEELLEEEEEEEELLLLLLLLLEEELLLLEEELLEEEEEEL


DSSP  LLLLLLLLLLLLLLLLLHHHHHHHHHLLHHHLLHHHHHHHHHHHHHHHHHLLEEEEEEEE
Query LDTTQTAGQPNWNQSGTLFEGIERWAERKALLTHDDVKQRAWQTLKWQIANGIQHVRTHV  120
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct LDTTQTAGQPNWNQSGTLFEGIERWAERKALLTHDDVKQRAWQTLKWQIANGIQHVRTHV  120
DSSP  LLLLLLLLLLLLLLLLLHHHHHHHHHLLHHHLLHHHHHHHHHHHHHHHHHLLEEEEEEEE


DSSP  ELLLLLLHHHHHHHHHHHHHLLLLEEEEEEELLLLLLLLLLHHHHHHHHHHLLLLEEEEL
Query DVSDATLTALKAMLEVKQEVAPWIDLQIVAFPQEGILSYPNGEALLEEALRLGADVVGAI  180
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct DVSDATLTALKAMLEVKQEVAPWIDLQIVAFPQEGILSYPNGEALLEEALRLGADVVGAI  180
DSSP  ELLLLLLHHHHHHHHHHHHHLLLLEEEEEEELLLLLLLLLLHHHHHHHHHHLLLLEEEEL


DSSP  HHHLLLHHHHHHHHHHHHHHHHHHLLEEEEEELLLLLLLLLHHHHHHHHHHHHLLHHHEE
Query PHFEFTREYGVESLHKTFALAQKYDRLIDVHCDEIDDEQSRFVETVAALAHHEGMGARVT  240
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct PHFEFTREYGVESLHKTFALAQKYDRLIDVHCDEIDDEQSRFVETVAALAHHEGMGARVT  240
DSSP  HHHLLLHHHHHHHHHHHHHHHHHHLLEEEEEELLLLLLLLLHHHHHHHHHHHHLLHHHEE


DSSP  EEELHHHHHLLHHHHHHHHHHHHHHLLEEEELHHHHHHHLLLLLLLLLLLLLLLHHHHHH
Query ASHTTAMHSYNGAYTSRLFRLLKMSGINFVANPLVNIHLQGRFDTYPKRRGITRVKEMLE  300
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct ASHTTAMHSYNGAYTSRLFRLLKMSGINFVANPLVNIHLQGRFDTYPKRRGITRVKEMLE  300
DSSP  EEELHHHHHLLHHHHHHHHHHHHHHLLEEEELHHHHHHHLLLLLLLLLLLLLLLHHHHHH


DSSP  LLLLEEELLLLLLLLLLLLLLLLHHHHHHHHHHHLLLLLHHHHHHHHHHHLHHHHHHLLL
Query SGINVCFGHDDVFDPWYPLGTANMLQVLHMGLHVCQLMGYGQINDGLNLITHHSARTLNL  360
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct SGINVCFGHDDVFDPWYPLGTANMLQVLHMGLHVCQLMGYGQINDGLNLITHHSARTLNL  360
DSSP  LLLLEEELLLLLLLLLLLLLLLLHHHHHHHHHHHLLLLLHHHHHHHHHHHLHHHHHHLLL


DSSP  LLLLLLLLLLLLEEEELLLLHHHHHHHLLLLLEEEELLEEEEELLLLLEEEELLLEEEEL
Query QDYGIAAGNSANLIILPAENGFDALRRQVPVRYSVRGGKVIASTQPAQTTVYLEQPEAID  420
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct QDYGIAAGNSANLIILPAENGFDALRRQVPVRYSVRGGKVIASTQPAQTTVYLEQPEAID  420
DSSP  LLLLLLLLLLLLEEEELLLLHHHHHHHLLLLLEEEELLEEEEELLLLLEEEELLLEEEEL


DSSP  LLL
Query YKR  423
ident |||
Sbjct YKR  423
DSSP  LLL


No 2: Query=1k6wA Sbjct=4cqbA Z-score=50.0

back to top
DSSP  ---LLLEEEEELLLLLLLEEEEEEELLEEEEEEEEllllllLLLEEELLLLEEELLEEEE
Query ---ALQTIINARLPGEEGLWQIHLQDGKISAIDAQsgvmpiTENSLDAEQGLVIPPFVEP   57
ident        | || |        |      |  | |            ||   || | ||  
Sbjct skdFDLIIRNAYLSEKDSVYDIGIVGDRIIKIEAK--iegtVKDEIDAKGNLVSPGFVDA   58
DSSP  lllEEEEEEEEEELLLLEEEEEEEELLEEEEEELL--llllEEEEEELLLLLEEELEEEE


DSSP  EELLLLLLLLLL---lLLLLLLLH-HHHHHHHHLLHHHLLHHHHHHHHHHHHHHHHHLLE
Query HIHLDTTQTAGQ---pNWNQSGTL-FEGIERWAERKALLTHDDVKQRAWQTLKWQIANGI  113
ident | | |   |                   ||         ||   |         |   | 
Sbjct HTHMDKSFTSTGerlpKFWSRPYTrDAAIEDGLKYYKNATHEEIKRHVIEHAHMQVLHGT  118
DSSP  EELHHHLLLLLLllllLLLLLLLLhHHHHHHHHHHHHHLLHHHHHHHHHHHHHHHHHLLE


DSSP  EEEEEEEELLLL-LLHHHHHHHHHHHHHLLLLEEEEEEELLLLLLLLLLHHHHHHHHHHL
Query QHVRTHVDVSDA-TLTALKAMLEVKQEVAPWIDLQIVAFPQEGILSYPNGEALLEEALRL  172
ident    ||||||       |  | || | |    || | ||| | |       | |    |  
Sbjct LYTRTHVDVDSVaKTKAVEAVLEAKEELKDLIDIQVVAFAQSGFFVDLESESLIRKSLDM  178
DSSP  EEEEEEEELLLLlLLHHHHHHHHHHHHLLLLLEEEEEEELLLLLLLLLLHHHHHHHHHHH


DSSP  LLLEEEEL-HHHLLLhhHHHHHHHHHHHHHHHHLLEEEEEElLLLLLLL-LHHHHHHHHH
Query GADVVGAI-PHFEFTreYGVESLHKTFALAQKYDRLIDVHCdEIDDEQS-RFVETVAALA  230
ident | | ||   |           ||   | ||  ||  || |                |   
Sbjct GCDLVGGVdPATREN--NVEGSLDLCFKLAKEYDVDIDYHI-HDIGTVGvYSINRLAQKT  235
DSSP  LLLEEELLlLLLLLL--LHHHHHHHHHHHHHHLLLEEEEEE-LLLHHHHhHHHHHHHHHH


DSSP  HHHLLHHHEEEEELHHHHHLLHHHHHHHHHHHHHHLLEEEELHHHHhhhllllllllllL
Query HHEGMGARVTASHTTAMHSYNGAYTSRLFRLLKMSGINFVANPLVNihlqgrfdtypkrR  290
ident    |   ||| ||                 | | ||  ||                    
Sbjct IENGYKGRVTTSHAWCFADAPSEWLDEAIPLYKDSGMKFVTCFSST-------------P  282
DSSP  HHLLLLLLEEEEELLHHHHLLHHHHHHHHHHHHHHLLEEEEELLLL-------------L


DSSP  LLLLHHHHHHLLLLEEELLLLLLLLLLLLLLLLHHHHHHHHHHHLLLLLHHHHHHHHHHH
Query GITRVKEMLESGINVCFGHDDVFDPWYPLGTANMLQVLHMGLHVCQLMGYGQINDGLNLI  350
ident     |   || |||     |   | | | |   | |          |            |
Sbjct PTMPVIKLLEAGINLGCASDNIRDFWVPFGNGDMVQGALIETQRLELKTNRDLGLIWKMI  342
DSSP  LLLLHHHHHHLLLEEEEELLLLLLLLLLLLLLLHHHHHHHHHHHHLLLLHHHHHHHHHHH


DSSP  LHHHHHHLLL-LLLLLLLLLLLLEEEELLLLHHHHHHHLLLLLEEEELLEEEEELLllle
Query THHSARTLNL-QDYGIAAGNSANLIILPAENGFDALRRQVPVRYSVRGGKVIASTQpaqt  409
ident |   || |     |||  |  | |  |       |   |         |  |        
Sbjct TSEGARVLGIeKNYGIEVGKKADLVVLNSLSPQWAIIDQAKRLCVIKNGRIIVKDE----  398
DSSP  LHHHHHHHLLhHHLLLLLLLLLLEEEELLLLHHHHHHHLLLEEEEEELLEEEEELL----


DSSP  eeellleeeellll
Query tvyleqpeaidykr  423
ident               
Sbjct ----------viva  402
DSSP  ----------eell


No 3: Query=1k6wA Sbjct=2oofA Z-score=35.0

back to top
DSSP  --lLLEEEEELLL---------LLLLEEEEEEELLEEEEEEEELLlLLLLLLEEELLLLE
Query --aLQTIINARLP---------GEEGLWQIHLQDGKISAIDAQSGvMPITENSLDAEQGL   49
ident         |             |           | | |               |    |
Sbjct lncERVWLNVTPAtlrsdladyGLLEPHALGVHEGRIHALVPXQD-LKYPAHWQDXKGKL   59
DSSP  lllLEEEEEEEELlllllllllLLLLLEEEEEELLEEEEEEEHHH-LLLLLLLEELLLLE


DSSP  EELLEEEEEELLLLllLLLLlLLLLL----------llhHHHHHHHHLLHHHLLHHHHHH
Query VIPPFVEPHIHLDTtqTAGQpNWNQS----------gtlFEGIERWAERKALLTHDDVKQ   99
ident | |     | ||                             ||            |    
Sbjct VTPGLIDCHTHLIF-aGSRA-EEFELrqkgvpyaeiarkGGGIISTVRATRAASEDQLFE  117
DSSP  EEELEEEEEELLLL-lLLLH-HHHHHhhhlllhhhhhhlLLLHHHHHHHHHHLLHHHHHH


DSSP  HHHHHHHHHHHLLEEEEEEEEE-lLLLL--LHHHHHHHHHHHHHllLLEEEEEEE-LLLL
Query RAWQTLKWQIANGIQHVRTHVD-vSDAT--LTALKAMLEVKQEVapWIDLQIVAF-PQEG  155
ident  |    |  |  |   |             |  |             |            
Sbjct LALPRVKSLIREGVTTVEIKSGygLTLEdeLKXLRVARRLGEAL--PIRVKTTLLaAHAV  175
DSSP  HHHHHHHHHHHHLEEEEEEELLllLLHHhhHHHHHHHHHHHHHL--LLEEEEEEEeELLL


DSSP  -------lLLLL-LHHH-HHHHHHH-LLLLEEEELHHHLllhhHHHHHHHHHHHHHHHHL
Query -------iLSYP-NGEA-LLEEALR-LGADVVGAIPHFEftreYGVESLHKTFALAQKYD  205
ident          |            |     || |                       |  | 
Sbjct ppeyrddpDSWVeTICQeIIPAAAEaGLADAVDVFCEHI---gFSLAQTEQVYLAADQYG  232
DSSP  lhhhlllhHHHHhHHHHlHHHHHHHlLLLLEEEEEELLL---lLLHHHHHHHHHHHHHLL


DSSP  LEEEEEELLLLLllLLHHHHHHHHHhhhllhhHEEEEELHHHhhllhhhHHHHHHHHHHH
Query RLIDVHCDEIDDeqSRFVETVAALAhhegmgaRVTASHTTAMhsyngayTSRLFRLLKMS  265
ident      | |             |               |                  |   
Sbjct LAVKGHXDQLSN--LGGSTLAANFG-------ALSVDHLEYL-------DPEGIQALAHR  276
DSSP  LEEEEEELLLLL--LLHHHHHHHLL-------LLEEEELLLL-------LHHHHHHHHHH


DSSP  LLEEEELHHHHHHHLLllllllllLLLLLHHHHHHLLLLEEELLLLLlLLLLlLLLLlHH
Query GINFVANPLVNIHLQGrfdtypkrRGITRVKEMLESGINVCFGHDDVfDPWYpLGTAnML  325
ident |      |     |               |      |       |               
Sbjct GVVATLLPTAFYFLKE--------TKLPPVVALRKAGVPXAVSSDIN-PGTA-PIVS-LR  325
DSSP  LLEEEELHHHHHHLLL--------LLLLLHHHHHHLLLLEEELLLLL-LLLL-LLLL-HH


DSSP  HHHHHHHHHLLLllhhHHHHHHHHHLHHHHHHLL-LLLL-LLLLLLLLLEEEELLLLHHH
Query QVLHMGLHVCQLmgygQINDGLNLITHHSARTLN-LQDY-GIAAGNSANLIILPAENGFD  383
ident            |             | | || |           |  |            
Sbjct XAXNXACTLFGL----TPVEAXAGVTRHAARALGeQEQLgQLRVGXLADFLVWNCGHPAE  381
DSSP  HHHHHHHHHHLL----LHHHHHHHLLHHHHHHLLlLLLLlLLLLLLLLLEEEELLLLLLH


DSSP  HHHHL--LLLLEEEELLEEEEEllllleeeellleeeellll
Query ALRRQ--VPVRYSVRGGKVIAStqpaqttvyleqpeaidykr  423
ident              |  |                         
Sbjct LSYLIgvDQLVSRVVNGEETLH--------------------  403
DSSP  HHHLLllLLEEEEEELLEELLL--------------------


No 4: Query=1k6wA Sbjct=1j6pA Z-score=34.3

back to top
DSSP  LLLEEE-EELL---LLLLLEEEEEEELLEEEEEEEEllLLLLlllEEELLLLEEELLEEE
Query ALQTII-NARL---PGEEGLWQIHLQDGKISAIDAQsgVMPItenSLDAEQGLVIPPFVE   56
ident     |     |     |          | |                ||    || |    
Sbjct HHXIIGnCLILkdfSSEPFWGAVEIENGTIKRVLQG--EVKV---DLDLSGKLVXPALFN   55
DSSP  LEEEEEeEEELlllLLLLEEEEEEEELLEEEEEEEL--LLLL---LEELLLEEEEELEEE


DSSP  EEELLLLLLLLLlllLLLLLLHHHHH-HHHHLLHHHLLHHHHHHHHHHHHHHHHHLLEEE
Query PHIHLDTTQTAGqpnWNQSGTLFEGI-ERWAERKALLTHDDVKQRAWQTLKWQIANGIQH  115
ident  | |   |   |           |            ||                  ||  
Sbjct THTHAPXTLLRG---VAEDLSFEEWLfSKVLPIEDRLTEKXAYYGTILAQXEXARHGIAG  112
DSSP  EEELHHHHHHLL---LLLLLLHHHHHhLLHHHHHLLLLHHHHHHHHHHHHHHHHLLLEEE


DSSP  EEEEEEllllllhHHHHHHHHHHHHllLLEEEEEEELlllLLLLLLHhHHHHHHHHLLL-
Query VRTHVDvsdatltALKAMLEVKQEVapWIDLQIVAFPqegILSYPNGeALLEEALRLGA-  174
ident                                           |         |       
Sbjct FVDXYF-------HEEWIAKAVRDF--GXRALLTRGL---VDSNGDD-GGRLEENLKLYn  159
DSSP  EEEEEL-------LHHHHHHHHHHH--LLEEEEEEEE---LLLLLLL-LLHHHHHHHHHh


DSSP  ----------LEEEE-LHHHLllhhhHHHHHHHHHHHHHHHLLEEEEEELLLLLLLLLhH
Query ----------DVVGA-IPHFEftreyGVESLHKTFALAQKYDRLIDVHCDEIDDEQSRfV  223
ident              |   |          | |   |  |         |  |   |     
Sbjct ewngfegrifVGFGPhSPYLC-----SEEYLKRVFDTAKSLNAPVTIHLYETSKEEYD-L  213
DSSP  hhllhhhleeEEEEElLLLLL-----LHHHHHHHHHHHHHHLLLEEEEELLLLLLLLL-L


DSSP  HHHHH-HHHHhllhhHEEEEELHHHhhllhhhHHHHHHHHHHHLLEEEELHHHHHHHLLl
Query ETVAA-LAHHegmgaRVTASHTTAMhsyngayTSRLFRLLKMSGINFVANPLVNIHLQGr  282
ident |                 | |             | |  ||        ||  |  |   
Sbjct EDILNiGLKE----vKTIAAHCVHL-------PERYFGVLKDIPFFVSHNPASNLKLGN-  261
DSSP  HHHHLlLLLL----lLEEEEELLLL-------LHHHHHHHLLLLEEEEELHHHHHHLLL-


DSSP  llllllllLLLLHHHHHHLLLLEEELLLLLLlllLLLLlLLHHHHHHHHHHHLL--LLLH
Query fdtypkrrGITRVKEMLESGINVCFGHDDVFdpwYPLGtANMLQVLHMGLHVCQ--LMGY  340
ident         ||  |    | |  |  | |            |                   
Sbjct --------GIAPVQRXIEHGXKVTLGTDGAA---SNNS-LNLFFEXRLASLLQKaqNPRN  309
DSSP  --------LLLLHHHHHHLLLEEEELLLLLL---LLLL-LLHHHHHHHHHHHHHllLLLL


DSSP  hHHHHHHHHHLHHHHHHLlLLLL-LLLLLLLLLEEEELL---------lLHHHHHHHLL-
Query gQINDGLNLITHHSARTLnLQDY-GIAAGNSANLIILPA---------eNGFDALRRQV-  389
ident    |  |   |   |          |  |  | |                          
Sbjct lDVNTCLKXVTYDGAQAX-GFKSgKIEEGWNADLVVIDLdlpexfpvqnIKNHLVHAFSg  368
DSSP  lLHHHHHHHHLHHHHHHH-LLLLlLLLLLLLLLEEEEELllhhhllhhhHHHHHHHLLLl


DSSP  LLLEEEELLEEEEELL-----llleeeellleeeellll
Query PVRYSVRGGKVIASTQ-----paqttvyleqpeaidykr  423
ident  |      || |                           
Sbjct EVFATXVAGKWIYFDGeyptidseevkrelariekelys  407
DSSP  LLLEEEELLEEEEELLllllllhhhhhhhhhhhhhhhhl


No 5: Query=1k6wA Sbjct=3ls9A Z-score=32.9

back to top
DSSP  lLLEEEE-ELLL------LLLLEEEEEEELLEEEEEEEEllllllLLLEEELLLLEEELL
Query aLQTIIN-ARLP------GEEGLWQIHLQDGKISAIDAQsgvmpiTENSLDAEQGLVIPP   53
ident     |    |         |     |     || |               |       | 
Sbjct -MILIRGlTRVItfddqeRELEDADILIDGPKIVAVGKD-lsdrsVSRTIDGRGMIALPG   58
DSSP  -LEEEEEeEEEEllllllLEEEEEEEEEELLEEEEEELL-lllllLLEEEELLLEEEEEL


DSSP  EEEEEELLLLLLLLLLlLLLLLLLHHHHHHHH-HLLHHH-----LLHHHHHHHHHHHHHH
Query FVEPHIHLDTTQTAGQpNWNQSGTLFEGIERW-AERKAL-----LTHDDVKQRAWQTLKW  107
ident     | ||               |     |                 |     |   |  
Sbjct LINSHQHLYEGAMRAI-PQLERVTMASWLEGVlTRSAGWwrdgkFGPDVIREVARAVLLE  117
DSSP  EEEEEELHHHHHHLLL-HHHLLLLHHHHHHHHhHHHHHHhhlllLLHHHHHHHHHHHHHH


DSSP  HHHLLEEEEEEEEELLL-LLLHhhHHHHHHHHHHL-LLLEEEEEEELllLLLL-------
Query QIANGIQHVRTHVDVSD-ATLTalKAMLEVKQEVA-PWIDLQIVAFPqeGILS-------  158
ident     ||  |         ||                  |            |        
Sbjct SLLGGITTVADQHLFFPgATAD--SYIDATIEAATdLGIRFHAARSS--MTLGkseggfc  173
DSSP  HHHLLEEEEEEEELLLLlLLLL--LHHHHHHHHHHhHLLEEEEEELL--LLLLhhhllll


DSSP  ----LLLHhHHHHHHHHLLL-------------LEEEE-LHHHLllhhhHHHHHHHHHHH
Query ----YPNGeALLEEALRLGA-------------DVVGA-IPHFEftreyGVESLHKTFAL  200
ident                                     |              |        
Sbjct ddlfVEPV-DRVVQHCLGLIdqyhepepfgmvrIALGPcGVPYD-----KPELFEAFAQM  227
DSSP  lhhhLLLH-HHHHHHHHHHHhhhlllllllleeEEELLlLLLLL-----LHHHHHHHHHH


DSSP  HHHHLLEEEEEELLLL-LLLL------LHHHHHH-HHHHhhllHHHEEEEELHHHhhllh
Query AQKYDRLIDVHCDEID-DEQS------RFVETVA-ALAHhegmGARVTASHTTAMhsyng  252
ident |  ||     |  |      |                        ||   |         
Sbjct AADYDVRLHTHFYEPLdAGMSdhlygmTPWRFLEkHGWA----SDRVWLAHAVVP-----  278
DSSP  HHHHLLEEEEEELLLLhHHHHhhhhllLHHHHHHhLLLL----LLLEEEEELLLL-----


DSSP  hhHHHHHHHHHHHLLEEEELHHHHHHHLLlllllllllLLLLHHHHHHLLLLEEELLLLL
Query ayTSRLFRLLKMSGINFVANPLVNIHLQGrfdtypkrrGITRVKEMLESGINVCFGHDDV  312
ident              |                        |     | |  || | ||    
Sbjct --PREEIPEFADAGVAIAHLIAPDLRMGW---------GLAPIREYLDAGITVGFGTTGS  327
DSSP  --LHHHHHHHHHHLLEEEELHHHHHHLLL---------LLLLHHHHHHLLLEEEELLLLL


DSSP  LlllLLLLlLLHHHHHHHHHHHLL------lllhhHHHHHHHHHLHHHHHHLLLLLL-LL
Query FdpwYPLGtANMLQVLHMGLHVCQ------lmgygQINDGLNLITHHSARTLNLQDY-GI  365
ident        |  | |  |                        |   |  ||  |   |    
Sbjct A---SNDG-GNLLGDLRLAALAHRpadpnepekwlSARELLRMATRGSAECLGRPDLgVL  383
DSSP  L---LLLL-LLHHHHHHHHHHHLHhhllllhhhllLHHHHHHHLLHHHHHHLLLLLLlLL


DSSP  LLLLLLLEEEELL---------LLHHHHHHH--LLLLLEEEELLEEEEELL-llleeeel
Query AAGNSANLIILPA---------ENGFDALRR--QVPVRYSVRGGKVIASTQ-paqttvyl  413
ident   |  |                                  |  | |              
Sbjct EEGRAADIACWRLdgvdrvgvhDPAIGLIMTglSDRASLVVVNGQVLVENErpvladler  443
DSSP  LLLLLLLEEEEELllhhhllllLHHHHHHHLllLLLLLEEEELLEEEEELLeellllhhh


DSSP  lleeeellll
Query eqpeaidykr  423
ident           
Sbjct ivanttalip  453
DSSP  hhhhhhhhll


No 6: Query=1k6wA Sbjct=2pajA Z-score=32.6

back to top
DSSP  LLLEEEE-ELLL-----------LLLLeEEEEEELLEEEEEEEelllLLLL--LLEEELL
Query ALQTIIN-ARLP-----------GEEGlWQIHLQDGKISAIDAqsgvMPIT--ENSLDAE   46
ident     | | |                 |   |      | || |          |   || 
Sbjct PSTLIRNaAAIMtggrgtaddpsRVPG-PDIRIVGDTIDAIGA----LAPRpgETIVDAT   55
DSSP  LEEEEELlLEELlllllllllllLLLL-LLEEEELLEEEEELL----LLLLllLEEEELL


DSSP  LLEEELLEEEEEELLLLLLLLLlllllllllhhhhhhhhhlLHHHLLHHHHHHHHHHHHH
Query QGLVIPPFVEPHIHLDTTQTAGqpnwnqsgtlfegierwaeRKALLTHDDVKQRAWQTLK  106
ident      |  |  | ||      |                     ||         |   | 
Sbjct DCVIYPAWVNTHHHLFQSLLKG-----------------epFRALFDERRFRLAARIGLI   98
DSSP  LLEEEELEELLLLLHHHHHLLL-----------------llLHHHLLHHHHHHHHHHHHH


DSSP  HHHHLLEEEEEEEEELLLLLLHhhHHHHHHHHHHL-LLLEEEEEEELllLLLL-------
Query WQIANGIQHVRTHVDVSDATLTalKAMLEVKQEVA-PWIDLQIVAFPqeGILS-------  158
ident      |   |  |  |                |                           
Sbjct ELARSGCATVADHNYVYYPGMP-fDSSAILFEEAEkLGLRFVLLRGG--ATQTrqleadl  155
DSSP  HHHLLLEEEEEELLLLLLLLLL-lLHHHHHHHHHHhLLLEEEEEELL--LLLLlllllll


DSSP  -----LLLHhHHHHHHHHLLL-------------LEEEE-LHHHLllhhhHHHHHHHHHH
Query -----YPNGeALLEEALRLGA-------------DVVGA-IPHFEftreyGVESLHKTFA  199
ident                     |              |                     | |
Sbjct ptalrPETL-DAYVADIERLAaryhdaspramrrVVMAPtTVLYS----iSPREMRETAA  210
DSSP  lhhhlLLLH-HHHHHHHHHHHhhllllllllleeEEELLlLLLLL----lLHHHHHHHHH


DSSP  HHHHHLLEEEEEELllllLLLLhHHHHH-HHHHhhllHHHEEEEELHHHhhllhhhHHHH
Query LAQKYDRLIDVHCDeiddEQSRfVETVA-ALAHhegmGARVTASHTTAMhsyngayTSRL  258
ident  |         |        |  |             |  |   |               
Sbjct VARRLGLRMHSHLS----GKSP-VAFCGeHDWL----GSDVWYAHLVKV-------DADE  254
DSSP  HHHHLLLEEEEELL----LLLH-HHHHHhLLLL----LLLEEEELLLLL-------LHHH


DSSP  HHHHHHHLLEEEELHHHHHHHllllllllllllllLHHHHHHLLLLEEELLLLLLlllLL
Query FRLLKMSGINFVANPLVNIHLqgrfdtypkrrgitRVKEMLESGINVCFGHDDVFdpwYP  318
ident   ||   |      |  |  |               | ||   |  |  | |        
Sbjct IALLAQTGTGVAHCPQSNGRL--------------PVREMADAGVPVSIGVDGAA---SN  297
DSSP  HHHHHHHLLEEEELHHHHHLL--------------LLLLHHHHLLLEEELLLHHH---HL


DSSP  LLlLLHHHHHHHHHHHLLLLLhhHHHH-HHHHHLHHHHHHLLLLLL-LLLLLLLLLEEEE
Query LGtANMLQVLHMGLHVCQLMGygQIND-GLNLITHHSARTLNLQDY-GIAAGNSANLIIL  376
ident    | |    ||                     |   ||   |      | |  |     
Sbjct EA-ADMISEVHMTWLAQRARL--ASIAeVIHWGTAGGARVMGLDEVgKVAVGYAADIAVY  354
DSSP  LL-LLHHHHHHHHHHHHHHLL--LLHHhHHHHHLHHHHHHHLLLLLlLLLLLLLLLEEEE


DSSP  LL----------LLHHhHHHHL--LLLLEEEELLEEEEELL---------llleeeelll
Query PA----------ENGFdALRRQ--VPVRYSVRGGKVIASTQ---------paqttvyleq  415
ident                           |      ||                         
Sbjct RLddpryfglhdPAIG-PVASGgrPSVMALFSAGKRVVVDDliegvdikelggearrvvr  413
DSSP  ELllhhhlllllHHHH-HHHLLllLEEEEEEELLEEEEELLllllllhhhhhhhhhhhhh


DSSP  eeeellll
Query peaidykr  423
ident         
Sbjct ellrevvv  421
DSSP  hhhhhhhl


No 7: Query=1k6wA Sbjct=3mtwA Z-score=30.5

back to top
DSSP  -LLLEEEEELLL-----LLLLEEEEEEELLEEEEEEEELlllllLLLEEELLLLEEELLE
Query -ALQTIINARLP-----GEEGLWQIHLQDGKISAIDAQSgvmpiTENSLDAEQGLVIPPF   54
ident         |||                 || |  |              |       |  
Sbjct aEIKAVSAARLLdvasgKYVDNPLVIVTDGRITSIGKKGdavpaGATAVDLPGVTLLPGL   60
DSSP  lLEEEEEEEEEEellllEEEELEEEEEELLEEEEEEELLlllllLLEEEEEEEEEEEELE


DSSP  EEEEELLLLLLLLLlllllllllhhhhhhhHHLLHHHLLhHHHHHHHHHHHHHHHHLLEE
Query VEPHIHLDTTQTAGqpnwnqsgtlfegierWAERKALLThDDVKQRAWQTLKWQIANGIQ  114
ident    | |||     |                                     |     |  
Sbjct IDMHVHLDSLAEVG----------------GYNSLEYSD-RFWSVVQTANAKKTLEAGFT  103
DSSP  EEEEELLLLLLLLL----------------HHHHHHLLH-HHHHHHHHHHHHHHHHLLEE


DSSP  EEEEEEEllllllhHHHHHHHHHHHHL----LLLEEEEE-EELLL---------------
Query HVRTHVDvsdatltALKAMLEVKQEVA----PWIDLQIV-AFPQE---------------  154
ident  ||           |                |                            
Sbjct TVRNVGA-------ADYDDVGLREAIDagyvPGPRIVTAaISFGAtgghcdstffppsmd  156
DSSP  EEEELLL-------LLLHHHHHHHHHHllllLLLEEEELlLLEELlllllllllllhhhl


DSSP  -----LLLLLLLHHHHHHHHHHLLLLEEEELHHH-------lllhhHHHH-HHHHHHHHH
Query -----GILSYPNGEALLEEALRLGADVVGAIPHF-------eftreYGVE-SLHKTFALA  201
ident         |              || |                                |
Sbjct qknpfNSDSPDEARKAVRTLKKYGAQVIXICATGgvfsrgnepgqqQLTYeEMKAVVDEA  216
DSSP  lllllLLLLHHHHHHHHHHHHHLLLLEEEEELLLllllllllllllLLLHhHHHHHHHHH


DSSP  HHHLLEEEEEELllllllLLHHHHHHHHHhhhllhhhEEEEELHHHhhllhhhHHHHHHH
Query QKYDRLIDVHCDeiddeqSRFVETVAALAhhegmgarVTASHTTAMhsyngayTSRLFRL  261
ident          |                            |  |                 |
Sbjct HMAGIKVAAHAH-----gASGIREAVRAG-------vDTIEHASLV-------DDEGIKL  257
DSSP  HHLLLEEEEEEL-----lHHHHHHHHHLL-------lLEEEELLLL-------LHHHHHH


DSSP  HHHHLLEEEELHHHHHH----------------HLLLlllllllLLLL-LHHHHHHLLLL
Query LKMSGINFVANPLVNIH----------------LQGRfdtypkrRGIT-RVKEMLESGIN  304
ident     |  |                                              |  |  
Sbjct AVQKGAYFSMDIYNTDYtqaegkkngvlednlrKDRD-----igELQReNFRKALKAGVK  312
DSSP  HHHHLLEEELLLLLHHHhhhhhhhhlllhhhhhHHHH-----hhHHHHhHHHHHHHHLLE


DSSP  EEELLLLLLlllllLLLLLHHHHHHHHHhHLLLllhhHHHHHHHHHLHHHHHHLL-LLLL
Query VCFGHDDVFdpwypLGTANMLQVLHMGLhVCQLmgygQINDGLNLITHHSARTLN-LQDY  363
ident    | |                                        |   |  |    | 
Sbjct MVYGTDAGI-----YPHGDNAKQFAVMV-RYGA----TPLQAIQSATLTAAEALGrSKDV  362
DSSP  EELLLLLLL-----LLLLLHHHHHHHHH-HLLL----LHHHHHHHLLHHHHHHHLlLLLL


DSSP  -LLLLLLLLLEEEELLlLHHHHHHHLLLLLEEEELLEEEEELlllleeeellleeeelll
Query -GIAAGNSANLIILPAeNGFDALRRQVPVRYSVRGGKVIASTqpaqttvyleqpeaidyk  422
ident    | |     |                      || |                      
Sbjct gQVAVGRYGDMIAVAG-DPLADVTTLEKPVFVMKGGAVVKAP------------------  403
DSSP  lLLLLLLLLLEEEELL-LLLLLHHHHHLLLEEEELLEEEELL------------------


DSSP  l
Query r  423
ident  
Sbjct x  404
DSSP  l


No 8: Query=1k6wA Sbjct=2uz9A Z-score=30.0

back to top
DSSP  -LLLEEEEELL-------LLLLLEEEEEEEL-LEEEEEEEEL-------lllllLLLEEE
Query -ALQTIINARL-------PGEEGLWQIHLQD-GKISAIDAQS-------gvmpiTENSLD   44
ident                               | |||      |                  
Sbjct pLAHIFRGTFVhstwtcpMEVLRDHLLGVSDsGKIVFLEEASqqeklakewcfkPCEIRE   60
DSSP  lLLEEEEEEEEellllllLEEEEEEEEEELLlLLEEEEEEHHhhhhhhhhhlllHHHEEE


DSSP  LL-LLEEELLEEEEEELLLLLLLllllllllLLLH--HHHHHHHHLL-hhhLLHHHHHHH
Query AE-QGLVIPPFVEPHIHLDTTQTagqpnwnqSGTL--FEGIERWAER-kalLTHDDVKQR  100
ident         |  |  |||                                     |     
Sbjct LShHEFFMPGLVDTHIHASQYSF----agssIDLPllEWLTKYTFPAehrfQNIDFAEEV  116
DSSP  LLlLLEEEELEEEEEEEHHHHHH----llllLLLLhhHHHHHLHHHHhhhhHLHHHHHHH


DSSP  HHHHHHHHHHLLEEEEEEEEELLlllLHHHHHHHHHHHHHllLLEEEEEEELllLLLL--
Query AWQTLKWQIANGIQHVRTHVDVSdatLTALKAMLEVKQEVapWIDLQIVAFPqeGILS--  158
ident           ||                                            |   
Sbjct YTRVVRRTLKNGTTTACYFATIH---TDSSLLLADITDKF--GQRAFVGKVC--MDLNdt  169
DSSP  HHHHHHHHHHLLEEEEEEELLLL---HHHHHHHHHHHHHH--LLEEEEELEE--LLLLll


DSSP  -------LLLHHHHHHHHHHLL--------LLEEEE-LHHHLllhhhHHHHHHHHHHHHH
Query -------YPNGEALLEEALRLG--------ADVVGA-IPHFEftreyGVESLHKTFALAQ  202
ident                |                 |                        | 
Sbjct fpeyketTEESIKETERFVSEMlqknysrvKPIVTPrFSLSC-----SETLMGELGNIAK  224
DSSP  lllllllHHHHHHHHHHHHHHHhhhlllleEEEEEElLHHHL-----LHHHHHHHHHHHH


DSSP  HHLLEEEEEELLLL--LLLL--------LHHHHHHHHHhhhlLHHHEEEEELHHHhhllh
Query KYDRLIDVHCDEID--DEQS--------RFVETVAALAhhegMGARVTASHTTAMhsyng  252
ident   |  |  |  |     |                                |         
Sbjct TRDLHIQSHISENRdeVEAVknlypsykNYTSVYDKNN---lLTNKTVMAHGCYL-----  276
DSSP  HHLLEEEEEELLLHhhHHHHhhhlllllLHHHHHHHLL---lLLLLEEEEELLLL-----


DSSP  hhHHHHHHHHHHHLLEEEELHHHHHHHLLlllllllllLLLLHHHHHHLLLLEEELLLLL
Query ayTSRLFRLLKMSGINFVANPLVNIHLQGrfdtypkrrGITRVKEMLESGINVCFGHDDV  312
ident              |      |  |  |           |   | | |        | |  
Sbjct --SAEELNVFHERGASIAHCPNSNLSLSS---------GFLNVLEVLKHEVKIGLGTDVA  325
DSSP  --LHHHHHHHHHHLLEEEELHHHHHHLLL---------LLLLHHHHHHLLLEEEELLLLL


DSSP  llllLLLLlLLHHHHHHHHHHHLL-------lllhhHHHHHHHHHLHHHHHHLL-LLLL-
Query fdpwYPLGtANMLQVLHMGLHVCQ-------lmgygQINDGLNLITHHSARTLN-LQDY-  363
ident            ||        |                     | |      |       
Sbjct ----GGYS-YSMLDAIRRAVMVSNillinkvnekslTLKEVFRLATLGGSQALGlDGEIg  380
DSSP  ----LLLL-LLHHHHHHHHHHHHHhhhhllllllllLHHHHHHHHLHHHHHHLLlLLLLl


DSSP  LLLLLLLLLEEEELL--------------------lLHHHHHHHLLL--LLEEEELLEEE
Query GIAAGNSANLIILPA--------------------eNGFDALRRQVP--VRYSVRGGKVI  401
ident     |     |                              |             |||  
Sbjct NFEVGKEFDAILINPkasdspidlfygdffgdiseaVIQKFLYLGDDrnIEEVYVGGKQV  440
DSSP  LLLLLLLLLEEEELLlllllllllllhhhhlllllhHHHHHHHHLLHhhEEEEEELLEEE


DSSP  EEllllleeeellleeeellll
Query AStqpaqttvyleqpeaidykr  423
ident                       
Sbjct VP------------------fs  444
DSSP  EL------------------ll


No 9: Query=1k6wA Sbjct=4rdvB Z-score=29.7

back to top
DSSP  llLEEEEELLL---LLLLEEEEEEEL-LEEEEEEEElLLLLLlllEEELLlLEEELLEEE
Query alQTIINARLP---GEEGLWQIHLQD-GKISAIDAQsGVMPItenSLDAEqGLVIPPFVE   56
ident     |   |     |            |    |                  | | |    
Sbjct --SAIFAERALlpeGWARNVRFEISAdGVLAEIRPD-ANADG---AERLG-GAVLPGMPN   53
DSSP  --LEEEEEEEEellEEEEEEEEEELLlLLEEEEELL-LLLLL---LEELL-LLEEELEEE


DSSP  EEELLLLLLLLLLllLLLL----LLHHHHHHHHHLLHHHLLHHHHHHHHHHHHHHHHHLL
Query PHIHLDTTQTAGQpnWNQS----GTLFEGIERWAERKALLTHDDVKQRAWQTLKWQIANG  112
ident  | |      ||                  |      | |        | |        |
Sbjct LHSHAFQRAMAGL--AEVAgnpnDSFWTWRELMYRMVARLSPEQIEVIACQLYIEMLKAG  111
DSSP  EEELHHHHHHLLL--LLLLllllLLHHHHHHHHHHHHLLLLHHHHHHHHHHHHHHHHHHL


DSSP  EEEEEEEEELLL--------lLLHHHHHHHHHHHHHllLLEEEEEEELllLLLL------
Query IQHVRTHVDVSD--------aTLTALKAMLEVKQEVapWIDLQIVAFPqeGILS------  158
ident    |     |                             | |                  
Sbjct YTAVAEFHYVHHdldgrsyadPAELSLRISRAASAA--GIGLTLLPVL--YSHAgfggqp  167
DSSP  EEEEEEEELLLLlllllllllLLHHHHHHHHHHHHH--LLEEEEEELL--LLEEelllee


DSSP  -------lLLHHHHHHHHHHLL---------lLEEEE-LHHHLllhhhHHHHHHHHHHhh
Query -------yPNGEALLEEALRLG---------aDVVGA-IPHFEftreyGVESLHKTFAla  201
ident          ||     | |                                      |  
Sbjct asegqrrfINGSEAYLELLQRLrapleaaghsLGLCFhSLRAV-----TPQQIATVLA--  220
DSSP  llhhhlllLLLHHHHHHHHHHHhhhhhhhlleELEEElLLLLL-----LHHHHHHHHL--


DSSP  HHHL-LEEEEEELLLL--LLLL------LHHHHHH-HHHHhhllHHHEEEEELHHHhhll
Query QKYD-RLIDVHCDEID--DEQS------RFVETVA-ALAHhegmGARVTASHTTAMhsyn  251
ident    |      |  |              |         |       |    | |      
Sbjct AGHDdLPVHIHIAEQQkeVDDCqawsgrRPLQWLYeNVAV----DQRWCLVHATHA----  272
DSSP  LLLLlLLEEEEELLLHhhHHHHhhhhllLHHHHHHhHLLL----LLLEEEEELLLL----


DSSP  hhhHHHHHHHHHHHLLEEEELHHHHHHHLllllllllllLLLLHHHHHHLLLLEEELLLL
Query gayTSRLFRLLKMSGINFVANPLVNIHLQgrfdtypkrrGITRVKEMLESGINVCFGHDD  311
ident              ||            |           ||      |  |     | | 
Sbjct ---DPAEVAAMARSGAVAGLCLSTEANLG---------dGIFPATDFLAQGGRLGIGSDS  320
DSSP  ---LHHHHHHHHHHLLEEEELHHHHHHLL---------lLLLLHHHHHHLLLEEEELLLL


DSSP  LlllllllLLLLHHHHHHHHHHHL--------LLLL---HHHHHHHHHHHLHHHHHHLLL
Query VfdpwyplGTANMLQVLHMGLHVC--------QLMG---YGQINDGLNLITHHSARTLNL  360
ident                 |                |                    |  |  
Sbjct H-------VSLSVVEELRWLEYGQrlrdrkrnRLYRddqPMIGRTLYDAALAGGAQALGQ  373
DSSP  L-------LLLLHHHHHHHHHHHHhhhhllllLLLLlllLLHHHHHHHHHHHHHHHHHLL


DSSP  LLLLLLLLLLLLEEEELL-----------lLHHHHH-HHLL-LLLEEEELLEEEEELL--
Query QDYGIAAGNSANLIILPA-----------eNGFDAL-RRQV-PVRYSVRGGKVIASTQ--  405
ident      | |  | |  |                   |       ||     |         
Sbjct PIGSLAVGRRADLLVLDGndpylasaegdaLLNRWLfAGGDrQVRDVMVAGRWVVRDGrh  433
DSSP  LLLLLLLLLLLLEEEELLllhhhhllllhhHHHHHHhHLLHhHEEEEEELLEEEELLLll


DSSP  llleeeellleeeellll
Query paqttvyleqpeaidykr  423
ident                   
Sbjct ageersarafvqvlgell  451
DSSP  llhhhhhhhhhhhhhhhl


No 10: Query=1k6wA Sbjct=3mkvA Z-score=28.7

back to top
DSSP  -LLLEEEEELLL-----LLLLEEEEEEELLEEEEEEEELlllllLLLEEELLLLEEELLE
Query -ALQTIINARLP-----GEEGLWQIHLQDGKISAIDAQSgvmpiTENSLDAEQGLVIPPF   54
ident        |  |             |   || |                 |       |  
Sbjct lTTFLFRNGALLdpdhpDLLQGFEILIEDGFIREVSDKP-ikssNAHVIDVKGKTIMPGL   59
DSSP  lLEEEEEEEEELlllllLLEEEEEEEEELLEEEEEELLL-llllLLEEEELLLLEEEELE


DSSP  EEEEELLLlLLLLllllllllllhhhHHHHHHllhhHLLHHHHHHHHHHHHHHHHHLLEE
Query VEPHIHLDtTQTAgqpnwnqsgtlfeGIERWAerkaLLTHDDVKQRAWQTLKWQIANGIQ  114
ident    | |                       | |     |    |  ||          |  
Sbjct IDLHVHVV-AIEF-------------NLPRVA----TLPNVLVTLRAVPIMRAMLRRGFT  101
DSSP  EEEEELLL-LLLL-------------LHHHHL----LLLHHHHHHHHHHHHHHHHHLLEE


DSSP  EEEEEEEllllllhhhhhHHHHHHHHL----LLLEEEEE-EELLL---------------
Query HVRTHVDvsdatltalkaMLEVKQEVA----PWIDLQIV-AFPQE---------------  154
ident  ||                   || |         |                        
Sbjct TVRDAGG----------aGYPFKQAVEsglvEGPRLFVSgRALSQtgghadprarsdymp  151
DSSP  EEEELLL----------lLHHHHHHHHllllLLLEEEELlLEEELlllllllllllllll


DSSP  ----------------LLLLLLLHHHHHHHHHHLLLLEEEELHHH--------lllhhHH
Query ----------------GILSYPNGEALLEEALRLGADVVGAIPHF--------eftreYG  190
ident                              | |  |||                     | 
Sbjct pdspcgccvrvgalgrVADGVDEVRRAVREELQMGADQIXIMASGgvasptdpvgvfgYS  211
DSSP  lllllllllllllleeELLLHHHHHHHHHHHHHHLLLLEEEELLLlllllllllllllLL


DSSP  HHHHHHHHHHHHHHLLEEEEEELllllllLLHHHHHHHHHhhhllhhhEEEEELHHHhhl
Query VESLHKTFALAQKYDRLIDVHCDeiddeqSRFVETVAALAhhegmgarVTASHTTAMhsy  250
ident         | ||        |                            |  |       
Sbjct EDEIRAIVAEAQGRGTYVLAHAY-----tPAAIARAVRCG-------vRTIEHGNLI---  256
DSSP  HHHHHHHHHHHHLLLLLEEEEEL-----lHHHHHHHHHLL-------lLEEEELLLL---


DSSP  lhhhHHHHHHHHHHHLLEEEELHHHHHHH---------------LLLLlllllLLLL-lL
Query ngayTSRLFRLLKMSGINFVANPLVNIHL---------------QGRFdtypkRRGI-tR  294
ident          ||    |   |        |                               
Sbjct ----DDETARLVAEHGAYVVPTLVTYDALasegekyglppesiaKIAD----vHGAGlhS  308
DSSP  ----LHHHHHHHHHHLLEEELLHHHHHHHhhhlllllllhhhhlLHHH----hHLLHhhH


DSSP  HHHHHHLLLLEEELLLLLLllllLLLLLLHhHHHHHHHHHLllllhhHHHHHHHHHLHHH
Query VKEMLESGINVCFGHDDVFdpwyPLGTANMlQVLHMGLHVCqlmgygQINDGLNLITHHS  354
ident    |   |    || |                       |                |  |
Sbjct IEIMKRAGVKMGFGTDLLG----EAQRLQS-DEFRILAEVL------SPAEVIASATIVS  357
DSSP  HHHHHHHLLLLLLLLLLLH----HHHHHLL-HHHHHHHLLL------LHHHHHHHLLHHH


DSSP  HHHLLLLL--LLLLLLLLLLEEEELLlLHHHHHHHL----LLLLEEEELLEEEEELLlll
Query ARTLNLQD--YGIAAGNSANLIILPAeNGFDALRRQ----VPVRYSVRGGKVIASTQpaq  408
ident |  |  ||    |  |  |        |                     |          
Sbjct AEVLGMQDklGRIVPGAHADVLVVDG-NPLKSVDCLlgqgEHIPLVMKDGRLFVNEL---  413
DSSP  HHHLLLLLllLLLLLLLLLLEEEELL-LLLLLLLLLllllLLLLEEEELLEEEEELL---


DSSP  eeeellleeeellll
Query ttvyleqpeaidykr  423
ident                
Sbjct --------------e  414
DSSP  --------------l


No 11: Query=1k6wA Sbjct=4c5yA Z-score=27.2

back to top
DSSP  ---LLLEEEEELLL----LLLLEEEEEEELLEEEEEEEELL----llllLLLEEELllLE
Query ---ALQTIINARLP----GEEGLWQIHLQDGKISAIDAQSG----vmpiTENSLDAeqGL   49
ident        |    |                |  |                |          
Sbjct deaKVTIIYAGLLIpgdgEPLRNAALVISDKIIAFVGSEADipkkylrsTQSTHRV--PV   58
DSSP  lllLEEEEEEEEELllllLLEEEEEEEEELLEEEEEEEHHHllhhhhhhLLLEEEE--EE


DSSP  EELLEEEEEELLLllLLLLLLlllllllhhhhhHHHHlLHHHLLHHHHHHHHHHHHHHHH
Query VIPPFVEPHIHLDttQTAGQPnwnqsgtlfegiERWAeRKALLTHDDVKQRAWQTLKWQI  109
ident   |     | |                                       |         
Sbjct LMPGLWDCHMHFG--GDDDYY------------NDYT-SGLATHPASSGARLARGCWEAL  103
DSSP  EEELEEEEEELLL--LLLLLL------------LLLH-HHHHLLHHHHHHHHHHHHHHHH


DSSP  HLLEEEEEEEEellllllhhhhHHHHHHHHHL----LLLEEEEE-EELLL----------
Query ANGIQHVRTHVdvsdatltalkAMLEVKQEVA----PWIDLQIV-AFPQE----------  154
ident  ||    |                 ||                  |              
Sbjct QNGYTSYRDLA----------gYGCEVAKAINdgtiVGPNVYSSgAALSQtaghgdifal  153
DSSP  HLLEEEEEELL----------lLHHHHHHHHHllllLLLEEEELlLEEELllllllllll


DSSP  -------------------------LLLLlLLHHHHHHHHHHLLLLEEEELHHH------
Query -------------------------GILSyPNGEALLEEALRLGADVVGAIPHF------  183
ident                                          | || |             
Sbjct pagevlgsygvmnprpgywgagplcIADGvEEVRRAVRLQIRRGAKVIXVMASGgvmsrd  213
DSSP  lhhhhhhhhlllllllllllllleeELLLhHHHHHHHHHHHHHLLLLEEEELLLllllll


DSSP  --lllhhHHHHHHHHHHHHHHHHLLEEEEEELllllllLLHHHHHHHHHhhhllhhhEEE
Query --eftreYGVESLHKTFALAQKYDRLIDVHCDeiddeqSRFVETVAALAhhegmgarVTA  241
ident           | |      |    |    |                              
Sbjct dnpnfaqFSPEELKVIVEEAARQNRIVSAHVH-----gKAGIMAAIKAG-------cKSL  261
DSSP  lllllllLLHHHHHHHHHHHHHLLLLEEEEEL-----lHHHHHHHHHHL-------lLEE


DSSP  EELHHHhhllhhhHHHHHHHHHHHLLEEEELHHHHHHH--------------LLLLllll
Query SHTTAMhsyngayTSRLFRLLKMSGINFVANPLVNIHL--------------QGRFdtyp  287
ident  |                 | |  ||  ||   |                          
Sbjct EHVSYA-------DEEVWELMKEKGILYVATRSVIEIFlasngeglvkeswaKLQA----  310
DSSP  EELLLL-------LHHHHHHHHHHLLEEELLHHHHHHHhhhllllllllhhhLLLH----


DSSP  lLLLLL-LHHHHHHLLLLEEELLLLLllllllllLLLHHHHHHHHHHHLLLllhhHHHHH
Query kRRGIT-RVKEMLESGINVCFGHDDVfdpwyplgTANMLQVLHMGLHVCQLmgygQINDG  346
ident                |     | |                 |                  
Sbjct lADSHLkAYQGAIKAGVTIALGTDTA-------pGGPTALELQFAVERGGM----TPLEA  359
DSSP  hHHHHHhHHHHHHHLLLLEELLLLLL-------lLLLLHHHHHHHHHLLLL----LHHHH


DSSP  HHHHLHHHHHHLL--LLLL-LLLLLLLLLEEEELLlLHHHHHHHL---LLLLEEEELLEE
Query LNLITHHSARTLN--LQDY-GIAAGNSANLIILPAeNGFDALRRQ---VPVRYSVRGGKV  400
ident     |                   |  |  | |   |             |     ||| 
Sbjct IKAATANAPLSVGpqAPLTgQLREGYEADVIALEE-NPLEDIKVFqepKAVTHVWKGGKL  418
DSSP  HHHHLLLHHHHHHhhLLLLlLLLLLLLLLEEEELL-LLLLLHHHHhlhHHEEEEEELLEE


DSSP  EEELLllleeeellleeeellll
Query IASTQpaqttvyleqpeaidykr  423
ident                        
Sbjct FKGPG-----igpwgedarnpfl  436
DSSP  EELLL-----lllllllllllll


No 12: Query=1k6wA Sbjct=3icjA Z-score=26.7

back to top
DSSP  LLLEEEEELL------LLLLleEEEEEELLEEEEEEEEL----lllllLLLEEELLLLEE
Query ALQTIINARL------PGEEglWQIHLQDGKISAIDAQS----gvmpiTENSLDAEQGLV   50
ident      ||                               |              |     |
Sbjct CMKALINGTIytsfspVKKV--SGLVISNERVLYAGDSStalriaelaGGEIIDLKGKFV   58
DSSP  LEEEEELLEEeeeellEEEE--LEEEEELLEEEEEELHHhhhhhhhhhLLEEEELLLLEE


DSSP  ELLEEEEEELLLLLLLL-------------------------llLLLL------------
Query IPPFVEPHIHLDTTQTA-------------------------gqPNWN------------   73
ident  | |   | |||                                                
Sbjct MPAFFDSHLHLDELGMSlemvdlrgvksmeelvervkkgrgriiFGFGwdqdelgrwptr  118
DSSP  EELEEEEEELHHHHHHHhhleellllllhhhhhhhhhlllllleEEEEelhhhhlllllh


DSSP  --------------LLLL----------------------------hhhhHHHHHLL-HH
Query --------------QSGT----------------------------lfegIERWAER-KA   90
ident                                                    |        
Sbjct edldvidrpvflyrRCFHvavmnskmidllnlkpskdfdestgivreralEESRKIInEK  178
DSSP  hhhlllllleeeeeLLLLeeeelhhhhhhhllllllleelllleeehhhhHHHHHHHhHL


DSSP  HLLHHHHHHHHHHHHHHHHHLLEEEEEEEEELllllLHHHHHHHHHH--HHHLllLEEEE
Query LLTHDDVKQRAWQTLKWQIANGIQHVRTHVDVsdatLTALKAMLEVK--QEVApwIDLQI  148
ident  ||  | |             |   |            ||||  |               
Sbjct ILTVKDYKHYIESAQEHLLSLGVHSVGFMSVG----EKALKALFELEreGRLK--MNVFA  232
DSSP  LLLHHHHHHHHHHHHHHHHHLLEEEEEEEEEL----HHHHHHHHHHHhlLLLL--LEEEE


DSSP  EEELlllllllllhhhHHHHHHH-----------llLLEEEELHHH--------------
Query VAFPqegilsypngeaLLEEALR-----------lgADVVGAIPHF--------------  183
ident    |             |   |                 |                    
Sbjct YLSP------------ELLDKLEelnlgkfegrrlrIWGVXLFVDGslgartallsepyt  280
DSSP  EELH------------HHHHHHHhhlllleellleeEEEEEEELLLllllllllllllll


DSSP  -----llLHHHHHHHHHHHHHHHHHHLLEEEEEELllllllLLHHHHHHHHHHHHLLHhh
Query -----efTREYGVESLHKTFALAQKYDRLIDVHCDeiddeqSRFVETVAALAHHEGMGar  238
ident                       |        ||           |               
Sbjct dnpttsgELVMNKDEIVEVIERAKPLGLDVAVHAI-----gDKAVDVALDAFEEAEFS--  333
DSSP  lllllllLLLLLHHHHHHHHHHHLLLLLEEEEEEL-----lHHHHHHHHHHHHHHLLL--


DSSP  EEEEELHHHhhllhhhHHHHHHHHHHHLLEEEELHHHHHHHL-LLLL-LLLLLllLLLHH
Query VTASHTTAMhsyngayTSRLFRLLKMSGINFVANPLVNIHLQ-GRFD-TYPKRrgITRVK  296
ident     |                   |       | |                      | |
Sbjct GRIEHASLV-------RDDQLERIKELKVRISAQPHFIVSDWwIVNRvGEERAkwAYRLK  386
DSSP  LEEEELLLL-------LHHHHHHHHHHLLEEEELLLHHHHLLlHHHHhHHHHHhhLLLHH


DSSP  HHHHlLLLEEELLLLLllllllLLLLLHHHHHHHHHHH------LLLLlhhhHHHHHHHH
Query EMLEsGINVCFGHDDVfdpwypLGTANMLQVLHMGLHV------CQLMgygqINDGLNLI  350
ident           |  |           |                              | | 
Sbjct TLSS-ITKLGFSTDSP------IEPADPWVSIDAAVNRyvvdpgERVS----REEALHLY  435
DSSP  HHHH-HLLEEELLLLL------LLLLLHHHHHHHHHHLllllhhHLLL----HHHHHHHL


DSSP  LHHHHHHLLLLLL-LLLLLLLLLEEEELLlLHHHhhhhllllleeeelleeeeellllle
Query THHSARTLNLQDY-GIAAGNSANLIILPAeNGFDalrrqvpvrysvrggkviastqpaqt  409
ident || ||      |      |  |  |||                                 
Sbjct THGSAQVTLAEDLgKLERGFRAEYIILDR-DPLK--------------------------  468
DSSP  LHHHHHHLLLLLLlLLLLLLLLLEEEELL-LLLL--------------------------


DSSP  eeellleeeellll
Query tvyleqpeaidykr  423
ident               
Sbjct --------------  468
DSSP  --------------


No 13: Query=1k6wA Sbjct=2vunA Z-score=26.0

back to top
DSSP  LLLEEEE-ELLL-------LLLLeEEEEEELLEEEEEEEEL-lllllLLLEEELLLLEEE
Query ALQTIIN-ARLP-------GEEGlWQIHLQDGKISAIDAQS-gvmpiTENSLDAEQGLVI   51
ident     | |                   |   || | ||               ||    | 
Sbjct SKTIIKNiGKIVsgdikspVLQA-DTIVVEDGLIAAIGGEElmkdagDATIIDAAGSTVT   59
DSSP  LEEEEELlLEEElllllllEELL-LEEEEELLEEEEEELHHhhllllLLEEEELLLLEEE


DSSP  LLEEEEEELLL---lLLLLLlllllllllhhhhhhhhhllhhhllhhhhhhhhhHHHHHH
Query PPFVEPHIHLD---tTQTAGqpnwnqsgtlfegierwaerkallthddvkqrawQTLKWQ  108
ident |     | |                                                   
Sbjct PGLLDTHVHVSggdyAPRQK--------------------------------tmDFISSA   87
DSSP  ELEEEEEELLLllleEHHHL--------------------------------eeLHHHHH


DSSP  HHLLEEEEEEEEE-------lLLLL-LHHHHHH-HHHHHHHLLLLEEE-EEEELllllll
Query IANGIQHVRTHVD-------vSDAT-LTALKAM-LEVKQEVAPWIDLQ-IVAFPqegils  158
ident    |                   |                                    
Sbjct LHGGVTTMISAGSphfpgrpkDAAGtKALAITLsKSYYNARPAGVKVHgGAVIL-----e  142
DSSP  HLLLEEEEEELLLllllllllLHHHhHHHHHHHhHHHHHLLHHHLEEElLEELL-----l


DSSP  LLLHHHHHHHHHHLLLLEE-EELHhhlllhhhHHHHHHHHHHHHHHHLLEEEEEELLL--
Query YPNGEALLEEALRLGADVV-GAIPhfeftreyGVESLHKTFALAQKYDRLIDVHCDEI--  215
ident     |    |    |   |               |        | |       |      
Sbjct KGLTEEDFIEMKKEGVWIVgEVGL----gtikNPEDAAPMVEWAHKHGFKVQMHTGGTsi  198
DSSP  LLLLHHHHHHHHHLLLLEEeEELL----llllLHHHHHHHHHHHHHLLLEEEEELLLLll


DSSP  lllLLLHHHHHHHHHhhhllhhhEEEEEL-----HHHHHllhhhhhhhHHHHHHHLLEEE
Query ddeQSRFVETVAALAhhegmgarVTASHT-----TAMHSyngaytsrlFRLLKMSGINFV  270
ident           |               ||                     |          
Sbjct pgsSTVTADDVIKTK-------pDVVSHInggptAISVQ-------evDRIMDETDFAME  244
DSSP  lllLLLLHHHHHHHL-------lLEEELLlllllLLLHH-------hhHHHHHHLLLEEE


DSSP  ELhHHHHhhllllllllllLLLL--LHHHHHHLLL--LEEELLLLLlllLLLLLLLL-HH
Query ANpLVNIhlqgrfdtypkrRGIT--RVKEMLESGI--NVCFGHDDVfdpWYPLGTAN-ML  325
ident                      |         | |    | || |               |
Sbjct IV-QCGN------------PKIAdyVARRAAEKGQlgRVIFGNDAP---SGTGLIPLgIL  288
DSSP  EE-LLLL------------HHHHhhHHHHHHHHLLhhHEEEELLLL---LLLLLLLLhHH


DSSP  HHHHHHHHHLLLllhhHHHHHHHHHLHHHHHHLLLLLLLLLLLLLLLEEEELL-------
Query QVLHMGLHVCQLmgygQINDGLNLITHHSARTLNLQDYGIAAGNSANLIILPA-------  378
ident                          |  |     |    || |  | |||          
Sbjct RNMCQIASMSDI----DPEVAVCMATGNSTAVYGLNTGVIAPGKEADLIIMDTplgsvae  344
DSSP  HHHHHHHHHLLL----LHHHHHHHHLHHHHHHHLLLLLLLLLLLLLLEEEEELlllllll


DSSP  LLHHHHHH-HLLLLLEEEELLEEEEEL----LLLLeeeellleeeellll
Query ENGFDALR-RQVPVRYSVRGGKVIAST----QPAQttvyleqpeaidykr  423
ident                     |           ||                
Sbjct DAMGAIAAgDIPGISVVLIDGEAVVTKsrntPPAK---------raakil  385
DSSP  LHHHHHHHlLLLEEEEEEELLEEEELLllllLLLL---------llleel


No 14: Query=1k6wA Sbjct=2ogjA Z-score=25.4

back to top
DSSP  -LLLEEEEELLL-----LLLLEEEEEEE-LLEEEEEEEEllllllLLLEEElLLLEEELL
Query -ALQTIINARLP-----GEEGLWQIHLQ-DGKISAIDAQsgvmpiTENSLDaEQGLVIPP   53
ident  |     |                |    |||| |                       | 
Sbjct qAPILLTNVKPVgfgkgASQSSTDILIGgDGKIAAVGSA--lqapADTQRI-DAAFISPG   57
DSSP  lLLEEEEEEEELlllllLLLLLEEEEELlLLLEEEEELL--llllLLEEEL-LLLEEEEL


DSSP  EEEEEELLLLllllllllllllllhhhhhhhhhllhhhllhhHHHHhhhHHHHH-HHHLL
Query FVEPHIHLDTtqtagqpnwnqsgtlfegierwaerkallthdDVKQrawQTLKW-QIANG  112
ident  |  | |                                                    |
Sbjct WVDLHVHIWH--------------------------------GGTD-isIRPSEcGAERG   84
DSSP  EEEEEELLLL--------------------------------LLLL-llLLHHHlLHHHL


DSSP  EEEEEE-EEELllllLHHHHHHHH-HHHHHllLLEEEEEEELL----------LLLLLLl
Query IQHVRT-HVDVsdatLTALKAMLE-VKQEVapWIDLQIVAFPQ----------EGILSYp  160
ident                        |                                    
Sbjct VTTLVDaGSAG----EANFHGFREyIIEPS--RERIKAFLNLGsiglvacnrvPELRDI-  137
DSSP  EEEEEEeLLLL----LLLHHHHHHhLLLLL--LLEEEEEEELLllllllllllLLLLLH-


DSSP  LHHH--HHHHHHHLL---LLEEEELHH--HLLLhhHHHHHHHHHHHHHHHHLLEEEEEEL
Query NGEA--LLEEALRLG---ADVVGAIPH--FEFTreYGVESLHKTFALAQKYDRLIDVHCD  213
ident          |                          ||         |        ||  
Sbjct KDIDldRILECYAENsehIVGLXVRAShvITGS--WGVTPVKLGKKIAKILKVPXXVHVG  195
DSSP  HHLLhhHHHHHHHLLlllEEEEEEEELhhHHLL--LLLHHHHHHHHHHHHHLLLEEEEEL


DSSP  llllllLLHHHHHHHHHhhhllHHHEEEEELH-----HHHHLLHhHHHHHHHHHHhhLLE
Query eiddeqSRFVETVAALAhhegmGARVTASHTT-----AMHSYNGaYTSRLFRLLKmsGIN  268
ident             |         |      |                   |       || 
Sbjct ----epPALYDEVLEIL-----GPGDVVTHCFngksgSSIXEDE-DLFNLAERCE--GIR  243
DSSP  ----llLLLHHHHHHHL-----LLLLEEELLLlllllLLLLLLH-HHHHHHHHLL--LLE


DSSP  EEELHHHHhhhllllllllllllllLHHHHH-HLLLLEEELLLLLlLLLL-LLLLlLHHH
Query FVANPLVNihlqgrfdtypkrrgitRVKEML-ESGINVCFGHDDVfDPWY-PLGTaNMLQ  326
ident                                           |                 
Sbjct LDIGHGGA------------sfsfkVAEAAIaRGLLPFSISTDLH-GHSXnFPVW-DLAT  289
DSSP  EELLLLLL------------lllhhHHHHHHhLLLLLLLLLLLLL-LLLLlLLLL-LHHH


DSSP  HHHHHHhHLLLllhhHHHHHHHHHLHHHHHHLLLLLL-LLLLLLLLLEEEELlllhhhHH
Query VLHMGLhVCQLmgygQINDGLNLITHHSARTLNLQDY-GIAAGNSANLIILPaengfdAL  385
ident      |                  |   |    |        |  |              
Sbjct TXSKLL-SVDX----PFENVVEAVTRNPASVIRLDXEnRLDVGQRADFTVFD------LV  338
DSSP  HHHHHH-HLLL----LHHHHHHLLLHHHHHHLLLLLLlLLLLLLLLEEEEEE------EE


DSSP  HH----------------LLLLLEEEELLEEEEELlllleeeellleeeellll
Query RR----------------QVPVRYSVRGGKVIASTqpaqttvyleqpeaidykr  423
ident                       || | |   ||                     
Sbjct DAdleatdsngdvsrlkrLFEPRYAVIGAEAIAAS-------------ryipra  379
DSSP  EEeeeeellllleeeeeeEEEEEEEEELLEEEELL-------------llllll


No 15: Query=1k6wA Sbjct=1onxA Z-score=25.4

back to top
DSSP  -------LLLEEEEELL---LLLLlEEEEEEELLEEEEEEEElllLLLL----LLEEELL
Query -------ALQTIINARL---PGEEgLWQIHLQDGKISAIDAQsgvMPIT----ENSLDAE   46
ident               | |                ||| |        |          |  
Sbjct midytaaGFTLLQGAHLyapEDRG-ICDVLVANGKIIAVASN---IPSDivpnCTVVDLS   56
DSSP  llllhhhLLEEEEEEEEellLEEE-EEEEEEELLEEEEEELL---LLLLllllLEEEELL


DSSP  LLEEELLEEEEEELLLLLlllllllllllllhhhHHHHhHLLHhhllhhhhhhHHHHhHH
Query QGLVIPPFVEPHIHLDTTqtagqpnwnqsgtlfeGIERwAERKallthddvkqRAWQtLK  106
ident      | |   | ||                   |                       | 
Sbjct GQILCPGFIDQHVHLIGG---------------gGEAG-PTTR---------tPEVA-LS   90
DSSP  LLEEEELEEEEEELLLLL---------------lLLLL-HHHL---------lLLLL-HH


DSSP  HHHHLLEEEEEEEEE-LLLLllHHHHHHHHHHHHHL-LLLEEEEEEELLLLLlllllhhH
Query WQIANGIQHVRTHVD-VSDAtlTALKAMLEVKQEVA-PWIDLQIVAFPQEGIlsypngeA  164
ident      |   |       |          |          |                    
Sbjct RLTEAGVTSVVGLLGtDSIS--RHPESLLAKTRALNeEGISAWMLTGAYHVP--srtitG  146
DSSP  HHHHLLEEEEEELLLlLLLL--LLHHHHHHHHHHHHhHLLEEEEEEELLLLL--lllllL


DSSP  HHHHHHHLL--LLEEEELH---HHLLlhhHHHHHHHHHHHHHHHHL------LEEEEEeL
Query LLEEALRLG--ADVVGAIP---HFEFtreYGVESLHKTFALAQKYD------RLIDVHcD  213
ident   |           |                |  |    |                 |  
Sbjct SVEKDVAIIdrVIGVXCAIsdhRSAA---PDVYHLANMAAESRVGGllggkpGVTVFH-M  202
DSSP  LHHHHHHHLllEEEEEEEElllLLLL---LLHHHHHHHHHHHHHHHhhhlllLEEEEE-E


DSSP  LLLllLLLHhHHHHHHH-hHHLLHHHEEEEELHhHHHLlhhhhhhhHHHHHHhLLEEEEL
Query EIDdeQSRFvETVAALA-hHEGMGARVTASHTTaMHSYngaytsrlFRLLKMsGINFVAN  272
ident                |              |                      |      
Sbjct GDS--KKAL-QPIYDLLenCDVPISKLLPTHVN-RNVP---lfeqaLEFARK-GGTIDIT  254
DSSP  LLL--LLLL-HHHHHHHhlLLLLHHHEEEELHH-HLHH---hhhhhHHHHHL-LLLEEEE


DSSP  hHHHHhhlllllllllLLLL--lLHHHHH-HLLL--LEEELLLLLLLLL----------l
Query pLVNIhlqgrfdtypkRRGI--tRVKEML-ESGI--NVCFGHDDVFDPW----------y  317
ident                                      |    |                 
Sbjct -SSID-----------EPVApaeGIARAVqAGIPlaRVTLSSDGNGSQPffddegnlthi  302
DSSP  -LLLL-----------LLLLhhhHHHHHHhLLLLhhHEEEELLLLLEEEeellllleeee


DSSP  LLLLLL-HHHHHHHhhhhlllLLHHHHH-HHHHHHLHHHHHHLLLLLL-LLLLLLLLLEE
Query PLGTAN-MLQVLHMglhvcqlMGYGQIN-DGLNLITHHSARTLNLQDY-GIAAGNSANLI  374
ident         |              |     | |   |   |  |||     |  || | | 
Sbjct GVAGFEtLLETVQV-----lvKDYDFSIsDALRPLTSSVAGFLNLTGKgEILPGNDADLL  357
DSSP  EELLLHhHHHHHHH-----hhHHHLLLHhHHHHHHLHHHHHHLLLLLLlLLLLLLLLLEE


DSSP  EELLllhhhhhhhLLLLLEEEELLEEEEELLllleeeellleeeellll
Query ILPAengfdalrrQVPVRYSVRGGKVIASTQpaqttvyleqpeaidykr  423
ident                        ||                        
Sbjct VMTP---------ELRIEQVYARGKLMVKDG-------kacvkgtfetd  390
DSSP  EELL---------LLLEEEEEELLEEEEELL-------eelllllllll


No 16: Query=1k6wA Sbjct=3nqbA Z-score=25.0

back to top
DSSP  -----------------------lLLEEEEELL-----LLLLlEEEEEEELLEEEEEEEE
Query -----------------------aLQTIINARL-----PGEEgLWQIHLQDGKISAIDAQ   32
ident                            |    |             |      |      
Sbjct epadlnddtlraravaaargdqrfDVLITGGTLvdvvtGELR-PADIGIVGALIASVHEP   59
DSSP  llhhhllhhhhhhhhhhhhlllleEEEEELLEEellllLLEE-ELEEEEELLEEEEEELL


DSSP  llLLLLL-LLEEELLLLEEELLEEEEEELLLLLLllllllllllllhhhhhhhhhllhhh
Query sgVMPIT-ENSLDAEQGLVIPPFVEPHIHLDTTQtagqpnwnqsgtlfegierwaerkal   91
ident             ||    | |     | |                               
Sbjct --ASRRDaAQVIDAGGAYVSPGLIDTHXHIESSX--------------------------   91
DSSP  --LLLLLeEEEEELLLLEEEELEEEEEELHHHHL--------------------------


DSSP  llhhhhhHHHHHHHHHHHHLLEEEEEEEEE--LLLLLLHHHHHHHHHHHHHllLLEEEEE
Query lthddvkQRAWQTLKWQIANGIQHVRTHVD--VSDATLTALKAMLEVKQEVapWIDLQIV  149
ident                   | |                                       
Sbjct -------ITPAAYAAAVVARGVTTIVWDPHefGNVHGVDGVRWAAKAIENL--PLRAILL  142
DSSP  -------LLHHHHHHHHHLLLEEEEEELLHhhHHHHLHHHHHHHHHHHLLL--LLEEEEE


DSSP  EELLLLLLL-----lLLHH-HHHHHHHHLL-LLEEE-ELHHhlllhHHHH---HHHHHHH
Query AFPQEGILS-----yPNGE-ALLEEALRLG-ADVVG-AIPHfeftrEYGV---ESLHKTF  198
ident |                   | |   |                                 
Sbjct APSCVPSAPglerggADFDaAILADLLSWPeIGGIAeIXNX-----RGVIerdPRXSGIV  197
DSSP  ELLLLLLLLllllllLLLLhHHHHHHHLLLlEEEEEeELLH-----HHHHlllHHHHHHH


DSSP  HHHHHHLLEEEEEELllllllllhHHHHHHHHhhhllhhhEEEEELhHHHHllhhhhhhh
Query ALAQKYDRLIDVHCDeiddeqsrfVETVAALAhhegmgarVTASHTtAMHSyngaytsrl  258
ident         |   |                |                              
Sbjct QAGLAAEKLVCGHAR---glknadLNAFXAAG-------vSSDHEL-VSGE--------d  238
DSSP  HHHHHHLLEEEELLL---lllhhhHHHHHHLL-------lLEELLL-LLHH--------h


DSSP  hhHHHHHLLEEEELhHHHHhhllllllllllLLLLLHH-HHHHL---LLLEEELLLLLLL
Query frLLKMSGINFVANpLVNIhlqgrfdtypkrRGITRVK-EMLES---GINVCFGHDDVFD  314
ident        |                                          |    |||| 
Sbjct lxAKLRAGLTIELR-GSHD------------HLLPEFVaALNTLghlPQTVTLCTDDVFP  285
DSSP  hhHHHHLLLEEEEE-LLLH------------HHHHHHHhHHHHHlllLLLEEEELLLLLH


DSSP  lllLLLL--LLHHHHHHHHHhHLLLllhhHHHHHHHHHLHHHHHHLLLLLL-LLLLLLLL
Query pwyPLGT--ANMLQVLHMGLhVCQLmgygQINDGLNLITHHSARTLNLQDY-GIAAGNSA  371
ident               |         |         |   |   |  |   |   ||||  |
Sbjct ---DDLLqgGGLDDVVRRLV-RYGL----KPEWALRAATLNAAQRLGRSDLgLIAAGRRA  337
DSSP  ---HHHHhlLLHHHHHHHHH-HLLL----LHHHHHHHHLHHHHHHHLLLLLlLLLLLLLL


DSSP  LEEEELlllhhHHHHhlLLLLEEEELLEEEEEL---------------------------
Query NLIILPaengfDALRrqVPVRYSVRGGKVIAST---------------------------  404
ident            |        |     |   |                             
Sbjct DIVVFE-----DLNG--FSARHVLASGRAVAEGgrxlvdiptcdttvlkgsxklplrxan  390
DSSP  LEEEEL-----LLLL--LLEEEEEELLEEEEELleelllllllllhhhllllllllllhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  404
ident                                                             
Sbjct dflvksqgakvrlatidrprftqwgeteadvkdgfvvppegatxisvthrhgxaepttkt  450
DSSP  hhllllllleeeeeeeellllleeeeeeeeeelleellllleeeeeeellllllllleee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  404
ident                                                             
Sbjct gfltgwgrwngafattvshdshnltvfggnagdxalaanavigtgggxavasegkvtail  510
DSSP  eeeellllllleeeelllllllleeeeellhhhhhhhhhhhhhllleeeeeelleeeeee


DSSP  ----------------------------------------------------------ll
Query ----------------------------------------------------------qp  406
ident                                                             
Sbjct plplsglvsdapleevarafedlreavgkvvewqppylvfkacfgatlacnigphqtdxg  570
DSSP  elllllllllllhhhhhhhhhhhhhhhhhhlllllllllhhhhhlllllllllleellll


DSSP  lleeeellleeeellll
Query aqttvyleqpeaidykr  423
ident                  
Sbjct iadvltgkvxespviev  587
DSSP  eeelllleeellleeel


No 17: Query=1k6wA Sbjct=2imrA Z-score=23.5

back to top
DSSP  llLEEEEEL-----lLLLLleEEEEEElLEEEEEEEELL--lLLLLlleeelLLLE--EE
Query alQTIINAR-----lPGEEglWQIHLQdGKISAIDAQSG--vMPITensldaEQGL--VI   51
ident                                 |                   |       
Sbjct -hTPRLLTCdvlytgAQSP-gGVVVVG-ETVAAAGHPDElrrQYPH---aaeERAGavIA   54
DSSP  -lLEEEEEEleeellEELL-eEEEEEL-LEEEEEELHHHhhhHLLL---leeEELLleEL


DSSP  LLEEEEEELLLLllllllllllllLLHHHHHHHHHllhhhllhhHHHHHHHHHHHHHHHL
Query PPFVEPHIHLDTtqtagqpnwnqsGTLFEGIERWAerkallthdDVKQRAWQTLKWQIAN  111
ident || |  | |||                 |   |                |          
Sbjct PPPVNAHTHLDM-sayefqalpyfQWIPEVVIRGR-------hlRGVAAAQAGADTLTRL  106
DSSP  LLLLEEEEELLL-lhhhhhhlhhhHLLHHHHHHHL-------llLHHHHHHHHHHHHHHL


DSSP  LEEEEEEEEEllllllhHHHHHHHHHHHHllLLEEEEEEELllLLLL---LLLHHHHHHH
Query GIQHVRTHVDvsdatltALKAMLEVKQEVapWIDLQIVAFPqeGILS---YPNGEALLEE  168
ident |   |   |        |   |                                 |    
Sbjct GAGGVGDIVW-------APEVMDALLARE--DLSGTLYFEV--LNPFpdkADEVFAAART  155
DSSP  LLLLEEEEEL-------LHHHHHHHHLLL--LLLEEEEEEE--LLLLhhhHHHHHHHHHH


DSSP  HHHLL--------lLEEEE-LHHHLllhhhHHHHHHHHHHHHHHHLLEEEEEELLLL--L
Query ALRLG--------aDVVGA-IPHFEftreyGVESLHKTFALAQKYDRLIDVHCDEID--D  217
ident  |                   |                   |         |  |     
Sbjct HLERWrrlerpglrLGLSPhTPFTV-----SHRLMRLLSDYAAGEGLPLQIHVAEHPteL  210
DSSP  HHHHHhlllllleeEEEEElLLLLL-----LHHHHHHHHHHHHHHLLLLEEEELLLHhhH


DSSP  LLL--------------------------------LHHHHHH--HHHHhhllhhHEEEEE
Query EQS--------------------------------RFVETVA--ALAHhegmgaRVTASH  243
ident |                                    |                | |  |
Sbjct EMFrtgggplwdnrmpalyphtlaevigrepgpdlTPVRYLDelGVLA-----aRPTLVH  265
DSSP  HHHhhlllllhhhllhhhllllhhhhhllllllllLHHHHHHhhLLHH-----hLLEEEE


DSSP  LHHHhhllhhhHHHHHHHHHHHLLEEEELHHHHHHHLLlllllllllLLLLHHHHHHLLL
Query TTAMhsyngayTSRLFRLLKMSGINFVANPLVNIHLQGrfdtypkrrGITRVKEMLESGI  303
ident            |          |   |  |  | ||           |          | 
Sbjct MVNV-------TPDDIARVARAGCAVVTCPRSNHHLEC---------GTFDWPAFAAAGV  309
DSSP  LLLL-------LHHHHHHHHHHLLLEEELHHHHHHLLL---------LLLLHHHHHHLLL


DSSP  LEEELLLLLlllLLLLLlLLHHHHHHHHHHhlLLLLhHHHHHHHHHHLHHHHHHLLllLL
Query NVCFGHDDVfdpWYPLGtANMLQVLHMGLHvcQLMGyGQINDGLNLITHHSARTLNlqDY  363
ident  |  | | |          |               |                |       
Sbjct EVALGTDSV---ASGET-LNVREEVTFARQ--LYPG-LDPRVLVRAAVKGGQRVVG--TP  360
DSSP  LEEELLLLH---HHHLL-LLLHHHHHHHHH--HLLL-LLHHHHHHHHHHHHHHHHL--LL


DSSP  LLLLLLLLL-EEEEllllhhhhhhhlLLLLeeeelleeeeellllleeeellleeeelll
Query GIAAGNSAN-LIILpaengfdalrrqVPVRysvrggkviastqpaqttvyleqpeaidyk  422
ident     |                        |                              
Sbjct FLRRGETWQeGFRW------------ELSR-----------------------------d  379
DSSP  LLLLLLLLLhHHLH------------HHLL-----------------------------l


DSSP  l
Query r  423
ident  
Sbjct l  380
DSSP  l


No 18: Query=1k6wA Sbjct=3griA Z-score=23.4

back to top
DSSP  lLLEEEEELLLL--LLLEEEEEEELLEEEEEEEEllllllLLLEEELLLLEEELLEEEEE
Query aLQTIINARLPG--EEGLWQIHLQDGKISAIDAQsgvmpiTENSLDAEQGLVIPPFVEPH   58
ident     | |       |     |      |  |              ||    | | ||  |
Sbjct -XKLIKNGKVLQngELQQADILIDGKVIKQIAPA-iepsnGVDIIDAKGHFVSPGFVDVH   58
DSSP  -LEEEELLEEEEllEEEELEEEEELLEEEEEELL-lllllLLEEEELLLLEEEELEEEEE


DSSP  ELLLL--LLLLllllllllllhhhhhhhhhllhhhllhhhhhhHHHHHHHHHHHLLEEEE
Query IHLDT--TQTAgqpnwnqsgtlfegierwaerkallthddvkqRAWQTLKWQIANGIQHV  116
ident  ||                                              |     |   |
Sbjct VHLREpgGEYK-------------------------------eTIETGTKAAARGGFTTV   87
DSSP  ELLLLllLLLL-------------------------------lLHHHHHHHHHHLLEEEE


DSSP  EEEE----ELLLllLHHHHHHHHHHHHHLlLLEEEEEEEL--LLLLLllllHHHHHHHHH
Query RTHV----DVSDatLTALKAMLEVKQEVApWIDLQIVAFP--QEGILsypnGEALLEEAL  170
ident                    |        |        |                      
Sbjct CPXPntrpVPDS--VEHFEALQKLIDDNA-QVRVLPYASIttRQLGK----ELVDFPALV  140
DSSP  EELLllllLLLL--HHHHHHHHHHHHHHL-LLEELLLEELlhHHLLL----LLLLHHHHH


DSSP  HLLLLEEEELHHHlllhhHHHHHHHHHHHHHHHHLLEEEEEEL-----------------
Query RLGADVVGAIPHFeftreYGVESLHKTFALAQKYDRLIDVHCD-----------------  213
ident   ||                          | |    |  ||                  
Sbjct KEGAFAFTDDGVG----vQTASXXYEGXIEAAKVNKAIVAHCEdnsliyggaxhegkrsk  196
DSSP  LLLLLLEEELLLL----lLLHHHHHHHHHHHHHHLLLEEELLLlhhhllllleellhhhh


DSSP  ----llLLLLL--LHHHHHHHHHHHHLLhhHEEEEELHhHHHLlhhhhhhHHHHHH-HHL
Query ----eiDDEQS--RFVETVAALAHHEGMgaRVTASHTTaMHSYngaytsrLFRLLK-MSG  266
ident                      ||   |        |                        
Sbjct elgipgIPNICesVQIARDVLLAEAAGC--HYHVCHVS-TKES----vrvIRDAKRaGIH  249
DSSP  hhllleELLHHhhHHHHHHHHHHHHHLL--LEEELLLL-LHHH----hhhHHHHHHlLLL


DSSP  LEEEELHH-----------------HHHHHLLllllllLLLLllLHHHHHHLLLLEEELL
Query INFVANPL-----------------VNIHLQGrfdtypKRRGitRVKEMLESGINVCFGH  309
ident       |                   |  |                 | |  |   |   
Sbjct VTAEVTPHhlllteddipgnnaiykXNPPLRS------TEDR-eALLEGLLDGTIDCIAT  302
DSSP  EEEEELHHhhhllhhhlllllhhhlLLLLLLL------HHHH-hHHHHHHHLLLLLEELL


DSSP  LLLLL------------LLLLlLLLL-HHHHHHhhhhhllllLHHHHH-HHHHHHLHHHH
Query DDVFD------------PWYPlGTAN-MLQVLHmglhvcqlmGYGQIN-DGLNLITHHSA  355
ident |                |             |                       |    
Sbjct DHAPHardekaqpxekaPFGI-VGSEtAFPLLY----thfvkNGDWTLqQLVDYLTIKPC  357
DSSP  LLLLLlhhhhlllllllLLLL-LLLLlHHHHHH----hhhllLLLLLHhHHHHHHLHHHH


DSSP  HHLLLLLLLLLLLLLLLEEEELLL----------------lhhhhhHHLLLLLEEEELLE
Query RTLNLQDYGIAAGNSANLIILPAE----------------ngfdalRRQVPVRYSVRGGK  399
ident  | ||          | | |                                      | 
Sbjct ETFNLEYGTLKENGYADLTIIDLDseqeikgedflskadntpfigyKVYGNPILTXVEGE  417
DSSP  HHLLLLLLLLLLLLLLLEEEEELLlleellhhhlllllllllllllEELLEEEEEEELLE


DSSP  EEEELlllleeeellleeeellll
Query VIASTqpaqttvyleqpeaidykr  423
ident |                       
Sbjct VKFEG-------------------  422
DSSP  EEEEL-------------------


No 19: Query=1k6wA Sbjct=3giqA Z-score=23.3

back to top
DSSP  --LLLEEEEELL-----LLLLlEEEEEEELLEEEEEEEelllLLLL-LLEEELLLLEEEL
Query --ALQTIINARL-----PGEEgLWQIHLQDGKISAIDAqsgvMPIT-ENSLDAEQGLVIP   52
ident       |                      || | ||               ||    | |
Sbjct ekLDFKITGGWIidgtgAPRR-RADLGVRDGRIAAIGE---lGAHPaRHAWDASGKIVAP   56
DSSP  llEEEEEELLEElllllLLLE-ELEEEEELLEEEEEEL---lLLLLeEEEEELLLLEEEE


DSSP  LEEEEEELLLLLlllllllllllllhhhhhhhhhllhhhllhhhhhHHHHHhHHHHHHLL
Query PFVEPHIHLDTTqtagqpnwnqsgtlfegierwaerkallthddvkQRAWQtLKWQIANG  112
ident  |   | | |                                          | |    |
Sbjct GFIDVHGHDDLM---------------------------------fVEKPD-LRWKTSQG   82
DSSP  LEEELLLLLLLH---------------------------------hHHLLL-LHHHHLLL


DSSP  EEEEEEE----EELLLL----------------lLHHHHHHHHHHH-HHLLlLEEEEEEE
Query IQHVRTH----VDVSDA----------------tLTALKAMLEVKQ-EVAPwIDLQIVAF  151
ident |  |                                   |            |       
Sbjct ITTVVVGncgvSAAPAPlpgntaaalallgetplFADVPAYFAALDaQRPM-INVAALVG  141
DSSP  EEEEEELllllLLLLLLllllllhhhhhhlllllLLLHHHHHHHHHhLLLL-LEEEEEEE


DSSP  LLLlLLLLL--------------LHHHHHHHHHHLLLLEEEELHH--HLLLhhHHHHHHH
Query PQEgILSYP--------------NGEALLEEALRLGADVVGAIPH--FEFTreYGVESLH  195
ident                             |  ||  ||                     | 
Sbjct HAN-LRLAAmrdpqaaptaaeqqAMQDMLQAALEAGAVGFSTGLAyqPGAV--AQAAELE  198
DSSP  HHH-HHHHHlllllllllhhhhhHHHHHHHHHHHHLLLEEEEELLllLHHH--LLHHHHH


DSSP  HHHHHHHHHLLEEEEEELlLLLLLL-LHHHHHHHHHHHHLLhhHEEEEELhhHHHL--LH
Query KTFALAQKYDRLIDVHCDeIDDEQS-RFVETVAALAHHEGMgaRVTASHTtaMHSY--NG  252
ident      |    ||   |            || | |     |       ||         | 
Sbjct GLARVAAERRRLHTSHIR-NEADGVeAAVEEVLAIGRGTGC--ATVVSHH--KCMMpqNW  253
DSSP  HHHHHHHHLLLEEEEELL-LLLLLHhHHHHHHHHHHHHHLL--EEEELLL--LLLLhhHL


DSSP  HHHHHHHHHHHHHL-----LEEEELHHhHHHH-llLLLLLLL------------------
Query AYTSRLFRLLKMSG-----INFVANPLvNIHL-qgRFDTYPK------------------  288
ident                          |                                  
Sbjct GRSRATLANIDRAReqgveVALDIYPYpGSSTiliPERAETIddiritwstphpecsgey  313
DSSP  LLHHHHHHHHHHHHhllllEEEEELLLlEEEEellHHHLLLLllleeeeelllhhhllll


DSSP  -------------------------LLLL--lLHHHHHHlLLLEEELLLLLLLLlLLLL-
Query -------------------------RRGI--tRVKEMLEsGINVCFGHDDVFDPwYPLG-  320
ident                                  ||           | |       |   
Sbjct ladiaarwgcdkttaarrlapagaiYFAMdedEVKRIFQ-HPCCMVGSDGLPNDaRPHPr  372
DSSP  hhhhhhhhlllhhhhhhhhlleeeeEELLlhhHHHHHHH-LLLEEELLLLLLLLlLLLLh


DSSP  LLLHHHHHHhhhhhllLLLHHHHH--HHHHHHLHHHHHHLLLLLL-LLLLLLLLLEEEEL
Query TANMLQVLHmglhvcqLMGYGQIN--DGLNLITHHSARTLNLQDY-GIAAGNSANLIILP  377
ident                                 |   ||            |  |      
Sbjct LWGSFTRVL----gryVREARLMTleQAVARMTALPARVFGFAERgVLQPGAWADVVVFD  428
DSSP  HHHHHHHHH----hhhHHHLLLLLhhHHHHHHLHHHHHHHLLLLLlLLLLLLLLLEEEEL


DSSP  LllhHHHH---------hhLLLLLEEEELLEEEEELlllleeeellleeeellll
Query AengFDAL---------rrQVPVRYSVRGGKVIASTqpaqttvyleqpeaidykr  423
ident                     |        |                         
Sbjct P---DTVAdratwdeptlaSVGIAGVLVNGAEVFPQ-----ppadgrpgqvlrax  475
DSSP  L---LLLLlllllllllllLLLEEEEEELLEEEELL-----llllllllllllll


No 20: Query=1k6wA Sbjct=1yrrB Z-score=23.1

back to top
DSSP  llLEEEEELLL---LLLLEEEEEEELLEEEEEEEELlllllLLLEEELLLLEEELLEEEE
Query alQTIINARLP---GEEGLWQIHLQDGKISAIDAQSgvmpiTENSLDAEQGLVIPPFVEP   57
ident         |                || |                         | |   
Sbjct --YALTQGRIFtghEFLDDHAVVIADGLIKSVCPVA-elppEIEQRSLNGAILSPGFIDV   57
DSSP  --LEEELLEEElllLEELLEEEEEELLEEEEEEEHH-hlllLLLEEELLLLEEEELEEEE


DSSP  EEL-----LLLLlllllllllllllhhhhhhhhhllhhhlLHHHHH-HHHHHHHHHHHHL
Query HIH-----LDTTqtagqpnwnqsgtlfegierwaerkallTHDDVK-QRAWQTLKWQIAN  111
ident                                         |   |         |     
Sbjct QLNgcggvQFND----------------------------TAEAVSvETLEIMQKANEKS   89
DSSP  EELeelleELLL----------------------------LLLLLLhHHHHHHHHHHHLL


DSSP  LEEEEEEEEELLLLLLhhHHHHHHHHHHH---LLLLEEEEEEELLLLllllllhHHHHHH
Query GIQHVRTHVDVSDATLtaLKAMLEVKQEV---APWIDLQIVAFPQEGilsypngEALLEE  168
ident |              |   |    |  |     |   |                 ||   
Sbjct GCTNYLPTLITTSDEL--MKQGVRVMREYlakHPNQALGLHLEGPWL------nAALVDF  141
DSSP  LEEEEEEEELLLLHHH--HHHHHHHHHHHhhhLLLLLLLEEEELLLL------lLHHHHH


DSSP  HHHLL--LLEEEELHhhlllhhhHHHHhHHHHHHHHHHLLEEEEEELlllllLLLHHHHH
Query ALRLG--ADVVGAIPhfeftreyGVESlHKTFALAQKYDRLIDVHCDeiddeQSRFVETV  226
ident           |   |                                             
Sbjct LCENAdvITKVTLAP--------EMVP-AEVISKLANAGIVVSAGHS---naTLKEAKAG  189
DSSP  HHHLHhhEEEEEELH--------HHLL-HHHHHHHHHHLLEEEELLL---llLHHHHHHH


DSSP  HHHHhhhllhhhEEEEELH-hhhHLLHHHH--hhHHHHHHhhLLEEEELHHhhHHHLlll
Query AALAhhegmgarVTASHTT-amhSYNGAYT--srLFRLLKmsGINFVANPLvnIHLQgrf  283
ident               | |         |                |                
Sbjct FRAG-------iTFATHLYnampYITGREPglagAILDEA--DIYCGIIAD--GLHV---  235
DSSP  HHHL-------eEEELLLLllllLLLLLLLhhhhHHHHLL--LLEEEEELL--LLLL---


DSSP  llllllllllLHHHHHHLLL-LEEELLLLLllllLLLLlLLHHHHHHHHHHHLLlllhhH
Query dtypkrrgitRVKEMLESGI-NVCFGHDDVfdpwYPLGtANMLQVLHMGLHVCQlmgygQ  342
ident                        |   |             |          |       
Sbjct -------dyaNIRNAKRLKGdKLCLVTDAT----SGSS-LTMIEGVRNLVEHCG-----I  278
DSSP  -------lhhHHHHHHHHHHhHEEEELLLL----LLLL-LLHHHHHHHHHHHHL-----L


DSSP  HHH-HHHHHLHHHHHHLL-LLLL-LLLLLLLLLEEEELLllhhhhhhhLLLLLEEEELLE
Query IND-GLNLITHHSARTLN-LQDY-GIAAGNSANLIILPAengfdalrrQVPVRYSVRGGK  399
ident   |  |   |   ||           |||  |||                        | 
Sbjct ALDeVLRMATLYPARAIGvEKRLgTLAAGKVANLTAFTP---------DFKITKTIVNGN  329
DSSP  LHHhHHHHHLHHHHHHLLlLLLLlLLLLLLLLLEEEELL---------LLLEEEEEELLE


DSSP  EEEELlllleeeellleeeellll
Query VIASTqpaqttvyleqpeaidykr  423
ident                         
Sbjct EVVTQ-------------------  334
DSSP  EEEEL-------------------


No 21: Query=1k6wA Sbjct=1gkpA Z-score=22.9

back to top
DSSP  lLLEEEEELL---LLLLlEEEEEEELLEEEEEEEEllllllLLLEEELLLLEEELLEEEE
Query aLQTIINARL---PGEEgLWQIHLQDGKISAIDAQsgvmpiTENSLDAEQGLVIPPFVEP   57
ident     | |              |      |  |              ||    | | |  |
Sbjct -PLLIKNGEIitaDSRY-KADIYAEGETITRIGQN-leappGTEVIDATGKYVFPGFIDP   57
DSSP  -LEEEELLEEeelLEEE-ELEEEELLLLLLEEELL-lllllLLEEEELLLLEEEELEEEE


DSSP  EELLLLllllllllllllllhhhhhhhHHLLhhhllhhhhhhHHHHHHHHHHHLLEEEEE
Query HIHLDTtqtagqpnwnqsgtlfegierWAERkallthddvkqRAWQTLKWQIANGIQHVR  117
ident | |                                             |     |     
Sbjct HVHIYL--------------------pFMAT-------fakdTHETGSKAALMGGTTTYI   90
DSSP  EELLLL--------------------eELLE-------elllLHHHHHHHHHHLLEEEEE


DSSP  EEEELL--LLLLHHHHHHHHHHHHHLlLLEEEEEEELlLLLLllLLHHHHHHHHHHLLLL
Query THVDVS--DATLTALKAMLEVKQEVApWIDLQIVAFPqEGILsyPNGEALLEEALRLGAD  175
ident      |  |  |                 |                 |  | |    |  
Sbjct EMCCPSrnDDALEGYQLWKSKAEGNS-YCDYTFHMAV-SKFD--EKTEGQLREIVADGIS  146
DSSP  EEELLLllLLHHHHHHHHHHHHLLLL-LLEEEEEEEL-LLLL--LLHHHHHHHHHHLLLL


DSSP  EEEELHHHLLlhhHHHHHHHHHHHHHHHHLLEEEEEEL----------------------
Query VVGAIPHFEFtreYGVESLHKTFALAQKYDRLIDVHCD----------------------  213
ident                      |  ||         ||                       
Sbjct SFXIFLSYKNffgVDDGEMYQTLRLAKELGVIVTAHCEnaelvgrlqqkllsegktgpew  206
DSSP  EEEEEELLLLlllLLHHHHHHHHHHHHHHLLEEEEEELlhhhhhhhhhhhhhlllllhhh


DSSP  --llLLLLL--LHHHHHHHHHHHHLLhhHEEEEELHhHHHLlhhhhhhHHHHHH-HHLLE
Query --eiDDEQS--RFVETVAALAHHEGMgaRVTASHTTaMHSYngaytsrLFRLLK-MSGIN  268
ident       |          |      |        |                        | 
Sbjct hepsRPEAVeaEGTARFATFLETTGA--TGYVVHLS-CKPA----ldaAMAAKArGVPIY  259
DSSP  llllLLHHHhhHHHHHHHHHHHHHLL--EEEELLLL-LHHH----hhhHHHHHHlLLLEE


DSSP  EEELHHHHHH-------------------HLLLllllllLLLLlLHHHHHHLLLLEEELL
Query FVANPLVNIH-------------------LQGRfdtypkRRGItRVKEMLESGINVCFGH  309
ident                                         |        |  |     | 
Sbjct IESVIPHFLLdktyaerggveamkyimspPLRD------KRNQkVLWDALAQGFIDTVGT  313
DSSP  EEEEHHHHHLlhhhhhllhhhhhllllllLLLL------LHHHhHHHHHHHLLLLLEEEL


DSSP  LLLLL---------------LLLLlLLLL-HHHHHHHHHhhlllllhHHHHH-HHHHHLH
Query DDVFD---------------PWYPlGTAN-MLQVLHMGLhvcqlmgyGQIND-GLNLITH  352
ident |                   |             |                         
Sbjct DHCPFdteqkllgkeaftaiPNGI-PAIEdRVNLLYTYG----vsrgRLDIHrFVDAAST  368
DSSP  LLLLLlhhhhhhhlllhhhlLLLL-LLLLlHHHHHHHHH----llllLLLHHhHHHHHLH


DSSP  HHHHHLL-LLLL-LLLLLLLLLEEEELL----------------llhhhhhHHLLLLLEE
Query HSARTLN-LQDY-GIAAGNSANLIILPA----------------engfdalRRQVPVRYS  394
ident   |           || |  | |                                     
Sbjct KAAKLFGlFPRKgTIAVGSDADLVVYDPqyrgtisvktqhvnndyngfegfEIDGRPSVV  428
DSSP  HHHHHLLlLLLLlLLLLLLLLLEEEEELllleellhhhlllllllllllllEELLEEEEE


DSSP  EELLEEEEELL-llleeeellleeeellll
Query VRGGKVIASTQ-paqttvyleqpeaidykr  423
ident    |||                        
Sbjct TVRGKVAVRDGqfvgekgwgkllrrepmyf  458
DSSP  EELLEEEEELLeelllllllllllllllll


No 22: Query=1k6wA Sbjct=3ooqA Z-score=22.8

back to top
DSSP  lLLEEEEELL----LLLLlEEEEEEELLEEEEEEEEllllllLLLEEELLLLEEELLEEE
Query aLQTIINARL----PGEEgLWQIHLQDGKISAIDAQsgvmpiTENSLDAEQGLVIPPFVE   56
ident       ||                   ||                  |       | || 
Sbjct -KILFKNATVfpitSRPF-KGDVLVSNGKVEKVGEN--iedpDAEIVDLTGKFLFPGFVD   56
DSSP  -LEEEEEEEEllllLLLE-EEEEEEELLEEEEEELL--llllLLEEEELLLLEEEELEEE


DSSP  EEELL-LLLLLLllllllllllhhhhhhHHHL-----------lhhhllhhhHHHHhhHH
Query PHIHL-DTTQTAgqpnwnqsgtlfegieRWAE-----------rkallthddVKQRawQT  104
ident  | |                                                  |     
Sbjct AHSHIgLFEEGV----------------GYYYsdgneatdpvtphvkaldgfNPQD--PA   98
DSSP  EEELLlLLLLLL----------------LHHHlllllllllllllllhhhhlLLLL--HH


DSSP  HHHHHHLLEEEEEEEEellllllhhhhhhhhhhhhhlllleeeeeeELLLLL----llll
Query LKWQIANGIQHVRTHVdvsdatltalkamlevkqevapwidlqivaFPQEGI----lsyp  160
ident      | |   |                                                
Sbjct IERALAGGVTSVXIVP------------------------------GSANPVggqgsvik  128
DSSP  HHHHHLLLEEEEEELL------------------------------LLLLLEeeeeeeee


DSSP  lhhhhhhhhhhlLLLEEEELHHH------------lLLHHHHHHHHH-------------
Query ngealleealrlGADVVGAIPHF------------eFTREYGVESLH-------------  195
ident                                      ||                     
Sbjct frsiiveecivkDPAGLKXAFGEnpkrvygerkqtpSTRXGTAGVIRdyftkvknyxkkk  188
DSSP  lllllhhhheeeEEEEEEEELLHhhhhhhhhlllllLLHHHHHHHHHhhhhhhhhhhhhh


DSSP  -----------------hhhHHHHHHLLEEEEEELLlllllLLHHHHHHHHHHHHLLhhH
Query -----------------ktfALAQKYDRLIDVHCDEiddeqSRFVETVAALAHHEGMgaR  238
ident                                 |             |    |   |    
Sbjct elaqkegkeftetdlkxevgEXVLRKKIPARXHAHR-----ADDILTAIRIAEEFGF--N  241
DSSP  hhhhhlllllllllhhhhhhHHHHLLLLLEEEEELL-----HHHHHHHHHHHHHHLL--L


DSSP  EEEEELHHHHHllhhhhhhHHHHHHHHLLEEEE-LHHHhhHHLLLllllllLLLL-lLHH
Query VTASHTTAMHSyngaytsrLFRLLKMSGINFVA-NPLVniHLQGRfdtypkRRGI-tRVK  296
ident     | |                |    |  |    |                       
Sbjct LVIEHGTEAYK--------ISKVLAEKKIPVVVgPLLT--FRTKL----elKDLTxeTIA  287
DSSP  EEEEELLLHHH--------HHHHHHHHLLLEEElLLLL--LLLLH----hhLLLLllHHH


DSSP  HHHHLLLLEEELLLLLllllllLLLL-LHHHHHHHhHHHLLLllhhHHHHHHHHHLHHHH
Query EMLESGINVCFGHDDVfdpwypLGTA-NMLQVLHMgLHVCQLmgygQINDGLNLITHHSA  355
ident   |  |       |                                   | |   |   |
Sbjct KLLKDGVLIALXCDHP------VIPLeFATVQAAT-AXRYGA----KEEDLLKILTVNPA  336
DSSP  HHHHLLLLEEELLLLL------LLLHhHHHHHHHH-HHHHLL----LHHHHHHLLLHHHH


DSSP  HHLL-LLLL-LLLLLLLLLEEEELLllhhHHHHHLLLLLEEEELLEEEEELLllleeeel
Query RTLN-LQDY-GIAAGNSANLIILPAengfDALRRQVPVRYSVRGGKVIASTQpaqttvyl  413
ident   |        |  |  | |                 |      |               
Sbjct KILGlEDRIgSIEPGKDADLVVWSG----HPFDXKSVVERVYIDGVEVFRRE--------  384
DSSP  HHLLlLLLLlLLLLLLLLLEEEELL----LLLLLLLLEEEEEELLEEEEELL--------


DSSP  lleeeellll
Query eqpeaidykr  423
ident           
Sbjct ----------  384
DSSP  ----------


No 23: Query=1k6wA Sbjct=1a4mA Z-score=21.8

back to top
DSSP  llleeeeellllllleeeeeeelleeeeeeeellllllllleeelllleeELLEEEEEEL
Query alqtiinarlpgeeglwqihlqdgkisaidaqsgvmpitensldaeqglvIPPFVEPHIH   60
ident                                                     | || | |
Sbjct ----------------------------------------------tpafNKPKVELHVH   14
DSSP  ----------------------------------------------llllLLLEEEEEEE


DSSP  LLLLLLLLL------------------lLLLL--------llLHHHHHHHHHllHHHL-L
Query LDTTQTAGQ------------------pNWNQ--------sgTLFEGIERWAerKALL-T   93
ident ||                            |                             
Sbjct LDGAIKPETilyfgkkrgialpadtveeLRNIigmdkplslpGFLAKFDYYM--PVIAgC   72
DSSP  HHHLLLHHHhhhhhhhhllllllllhhhHHHHhlllllllhhHHHLLHHHHH--HHHLlL


DSSP  HHHHHHHHHHHHHHHHHLLEEEEEEEEELLL------------------LLLHHHHHHHH
Query HDDVKQRAWQTLKWQIANGIQHVRTHVDVSD------------------ATLTALKAMLE  135
ident     |  |          |   |                                     
Sbjct REAIKRIAYEFVEMKAKEGVVYVEVRYSPHLlanskvdpmpwnqtegdvTPDDVVDLVNQ  132
DSSP  HHHHHHHHHHHHHHHHHLLEEEEEEEELLHHhllllllllhhhllllllLHHHHHHHHHH


DSSP  HHHHHLL--LLEEEEEEELLLLLLlllLHHHHHHHHHHLL----LLEEEEL-hHHLLlhH
Query VKQEVAP--WIDLQIVAFPQEGILsypNGEALLEEALRLG----ADVVGAI-pHFEFtrE  188
ident   ||      |                       |                         
Sbjct GLQEGEQafGIKVRSILCCMRHQP---SWSLEVLELCKKYnqktVVAMDLAgdETIE--G  187
DSSP  HHHHHHHhhLLEEEEEEEEELLLH---HHHHHHHHHHHHLllllEEEEEEEllLLLL--L


DSSP  HHHH-hHHHHHHHHHHHLLEEEEEELLLlllLLLHHHHHHHHhhhhllhhhEEEEELHHH
Query YGVE-sLHKTFALAQKYDRLIDVHCDEIddeQSRFVETVAALahhegmgarVTASHTTAM  247
ident              | |      ||  |        |                   |    
Sbjct SSLFpgHVEAYEGAVKNGIHRTVHAGEV--gSPEVVREAVDI------lktERVGHGYHT  239
DSSP  HHHLhhHHHHHHHHHHHLLEEEEEELLL--lLHHHHHHHHHL------lllLEEEELHHH


DSSP  HHllhhhHHHHHHHHHHHLLEEEELHHHHHHHLlllllllLLLLllLHHHHHHLLLLEEE
Query HSyngayTSRLFRLLKMSGINFVANPLVNIHLQgrfdtypKRRGitRVKEMLESGINVCF  307
ident           |   |      |   |              |      |        |   
Sbjct IE-----DEALYNRLLKENMHFEVCPWSSYLTG---awdpKTTH--AVVRFKNDKANYSL  289
DSSP  HH-----LHHHHHHHHHLLLEEEELHHHHHHLL---llllLLLL--HHHHHHHLLLLEEE


DSSP  LLLLLLlllLLLLllLHHHHHHHHHHHLLLllhhHHHHHHHHhLHHHHHHLL-----LLL
Query GHDDVFdpwYPLGtaNMLQVLHMGLHVCQLmgygQINDGLNLiTHHSARTLN-----LQD  362
ident   ||                  |                  |     |            
Sbjct NTDDPL---IFKS--TLDTDYQMTKKDMGF----TEEEFKRL-NINAAKSSFlpeeeKKE  339
DSSP  LLLLLL---LLLL--LHHHHHHHHHHLLLL----LHHHHHHH-HHHHHHLLLllhhhHHH


DSSP  L---LLLLllllleeeellllhhhhhhhllllleeeelleeeeellllleeeellleeee
Query Y---GIAAgnsanliilpaengfdalrrqvpvrysvrggkviastqpaqttvyleqpeai  419
ident                                                             
Sbjct LlerLYRE----------------------------------------------------  347
DSSP  HhhhHHHH----------------------------------------------------


DSSP  llll
Query dykr  423
ident     
Sbjct --yq  349
DSSP  --ll


No 24: Query=1k6wA Sbjct=4b3zD Z-score=21.7

back to top
DSSP  LLLEEEEELL---LLLLlEEEEEEELLEEEEEEEEllllllLLLEEELLLLEEELLEEEE
Query ALQTIINARL---PGEEgLWQIHLQDGKISAIDAQsgvmpiTENSLDAEQGLVIPPFVEP   57
ident     |   |              | || |  |               |    |||     
Sbjct DRLLIKGGRIindDQSL-YADVYLEDGLIKQIGEN-livpgGVKTIEANGRMVIPGGIDV   58
DSSP  LEEEEEEEEEellLLEE-EEEEEEELLEEEEEELL-lllllLLEEEELLLLEEEELEEEE


DSSP  EELLLLllllllllllllllhhhhhhhhhllhhhllhhhhhHHHHHHHHHHHHLLEEEEE
Query HIHLDTtqtagqpnwnqsgtlfegierwaerkallthddvkQRAWQTLKWQIANGIQHVR  117
ident    |                                         |        |     
Sbjct NTYLQK--------------------------------taaDDFFQGTRAALVGGTTMII   86
DSSP  EELLLL--------------------------------lllLLHHHHHHHHHHLLEEEEE


DSSP  EEEEL-LLLL-LHHHHHHHHHHHHHLlLLEEEEEEELLLLlllLLLHHHHHHHHHH-LLL
Query THVDV-SDAT-LTALKAMLEVKQEVApWIDLQIVAFPQEGilsYPNGEALLEEALR-LGA  174
ident  ||        ||      |         |             |      ||      | 
Sbjct DHVVPePGSSlLTSFEKWHEAADTKS-CCDYSLHVDITSW---YDGVREELEVLVQdKGV  142
DSSP  EEELLlLLLLhHHHHHHHHHHHHLLL-LLEEEEEEELLLL---LLLHHHHHHHHHHlLLL


DSSP  LEEEELHHHLLlhhHHHHHHHHHHHHHHHHLLEEEEEEL---------------------
Query DVVGAIPHFEFtreYGVESLHKTFALAQKYDRLIDVHCD---------------------  213
ident                    |   |         | ||                       
Sbjct NSFQVYMAYKDvyqMSDSQLYEAFTFLKGLGAVILVHAEngdliaqeqkrilemgitgpe  202
DSSP  LEEEEELLLLLlllLLHHHHHHHHHHHHHHLLEEEEELLlhhhhhhhhhhhhhllllllh


DSSP  ---llLLLLL--LHHHHHHHHHHHHLLHhhEEEEELHhHHHLlhhhhhhHHHHHH-HHLL
Query ---eiDDEQS--RFVETVAALAHHEGMGarVTASHTTaMHSYngaytsrLFRLLK-MSGI  267
ident        |      |      |        |         |             |     
Sbjct ghalsRPEELeaEAVFRAITIAGRINCP--VYITKVM-SKSA----adiIALARKkGPLV  255
DSSP  hhhhhLLHHHhhHHHHHHHHHHHHHLLL--EEEEEEL-LHHH----hhhHHHHHHhLLLE


DSSP  EEEELHHHHHH--------------------HLLLlllllLLLLL-lLHHHHHHlLLLEE
Query NFVANPLVNIH--------------------LQGRfdtypKRRGI-tRVKEMLEsGINVC  306
ident                                                        |    
Sbjct FGEPIAASLGTdgthywsknwakaaafvtspPLSP-----DPTTPdyLTSLLAC-GDLQV  309
DSSP  EEEELHHHHHLllhhhhlllhhhhhhlllllLLLL-----LLLHHhhHHHHHHH-LLLLL


DSSP  ELLLLLLL---------------LLLLlLLLL-HHHHHHHHHhhlllllHHHHH--HHHH
Query FGHDDVFD---------------PWYPlGTAN-MLQVLHMGLhvcqlmgYGQIN--DGLN  348
ident  |                     |            |             |         
Sbjct TGSGHCPYstaqkavgkdnftliPEGV-NGIEeRMTVVWDKA-----vaTGKMDenQFVA  363
DSSP  LLLLLLLLlhhhhhhhlllhhhlLLLL-LLLLlHHHHHHHHH-----llLLLLLhhHHHH


DSSP  HHLHHHHHHLLLLL--LLLLLLLLLLEEEELlllhhhHHHH-------------------
Query LITHHSARTLNLQD--YGIAAGNSANLIILPaengfdALRR-------------------  387
ident       |   ||      || |  |   |                               
Sbjct VTSTNAAKIFNLYPrkGRIAVGSDADVVIWD------PDKLktitakshksaveynifeg  417
DSSP  HHLHHHHHHHLLLLllLLLLLLLLLLEEEEE------EEEEeelllllllllllllllll


DSSP  ---LLLLLEEEELLEEEEELL---------------------llleeeellleeeellll
Query ---QVPVRYSVRGGKVIASTQ---------------------paqttvyleqpeaidykr  423
ident              ||                                             
Sbjct mecHGSPLVVISQGKIVFEDGninvnkgmgrfiprkafpehlyqrvkirnkvfglqgvsr  477
DSSP  leeEEEEEEEEELLEEEEELLeellllllllllllllllhhhhhhhhhhhhhllllllll


No 25: Query=1k6wA Sbjct=3e74A Z-score=21.0

back to top
DSSP  -lLLEEEEELLL--LLLLEEEEEEELLEEEEEEEElllllllLLEEELLLLEEELLEEEE
Query -aLQTIINARLP--GEEGLWQIHLQDGKISAIDAQsgvmpitENSLDAEQGLVIPPFVEP   57
ident      | |       |     |    ||| ||              ||    | |  |  
Sbjct sfDLIIKNGTVIleNEARVVDIAVKGGKIAAIGQD---lgdaKEVXDASGLVVSPGXVDA   57
DSSP  leEEEEELLEEEllLLEEELEEEEELLEEEEEELL---llleEEEEELLLLEEEELEEEE


DSSP  EELLllllllllllllllllhhhhhhhhhllhhhllhhhhhhHHHHHHHHHHHLLEEEEE
Query HIHLdttqtagqpnwnqsgtlfegierwaerkallthddvkqRAWQTLKWQIANGIQHVR  117
ident | |                                                   ||    
Sbjct HTHI--------------------------------------GYETGTRAAAKGGITTXI   79
DSSP  EELL--------------------------------------LHHHHHHHHHHLLEEEEE


DSSP  EEE-----ELLLllLHHHHHHHHHHHHHLlLLEEEEEEELlllLLLLllhHHHHHHHHHL
Query THV-----DVSDatLTALKAMLEVKQEVApWIDLQIVAFPqegILSYpngEALLEEALRL  172
ident            |                   ||                    | |    
Sbjct EXPlnqlpATVD--RASIELKFDAAKGKL-TIDAAQLGGL---VSYN---IDRLHELDEV  130
DSSP  ELLlllllLLLL--HHHHHHHHHHHLLLL-LLEEEELEEL---LLLL---LLLHHHHHHH


DSSP  LLLEEEELHhhlllhhHHHHHHHHHHHHHHHHLLEEEEEEL-------------------
Query GADVVGAIPhfeftreYGVESLHKTFALAQKYDRLIDVHCD-------------------  213
ident |                      |             |||                    
Sbjct GVVGFXCFV-----rdVNDWQFFKGAQKLGELGQPVLVHCEnalicdelgeeakregrvt  185
DSSP  LLLLEEEEL-----llLLHHHHHHHHHHHHHHLLLEEEELLlhhhhhhhhhhhhhhllll


DSSP  -----llLLLLL--LHHHHHHHHHHHHLLhhHEEEEELHhHHHLlhhhhhhhHHHHH-HH
Query -----eiDDEQS--RFVETVAALAHHEGMgaRVTASHTTaMHSYngaytsrlFRLLK-MS  265
ident                    |  ||   |   |    |                |      
Sbjct ahdyvasRPVFTevEAIRRVLYLAKVAGC--RLHVCHVS-SPEG----veevTRARQeGQ  238
DSSP  hhhhhhlLLHHHhhHHHHHHHHHHHHHLL--LEEELLLL-LHHH----hhhhHHHHHlLL


DSSP  LLEEEELHHH-----------------hhHHLLllllllLLLL---llLHHHHHhlllLE
Query GINFVANPLV-----------------niHLQGrfdtypKRRG---itRVKEMLesgiNV  305
ident  |     |                                                    
Sbjct DITCESCPHYfvldtdqfeeigtlakcspPIRD------LENQkgxweKLFNGE----ID  288
DSSP  LEEEEELLHHhhllhhhhhhhlhhhllllLLLL------HHHHhhhhhHHHLLL----LL


DSSP  EELLLLLLLL-----------lLLLLLL-LHHHHHHhhhhhllllLHHHHH-HHHHHHLH
Query CFGHDDVFDP-----------wYPLGTA-NMLQVLHmglhvcqlmGYGQIN-DGLNLITH  352
ident |   |    |                       |             |        |   
Sbjct CLVSDHSPCPpexkagnixkawGGIAGLqSCXDVXF----deavqKRGXSLpXFGKLXAT  344
DSSP  EELLLLLLLLllllllllllllLLLLLHhHHHHHHH----hhhllLLLLLHhHHHHHHLH


DSSP  HHHHHLLLLLL-LLLLLLLLLEEEELL----------------llhhhhhHHLLLLLEEE
Query HSARTLNLQDY-GIAAGNSANLIILPA----------------engfdalRRQVPVRYSV  395
ident   |    ||    || |  |                                        
Sbjct NAADIFGLQQKgRIAPGKDADFVFIQPnssyvltnddleyrhkvspyvgrTIGARITKTI  404
DSSP  HHHHHLLLLLLlLLLLLLLLLEEEEELllleellhhhlllllllllllllEELLEEEEEE


DSSP  ELLEEEEELLllleeeellleeeellll
Query RGGKVIASTQpaqttvyleqpeaidykr  423
ident   | ||                      
Sbjct LRGDVIYDIE---qgfpvapkgqfilkh  429
DSSP  ELLEEEEELL---lllllllllleelll


No 26: Query=1k6wA Sbjct=3k2gB Z-score=18.5

back to top
DSSP  llleeeeellllllleeeeeeelleeeeeeeellllllllleeelllleeelLEEEEEEL
Query alqtiinarlpgeeglwqihlqdgkisaidaqsgvmpitensldaeqglvipPFVEPHIH   60
ident                                                          | |
Sbjct -------------------------slselspchvrsgrixtvdgpipssalGHTLXHEH   35
DSSP  -------------------------llllllllllllleeeelleeeehhhlLLEELLLL


DSSP  LLL---------------lllllLLLL--LLLL--LHHHhHHHHhllhhhllhhHHHHHH
Query LDT---------------tqtagQPNW--NQSG--TLFEgIERWaerkallthdDVKQRA  101
ident |                                    |                |    |
Sbjct LQNdcrcwwnppqeperqylaeaPISIeiLSELrqDPFV-NKHN-------ialDDLDLA   87
DSSP  LLEelhhhllllllhhhhhhhhlLLLHhhHHHHhlLHHH-LLLL-------leeLLHHHH


DSSP  HHHHHHHHHLLEEEEEEEEELLllllhHHHHHHHHHHHHllLLEEEEEEELLLLllLLLL
Query WQTLKWQIANGIQHVRTHVDVSdatltALKAMLEVKQEVapWIDLQIVAFPQEGilSYPN  161
ident     |   | |                          |          |           
Sbjct IAEVKQFAAVGGRSIVDPTCRG--igrDPVKLRRISAET--GVQVVXGAGYYLAssXPET  143
DSSP  HHHHHHHHHLLLLEEEELLLLL--lllLHHHHHHHHHHH--LLEEEELLLLLLHhhLLHH


DSSP  H--------hHHHHHHHH-------LLLLEEE-ELHHhlLLHHHHHHHHHHHHHHHHHHL
Query G--------eALLEEALR-------LGADVVG-AIPHfeFTREYGVESLHKTFALAQKYD  205
ident                                |               ||           
Sbjct AarlsaddiaDEIVAEALegtdgtdARIGLIGeIGVS-sDFTAEEEKSLRGAARAQVRTG  202
DSSP  HhlllhhhhhHHHHHHHHlllllllLLLLLEEeELLL-lLLLHHHHHHHHHHHHHHHHHL


DSSP  LEEEEEELLLllllLLHHHHHHHHHHH-HLLHHHEEEEELHHHHHllhhhHHHHHHHHHH
Query RLIDVHCDEIddeqSRFVETVAALAHH-EGMGARVTASHTTAMHSyngayTSRLFRLLKM  264
ident     ||         |    |  |              |    |             |  
Sbjct LPLXVHLPGW----FRLAHRVLDLVEEeGADLRHTVLCHXNPSHX-----DPVYQATLAQ  253
DSSP  LLEEELLLLL----LLLHHHHHHHHHHlLLLHHHEEELLLHHHLL-----LHHHHHHHHH


DSSP  HLLEEEE-LHHHhhHHLLLLLlllLLLLL------lLHHHHHHLLL--LEEELLLLLlLL
Query SGINFVA-NPLVniHLQGRFDtypKRRGI------tRVKEMLESGI--NVCFGHDDVfDP  315
ident  |                                          |        ||     
Sbjct RGAFLEFdXIGX--DFFYADQ---GVQCPsddevarAILGLADHGYldRILLSHDVF-VK  307
DSSP  HLLEEEElLLLL--LLEELLL---LEELLlhhhhhhHHHHHHHLLLhhHEEELLLLL-LH


DSSP  LL----LLLLL-LHHHhhHHHHHhlLLLLhHHHH-HHHHHHLHHHHHhLLLLLLllllll
Query WY----PLGTA-NMLQvlHMGLHvcQLMGyGQIN-DGLNLITHHSARtLNLQDYgiaagn  369
ident                   |           |        |      |             
Sbjct XXltryGGNGYaFVTK--HFLPR--LRRH-GLDDaALETLXVTNPRR-VFDASI------  355
DSSP  HHlhhhLLLLLlHHHH--LHHHH--HHHL-LLLHhHHHHHHLHHHHH-HHLLLL------


DSSP  llleeeellllhhhhhhhllllleeeelleeeeellllleeeellleeeellll
Query sanliilpaengfdalrrqvpvrysvrggkviastqpaqttvyleqpeaidykr  423
ident                                                       
Sbjct ---------------------------------------------------egh  358
DSSP  ---------------------------------------------------lll


No 27: Query=1k6wA Sbjct=2y1hB Z-score=18.1

back to top
DSSP  llleeeeellllllleeeeeeelleeeeeeeellllllllleeelllleeELLEEEEEEL
Query alqtiinarlpgeeglwqihlqdgkisaidaqsgvmpitensldaeqglvIPPFVEPHIH   60
ident                                                       |  | |
Sbjct --------------------------------------------------GVGLVDCHCH   10
DSSP  --------------------------------------------------LLLEEEEEEL


DSSP  LLL-LLLLllllllllllhhhhhhhhhllhhhllhhhhhhHHHHHHHHHHHLLEEEEEEE
Query LDT-TQTAgqpnwnqsgtlfegierwaerkallthddvkqRAWQTLKWQIANGIQHVRTH  119
ident |                                            |              
Sbjct LSApDFDR--------------------------------DLDDVLEKAKKANVVALVAV   38
DSSP  LLLhHHLL--------------------------------LHHHHHHHHHHLLEEEEEEL


DSSP  EELllllLHHHHHHHHHHHHHLllLEEEEEEELLLL-----lLLLLLHHHHHHHHHHLL-
Query VDVsdatLTALKAMLEVKQEVApwIDLQIVAFPQEG-----iLSYPNGEALLEEALRLG-  173
ident                                                             
Sbjct AEH----SGEFEKIMQLSERYN--GFVLPCLGVHPVqgldqrSVTLKDLDVALPIIENYk   92
DSSP  LLL----HHHHHHHHHHHHHLL--LLEEEEELLLLEelllleELLHHHHHHHHHHHHHHl


DSSP  --LLEE-EELHHH-------lLLHHHHHHHHHHHHHHHHHHLLEEEEEELlllllllLHH
Query --ADVV-GAIPHF-------eFTREYGVESLHKTFALAQKYDRLIDVHCDeiddeqsRFV  223
ident             |           |     |     ||        ||            
Sbjct drLLAIgEVGLDFsprfagtgEQKEEQRQVLIRQIQLAKRLNLPVNVHSR-------SAG  145
DSSP  llLLEEeEEEEELlllllllhHHHHHHHHHHHHHHHHHHHHLLLEEEEEE-------LLH


DSSP  HHHHHHHHHHLLHhHEEEEELHHHhhllhhhhhHHHHHHHHHLLEEEELhHHHHHHllll
Query ETVAALAHHEGMGaRVTASHTTAMhsyngaytsRLFRLLKMSGINFVANpLVNIHLqgrf  283
ident      |    |    |                          |  |       |      
Sbjct RPTINLLQEQGAE-KVLLHAFDGR--------pSVAMEGVRAGYFFSIP-PSIIRS----  191
DSSP  HHHHHHHHHLLLL-LEEEELLLLL--------hHHHHHHHHLLLEEEEL-HHHHLL----


DSSP  llllllLLLL-LHHHHHhllLLEEELLLLL--lllLLLLLLLL-HHHHHHHHHHhlLLLL
Query dtypkrRGIT-RVKEMLesgINVCFGHDDV--fdpWYPLGTAN-MLQVLHMGLHvcQLMG  339
ident             ||         |   |                                
Sbjct ------GQKQkLVKQLP--lTSICLETDSPalgpeKQVRNEPWnISISAEYIAQ--VKGI  241
DSSP  ------HHHHhHHHHLL--hHHEEELLLLLlllllLLLLLLHHhHHHHHHHHHH--HHLL


DSSP  hhHHHHHHHHHLHHHHHHLL-LLLLllllllllleeeellllhhhhhhhllllleeeell
Query ygQINDGLNLITHHSARTLN-LQDYgiaagnsanliilpaengfdalrrqvpvrysvrgg  398
ident            |         |                                      
Sbjct --SVEEVIEVTTQNALKLFPkLRHL-----------------------------------  264
DSSP  --LHHHHHHHHHHHHHHHLLlHHHH-----------------------------------


DSSP  eeeeellllleeeellleeeellll
Query kviastqpaqttvyleqpeaidykr  423
ident                          
Sbjct ------------------------l  265
DSSP  ------------------------l


No 28: Query=1k6wA Sbjct=2ob3A Z-score=17.7

back to top
DSSP  llleeeeellllllleeeeeeelleeeeeeeellllllllleeelllleeeLLEEEEEEL
Query alqtiinarlpgeeglwqihlqdgkisaidaqsgvmpitensldaeqglviPPFVEPHIH   60
ident                                                      |   | |
Sbjct -------------------------------------drintvrgpitiseAGFTLTHEH   23
DSSP  -------------------------------------lleeelleeelhhhHLLEEEEEL


DSSP  LLLllllllllllllllhhhhhhhhHLLHHHLLHHHHHHHHHHHHHHHHHLLEEEEEEEE
Query LDTtqtagqpnwnqsgtlfegierwAERKALLTHDDVKQRAWQTLKWQIANGIQHVRTHV  120
ident                          |              |   |    | |        
Sbjct ICG---------------ssagflrAWPEFFGSRKALAEKAVRGLRRARAAGVRTIVDVS   68
DSSP  LEE---------------llllhhhHLHHHHLLHHHHHHHHHHHHHHHHHLLLLEEEELL


DSSP  ELLllllhHHHHHHHHHHHHllLLEEEEEEELLLLllLLLLH--------HHHHHHHHH-
Query DVSdatltALKAMLEVKQEVapWIDLQIVAFPQEGilSYPNG--------EALLEEALR-  171
ident               ||                                            
Sbjct TFD--igrDVSLLAEVSRAA--DVHIVAATGLWFD--PPLSMrlrsveelTQFFLREIQy  122
DSSP  LHH--hllLHHHHHHHHHHH--LLEEELEEELLLL--LLHHHhlllhhhhHHHHHHHHHl


DSSP  ------LLLLEEEELHHhlllHHHHHHHHHHHHHHHHHHLLEEEEEELLLllllLLHHHH
Query ------LGADVVGAIPHfeftREYGVESLHKTFALAQKYDRLIDVHCDEIddeqSRFVET  225
ident         |                   |                |         |  | 
Sbjct giedtgIRAGIIXVATT-gkaTPFQELVLKAAARASLATGVPVTTHTAAS----QRDGEQ  177
DSSP  llllllLLLLEEEEELL-lllLHHHHHHHHHHHHHHHHHLLLEEEELLHH----HLHHHH


DSSP  HHHHHHH-HLLHHHEEEEELHHHHhllhhhHHHHHHHHHHHLLEEEE-LHHH--------
Query VAALAHH-EGMGARVTASHTTAMHsyngayTSRLFRLLKMSGINFVA-NPLV--------  275
ident  ||          ||   |                  |   |                  
Sbjct QAAIFESeGLSPSRVCIGHSDDTD------DLSYLTALAARGYLIGLdHIPYsaigledn  231
DSSP  HHHHHHHlLLLHHHEEELLHHHLL------LHHHHHHHHHLLLEEEElLLLLllllllll


DSSP  ---hhHHLLLllllllLLLL-lLHHHHHHLLL--LEEELLLLL---------lLLLLL--
Query ---niHLQGRfdtypkRRGI-tRVKEMLESGI--NVCFGHDDV---------fDPWYP--  318
ident       |  |              |     |         |                   
Sbjct asasaLLGIR-----sWQTRalLIKALIDQGYmkQILVSNDWTfgfssyvtniMDVMDrv  286
DSSP  hhhhhHHLLL-----lHHHHhhHHHHHHHLLLhhHEEELLLLLleellllllhHHHHHhh


DSSP  -LLLLLhhHHHHHHHHhlLLLLhHHHH-HHHHHHLHHHHHHLLllllllllllllleeee
Query -LGTANmlQVLHMGLHvcQLMGyGQIN-DGLNLITHHSARTLNlqdygiaagnsanliil  376
ident                    |   |              || |                  
Sbjct nPDGMA--FIPLRVIP--FLREkGVPQeTLAGITVTNPARFLS-----------------  325
DSSP  lLLHHH--HHHHLHHH--HHHHlLLLHhHHHHHHLHHHHHHHL-----------------


DSSP  llllhhhhhhhllllleeeelleeeeellllleeeellleeeellll
Query paengfdalrrqvpvrysvrggkviastqpaqttvyleqpeaidykr  423
ident                                                
Sbjct -------------------------------------------ptlr  329
DSSP  -------------------------------------------llll


No 29: Query=1k6wA Sbjct=2vc5A Z-score=17.3

back to top
DSSP  llleeeeellllllleeeeeeelleeeeeeeellllllllleeelllleeeLLEEEEEEL
Query alqtiinarlpgeeglwqihlqdgkisaidaqsgvmpitensldaeqglviPPFVEPHIH   60
ident                                                      |   | |
Sbjct ------------------------------------mriplvgkdsieskdIGFTLIHEH   24
DSSP  ------------------------------------llllllllllllhhhLLLEELLLL


DSSP  LLLllllllllllllllhhhhhHHHH-LLHHHLLhHHHHHHHHHHHHHHHHLLEEEEEEE
Query LDTtqtagqpnwnqsgtlfegiERWA-ERKALLThDDVKQRAWQTLKWQIANGIQHVRTH  119
ident |                                  |     |    |     |       
Sbjct LRV----------------fseAVRQqWPHLYNE-DEEFRNAVNEVKRAMQFGVKTIVDP   67
DSSP  LLL----------------llhHHHHhLHHHLLH-HHHHHHHHHHHHHHHHLLLLEEEEL


DSSP  EELLllllhHHHHHHHHHHHHLllLEEEEEEELLLLlLLLL---------lhHHHHHHHH
Query VDVSdatltALKAMLEVKQEVApwIDLQIVAFPQEGiLSYP---------ngEALLEEAL  170
ident              |  |       | |             |             |     
Sbjct TVMG--lgrDIRFMEKVVKATG--INLVAGTGIYIY-IDLPfyflnrsideiADLFIHDI  122
DSSP  LLLL--lllLHHHHHHHHHLLL--LEEEELEELLLL-LLLLhhhllllhhhhHHHHHHHH


DSSP  H-------LLLLEEEELHHHLlLHHHHHHHHHHHHHHHHHHLLEEEEEELLllllLLLHH
Query R-------LGADVVGAIPHFEfTREYGVESLHKTFALAQKYDRLIDVHCDEiddeQSRFV  223
ident           |  |                              |  |            
Sbjct KegiqgtlNKAGFVXIAADEPgITKDVEKVIRAAAIANKETKVPIITHSNA----HNNTG  178
DSSP  HlllllllLLLLLEEEELLLLlLLHHHHHHHHHHHHHHHHHLLLEEEELLL----LLLHH


DSSP  HHHHHHHHH-HLLHHHEEEEELHHHHhllhhhHHHHHHHHHHHLLEEEE-LHHHhHHHLl
Query ETVAALAHH-EGMGARVTASHTTAMHsyngayTSRLFRLLKMSGINFVA-NPLVnIHLQg  281
ident                     |                      |                
Sbjct LEQQRILTEeGVDPGKILIGHLGDTD------NIDYIKKIADKGSFIGLdRYGL-DLFL-  230
DSSP  HHHHHHHHHlLLLHHHEEELLHHHLL------LHHHHHHHHHLLLEEEElLLLL-LLLL-


DSSP  lllllllLLLL-lLHHHHHHLLL--LEEELLLLL-LLLL-----------llLLLLLhhH
Query rfdtypkRRGI-tRVKEMLESGI--NVCFGHDDV-FDPW-----------ypLGTANmlQ  326
ident                      |        ||      |                     
Sbjct ------pVDKRneTTLRLIKDGYsdKIMISHDYCcTIDWgtakpeykpklapRWSIT--L  282
DSSP  ------lHHHHhhHHHHHHHLLLllLEEELLLLLlLLLLllllhhhhhhhllLLLLL--H


DSSP  HHHHHHHhlLLLLHHHHH-HHHHHHLHHHHHHLLllllllllllllleeeellllhhhhh
Query VLHMGLHvcQLMGYGQIN-DGLNLITHHSARTLNlqdygiaagnsanliilpaengfdal  385
ident           |   |                                             
Sbjct IFEDTIP--FLKRNGVNEeVIATIFKENPKKFFS--------------------------  314
DSSP  HHHLHHH--HHHLLLLLHhHHHHHHLHHHHHHLL--------------------------


DSSP  hhllllleeeelleeeeellllleeeellleeeellll
Query rrqvpvrysvrggkviastqpaqttvyleqpeaidykr  423
ident                                       
Sbjct --------------------------------------  314
DSSP  --------------------------------------


No 30: Query=1k6wA Sbjct=1bf6A Z-score=17.3

back to top
DSSP  llleeeeellllllleeeeeeelleeeeeeeellllllllleeelllleeeLLEEEEEEL
Query alqtiinarlpgeeglwqihlqdgkisaidaqsgvmpitensldaeqglviPPFVEPHIH   60
ident                                                          | |
Sbjct -----------------------------------------------sfdpTGYTLAHEH   13
DSSP  -----------------------------------------------llllLLEEEEEEL


DSSP  LLLllllllllllllllhhhhHHHHhllhhhllhhHHHHHHHHHHHHHHHLLEEEEEEEE
Query LDTtqtagqpnwnqsgtlfegIERWaerkallthdDVKQRAWQTLKWQIANGIQHVRTHV  120
ident |                                  |      |        |   |    
Sbjct LHI-------------dlsgfKNNV------dcrlDQYAFICQEMNDLMTRGVRNVIEMT   54
DSSP  LLE-------------elhhhHLLH------hheeLLHHHHHHHHHHHHHLLEEEEEELL


DSSP  ELLllllhHHHHHHHHHHHHllLLEEEEEEELLLLllLLLL--------hHHHHHHHHHL
Query DVSdatltALKAMLEVKQEVapWIDLQIVAFPQEGilSYPN--------gEALLEEALRL  172
ident             || |  |    |                                    
Sbjct NRY--mgrNAQFMLDVMRET--GINVVACTGYYQDafFPEHvatrsvqelAQEMVDEIEQ  110
DSSP  LHH--hllLHHHHHHHHHHH--LLEEEEEELLLLHhhLLLHhhhllhhhhHHHHHHHHHL


DSSP  -------LLLEEE-ELHHHlllHHHHHHHHHHHHHHHHHHLLEEEEEELLLlllllLHHH
Query -------GADVVG-AIPHFeftREYGVESLHKTFALAQKYDRLIDVHCDEIddeqsRFVE  224
ident         |                                | |  |             
Sbjct gidgtelKAGIIAeIGTSEgkiTPLEEKVFIAAALAHNQTGRPISTHTSFS-----TMGL  165
DSSP  lllllllLEEEEEeEELLLlllLHHHHHHHHHHHHHHHHHLLLEEEELHHH-----LLHH


DSSP  HHHHHHHH-HLLHHHEEEEELHHHHhllhhhHHHHHHHHHHHLLEEEE-LHHHhHHHLll
Query TVAALAHH-EGMGARVTASHTTAMHsyngayTSRLFRLLKMSGINFVA-NPLVnIHLQgr  282
ident    ||         |||  |                      |                 
Sbjct EQLALLQAhGVDLSRVTVGHCDLKD------NLDNILKMIDLGAYVQFdTIGK-NSYY--  216
DSSP  HHHHHHHHlLLLHHHEEELLLLLLL------LHHHHHHHHHLLLEEEElLLLL-LLLL--


DSSP  llllllLLLL-lLHHHHHHLLL--LEEELLLLLlLLLL-----LLLLLLHH-HHHHHHHH
Query fdtypkRRGI-tRVKEMLESGI--NVCFGHDDVfDPWY-----PLGTANML-QVLHMGLH  333
ident                     |    |    |              |    |         
Sbjct -----pDEKRiaMLHALRDRGLlnRVMLSMDIT-RRSHlkangGYGYDYLLtTFIPQLRQ  270
DSSP  -----lHHHHhhHHHHHHHLLLhhHEEELLLLL-LHHHlhhhlLLLLLHHHhLHHHHHHH


DSSP  hlllllhHHHHH-HHHHHLHHHHHHLLllllllllllllleeeellllhhhhhhhlllll
Query vcqlmgyGQIND-GLNLITHHSARTLNlqdygiaagnsanliilpaengfdalrrqvpvr  392
ident        |                                                    
Sbjct ------sGFSQAdVDVMLRENPSQFFQ---------------------------------  291
DSSP  ------lLLLHHhHHHHHLHHHHHHLL---------------------------------


DSSP  eeeelleeeeellllleeeellleeeellll
Query ysvrggkviastqpaqttvyleqpeaidykr  423
ident                                
Sbjct -------------------------------  291
DSSP  -------------------------------


No 31: Query=1k6wA Sbjct=3gg7A Z-score=17.2

back to top
DSSP  llleeeeellllllleeeeeeelleeeeeeeellllllllleeelllleeelLEEEEEEL
Query alqtiinarlpgeeglwqihlqdgkisaidaqsgvmpitensldaeqglvipPFVEPHIH   60
ident                                                          | |
Sbjct ----------------------------------------------------SLIDFHVH    8
DSSP  ----------------------------------------------------LLEEEEEL


DSSP  LLLLLllllllllllllhhhhhhhhhllhhhllhhhhhhHHHHHHHHHHHLLEeEEEEEE
Query LDTTQtagqpnwnqsgtlfegierwaerkallthddvkqRAWQTLKWQIANGIqHVRTHV  120
ident ||                                                     |    
Sbjct LDLYP----------------------------------DPVAVARACEERQL-TVLSVT   33
DSSP  HHHLL----------------------------------LHHHHHHHHHHLLL-EEEELL


DSSP  ELLLlllhHHHHHHHHHHHHlllLEEEEEEELL-LLLLLLLLHHHHHHHHHHlLLLEEE-
Query DVSDatltALKAMLEVKQEVapwIDLQIVAFPQ-EGILSYPNGEALLEEALRlGADVVG-  178
ident         |    |                    |               |      || 
Sbjct TTPA----AWRGTLALAAGR---PHVWTALGFHpEVVSERAADLPWFDRYLP-ETRFVGe   85
DSSP  LLHH----HHHHHHHHHLLL---LLEEELLLLLhHHLLLLHHHLHHHHHHHH-HLLEEEe


DSSP  ELHH----hlLLHHHHHHHHHHHHHHHHHH-LLEEEEEELlllllllLHHHHHHHHHHHH
Query AIPH----feFTREYGVESLHKTFALAQKY-DRLIDVHCDeiddeqsRFVETVAALAHHE  233
ident            |                    |    |         |    |       
Sbjct VGLDgspslrGTWTQQFAVFQHILRRCEDHgGRILSIHSR-------RAESEVLNCLEAN  138
DSSP  EELLllhhhhHHHHHHHHHHHHHHHHHHHLlLEEEEEELL-------LLHHHHHHHHHHL


DSSP  LLhhHEEEEELHHhhhllhhhHHHHHHHHHHHLLEEEELhHHHHHhlllllllllLLLL-
Query GMgaRVTASHTTAmhsyngayTSRLFRLLKMSGINFVANpLVNIHlqgrfdtypkRRGI-  292
ident                           |     |  |                        
Sbjct PRsgTPILHWYSG--------SVTELRRAISLGCWFSVG-PTMVR----------TQKGa  179
DSSP  HHheEEEEELLLL--------LHHHHHHHHHLLLEEEEL-HHHHL----------LHHHh


DSSP  lLHHHHHhlllLEEELLLLLlllLLLL----LLLL-HHHHHHHHHHhLLLLlhhHHHH-H
Query tRVKEMLesgiNVCFGHDDVfdpWYPL----GTAN-MLQVLHMGLHvCQLMgygQIND-G  346
ident      |      |    |        |            |                    
Sbjct aLIRSMP--rdRVLTETDGP---FLELdgqaALPWdVKSVVEGLSK-IWQI---PASEvE  230
DSSP  hHHHHLL--hhHEEELLLLL---LLEElleeLLHHhHHHHHHHHHH-HHLL---LHHHhH


DSSP  HHHhLHHHHHhLLLLllllllllllleeeellllhhhhhhhllllleeeelleeeeelll
Query LNLiTHHSARtLNLQdygiaagnsanliilpaengfdalrrqvpvrysvrggkviastqp  406
ident          | |                                                
Sbjct RIV-KENVSR-LLGT---------------------------------------------  243
DSSP  HHH-HHHHHH-HHHL---------------------------------------------


DSSP  lleeeellleeeellll
Query aqttvyleqpeaidykr  423
ident                  
Sbjct -----------------  243
DSSP  -----------------


No 32: Query=1k6wA Sbjct=1a5kC Z-score=16.9

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct snisrqayadmfgptvgdkvrladtelwieveddlttygeevkfgggkvirdgmgqgqml   60
DSSP  leeehhhhhhhhlllllleeelllllleeelleellllllllllllllllllllllllll


DSSP  ----lLLEEEEELL---LLLLlEEEEEEELLEEEEEEEE---------llllllLLLEEE
Query ----aLQTIINARL---PGEEgLWQIHLQDGKISAIDAQ---------sgvmpiTENSLD   44
ident           ||      |      |   || | ||                        
Sbjct aadcvDLVLTNALIvdhWGIV-KADIGVKDGRIFAIGKAgnpdiqpnvtipigaATEVIA  119
DSSP  hhhllLEEEEEEEEeelLEEE-EEEEEEELLEEEEEELEellllllllleelllLLEEEE


DSSP  LLLLEEELLEEEEEELLLlllllllllllllllhhhhhhhhhllhhhllhhhhhhhHHHH
Query AEQGLVIPPFVEPHIHLDttqtagqpnwnqsgtlfegierwaerkallthddvkqrAWQT  104
ident ||   |       |||                                          | 
Sbjct AEGKIVTAGGIDTHIHWI--------------------------------------CPQQ  141
DSSP  LLLLEEEELEEEEEEELL--------------------------------------LLLH


DSSP  HHHHHHLLEEEEEEE------------EELLlllLHHHHHHHHHHHHHllLLEEEEEEEL
Query LKWQIANGIQHVRTH------------VDVSdatLTALKAMLEVKQEVapWIDLQIVAFP  152
ident        |                                ||                  
Sbjct AEEALVSGVTTMVGGgtgpaagthattCTPG---PWYISRMLQAADSL--PVNIGLLGKG  196
DSSP  HHHHHHHLEEEEEEElllllhhhhhllLLLH---HHHHHHHHHHHLLL--LLEEEEEEEL


DSSP  llLLLLlllhHHHHHHHHHLLLLEEEELHHHLllhhhHHHHHHHHHHHHHHHLLEEEEEe
Query qeGILSypngEALLEEALRLGADVVGAIPHFEftreyGVESLHKTFALAQKYDRLIDVHc  212
ident              | |    |                           |   |     | 
Sbjct --NVSQ----PDALREQVAAGVIGLEIHEDWG----aTPAAIDCALTVADEMDIQVALH-  245
DSSP  --LLLL----HHHHHHHHHHLLLEEEEEHHHL----lLHHHHHHHHHHHHHHLLEEEEE-


DSSP  LLLLL--LLLL-HHHHhHHHHhhhllhhHEEEEEL-----HHHHHllhhhhhhhhhhHHH
Query DEIDD--EQSR-FVETvAALAhhegmgaRVTASHT-----TAMHSyngaytsrlfrlLKM  264
ident                                  ||                         
Sbjct SDTLNesGFVEdTLAA-IGGR-------TIHTFHTegaggGHAPD--------iitaCAH  289
DSSP  LLLLLllLLHHhHHHH-HLLL-------LEEELLLlllllLLLLL--------hhhhHHL


DSSP  HLLEEEELHHH-------------------------hhhhlLLLLlllLLLLlllHHHHH
Query SGINFVANPLV-------------------------nihlqGRFDtypKRRGitrVKEML  299
ident   |                                                         
Sbjct PNILPSSTNPTlpytlntidehldmlmvchhldpdiaedvaFAESrirRETI-aaEDVLH  348
DSSP  LLEEEEEEHHHllllllhhhhhhhhhhhhhllllllhhhhhLLLLlllHHHH-hhHHHHH


DSSP  HLLLLEEELLLLLllllLLLLLLLHHHHHHHHHHhlLLLL-------------HHHHHHH
Query ESGINVCFGHDDVfdpwYPLGTANMLQVLHMGLHvcQLMG-------------YGQINDG  346
ident   |       |                      |                          
Sbjct DLGAFSLTSSDSQ----AMGRVGEVILRTWQVAH--RMKVqrgalaeetgdndNFRVKRY  402
DSSP  HLLLLLEEELLLL----LLLLLLLHHHHHHHHHH--HHHHhhlllllllllllHHHHHHH


DSSP  HHHHLHHHHHHLL-LLLL-LLLLLLLLLEEEELLllhHHHHhhlLLLLEEEELLEEEEEL
Query LNLITHHSARTLN-LQDY-GIAAGNSANLIILPAengFDALrrqVPVRYSVRGGKVIAST  404
ident     |   | |         |  |  | |               |       ||      
Sbjct IAKYTINPALTHGiAHEVgSIEVGKLADLVVWSP---AFFG---VKPATVIKGGMIAIAP  456
DSSP  HHLLLHHHHHHLLlLLLLlLLLLLLLLLEEEELH---HHLL---LLLLEEEELLEEEEEE


DSSP  L-------lLLEE-----------------------------------------------
Query Q-------pAQTT-----------------------------------------------  410
ident                                                             
Sbjct MgdinasipTPQPvhyrpmfgalgsarhhcrltflsqaaaangvaerlnlrsaiavvkgc  516
DSSP  EllllllllLLLLleeeelhhhlhhhhhhhleeeelhhhhhhlhhhhllllleeeellll


DSSP  -------------------------------------eellleeeellll
Query -------------------------------------vyleqpeaidykr  423
ident                                                   
Sbjct rtvqkadmvhnslqpnitvdaqtyevrvdgelitsepadvlpmaqryflf  566
DSSP  llllhhhllllllllleeelllllleeelleellllllllllllllllll


No 33: Query=1k6wA Sbjct=3cjpA Z-score=16.3

back to top
DSSP  llleeeeellllllleeeeeeelleeeeeeeellllllllleeelllleeelLEEEEEEL
Query alqtiinarlpgeeglwqihlqdgkisaidaqsgvmpitensldaeqglvipPFVEPHIH   60
ident                                                          | |
Sbjct ----------------------------------------------------LIIDGHTH    8
DSSP  ----------------------------------------------------LLEEEEEE


DSSP  LLlllllllllllllllhhhhhhhhhllhhhllhhhhhHHHHHHHHHHHHLLEEEEEEEE
Query LDttqtagqpnwnqsgtlfegierwaerkallthddvkQRAWQTLKWQIANGIQHVRTHV  120
ident                                              |     |        
Sbjct VI------------------------------------LPVEKHIKIMDEAGVDKTILFS   32
DSSP  LL------------------------------------LLHHHHHHHHHHHLLLEEEEEL


DSSP  E-----------------------------lLLLL-LHHHHHHHHHHHHHLllLEEEEEE
Query D-----------------------------vSDAT-LTALKAMLEVKQEVApwIDLQIVA  150
ident                                         |    | |            
Sbjct TsihpetavnlrdvkkemkklndvvngktnsMIDVrRNSIKELTNVIQAYP--SRYVGFG   90
DSSP  LlllhhhlllhhhhhhhhhhhhhhhllllllLHHHhHHHHHHHHHHHHHLL--LLEEEEE


DSSP  ELllLLLL-llLHHHHHHHHH-HLLLLEEE-ELHHhlllHHHHHHHhHHHHHHHHHHL-L
Query FPqeGILS-ypNGEALLEEAL-RLGADVVG-AIPHfeftREYGVESlHKTFALAQKYD-R  206
ident                  ||          |   |                |         
Sbjct NV--PVGLsenDTNSYIEENIvNNKLVGIGeLTPA----SGQIKSL-KPIFKYSMDSGsL  143
DSSP  LL--LLLLlhhHHHHHHHHHLlLLLLLEEEeELLL----LLLHHHH-HHHHHHHHHLLlL


DSSP  EEEEeELLLlllLLLHHHHHHHHHHHHLLhhHEEEEE-LHHHHHLlhhhhhhhHHHHHHH
Query LIDVhCDEIddeQSRFVETVAALAHHEGMgaRVTASH-TTAMHSYngaytsrlFRLLKMS  265
ident  |                  | |         |   |                  | |  
Sbjct PIWI-HAFN-plVLQDIKEIAELCKAFPK-vPVILGHmGGSNWMT-------aVELAKEI  193
DSSP  LEEE-LLLL-llLHHHHHHHHHHHHHLLL-lLEEEHHhHHHHHHH-------hHHHHHHL


DSSP  L-LEEEELhhHHHHhlllllllllLLLL-lLHHHHHhllLLEEELLLLLLllllllLLLL
Query G-INFVANplVNIHlqgrfdtypkRRGI-tRVKEMLesgINVCFGHDDVFdpwyplGTAN  323
ident                                  |         || |  |      |   
Sbjct QnLYLDTS--AYFS----------TFVLkiVINELP---LKCIFGTDMPF------GDLQ  232
DSSP  LlEEEELL--LLLL----------HHHHhhHHHHLL---LLEELLLLLLL------LLHH


DSSP  hhHHHHHHHHHLllllhhHHHH-HHHHHLHHHHHHLLLlllllllllllleeeellllhh
Query mlQVLHMGLHVCqlmgygQIND-GLNLITHHSARTLNLqdygiaagnsanliilpaengf  382
ident                                  | ||                       
Sbjct --LSIEAIKKMS------NDSYvANAVLGDNISRLLNI----------------------  262
DSSP  --HHHHHHHHHL------LLHHhHHHHHLHHHHHHHLL----------------------


DSSP  hhhhhllllleeeelleeeeellllleeeellleeeellll
Query dalrrqvpvrysvrggkviastqpaqttvyleqpeaidykr  423
ident                                          
Sbjct -----------------------------------------  262
DSSP  -----------------------------------------


No 34: Query=1k6wA Sbjct=2ffiA Z-score=15.6

back to top
DSSP  llleeeeellllllleeeeeeelleeeeeeeellllllllleeelllleeeLLEEEEEEL
Query alqtiinarlpgeeglwqihlqdgkisaidaqsgvmpitensldaeqglviPPFVEPHIH   60
ident                                                          | |
Sbjct -------------------------------------------------lhLTAIDSHAH   11
DSSP  -------------------------------------------------llLLLEELLLL


DSSP  LLlllllllllllllllhhhhhhhhhLLHHHLL---hhhhhhHHHHHHHHHHHLLEEEEE
Query LDttqtagqpnwnqsgtlfegierwaERKALLT---hddvkqRAWQTLKWQIANGIQHVR  117
ident                                                |    | |  |  
Sbjct VF----------------------srGLNLASQrryapnydaPLGDYLGQLRAHGFSHGV   49
DSSP  LL----------------------lhHHHHHLLlllllllllLHHHHHHHHHHLLLLEEL


DSSP  EEE---ELLLlllhhHHHHHHHHHHHLllLEEEEEEELlllllllllHHHHhhHHHHLL-
Query THV---DVSDatltaLKAMLEVKQEVApwIDLQIVAFPqegilsypnGEALleEALRLG-  173
ident          |         |   | |     |  |                    |    
Sbjct LVQpsfLGTD-----NRYLLSALQTVP--GQLRGVVXL---------ERDVeqATLAEXa   93
DSSP  LLLlhhHLLL-----LHHHHHHHHHLL--LLLLLLLLL---------LLLLlhHHHHHHh


DSSP  ---LLEEEELHHHLllhhHHHH----hhHHHHHHHHHHLLEEEEEELlllllllLHHHHH
Query ---ADVVGAIPHFEftreYGVE----slHKTFALAQKYDRLIDVHCDeiddeqsRFVETV  226
ident       |                                     |               
Sbjct rlgVRGVRLNLXGQ----DXPDltgaqwRPLLERIGEQGWHVELHRQ------vADIPVL  143
DSSP  lllLLEEELLLLLL----LLLLllllllHHHHHHHHHHLLEEEELLL------lLLHHHH


DSSP  HHHHHHHLLhhHEEEEEL-HHHH--HLLHHHHHHHHHHHHHHLLEEEELhhHHHHHLLLl
Query AALAHHEGMgaRVTASHT-TAMH--SYNGAYTSRLFRLLKMSGINFVANplVNIHLQGRf  283
ident        |        |                 |  |                 |||  
Sbjct VRALQPYGL--DIVIDHFgRPDArrGLGQPGFAELLTLSGRGKVWVKVS--GIYRLQGS-  198
DSSP  HHHHLLLLL--LEEELHHhLLLLllLLLLLLHHHHLLLLLLLLEEEEEE--LHHHLLLL-


DSSP  llllLLLL---llLHHHHHHLLL--LEEELLLLLLLlLLLL-LLLLhhHHHHHHHhHLLL
Query dtypKRRG---itRVKEMLESGI--NVCFGHDDVFDpWYPL-GTANmlQVLHMGLhVCQL  337
ident                              | |                            
Sbjct ---pEENLafarqALCALEAHYGaeRLXWGSDWPHT-QHESeVSFG--SAVEQFE-ALGC  251
DSSP  ---hHHHHhhhhhHHHHHHHHLLhhHEEEELLLLLL-LLLLlLLHH--HHHHHHH-HHLL


DSSP  llhhhHHHH-HHHHLHHHHHHLLLLLLllllllllleeeellllhhhhhhhllllleeee
Query mgygqINDG-LNLITHHSARTLNLQDYgiaagnsanliilpaengfdalrrqvpvrysvr  396
ident             |                                               
Sbjct -----SAQLrQALLLDTARALFGFELE---------------------------------  273
DSSP  -----LHHHhHHHHLHHHHHHLLLLLL---------------------------------


DSSP  lleeeeellllleeeellleeeellll
Query ggkviastqpaqttvyleqpeaidykr  423
ident                            
Sbjct ---------------------------  273
DSSP  ---------------------------


No 35: Query=1k6wA Sbjct=2a3lA Z-score=15.4

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct qpdpiaadilrkepeqetfvrlnvplevptsdeveaykclqeclelrkryvfqetvapwe   60
DSSP  llllllllllllllllllllllllllllllllllllhhhhhhhhhhhhllllllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct keepfahypqgksdhcfemqdgvvhvfankdakedlfpvadatafftdlhhvlkviaagn  120
DSSP  lllllllllllllllllllllllllllllllllllllllllhhhhhhhhhhhhhhlllhh


DSSP  ------------------llleeeeelllLLLLeeeeeeelleeeeeeeellllllllle
Query ------------------alqtiinarlpGEEGlwqihlqdgkisaidaqsgvmpitens   42
ident                                                             
Sbjct irtlchrrlvlleqkfnlhlmlnadkeflAQKS---------------------------  153
DSSP  hhhhhhhhhhhhhhhhhhhhhhhhhhhhhHHHH---------------------------


DSSP  eellLLEE--ELLEEEEEELLLLLLLL---------------------------------
Query ldaeQGLV--IPPFVEPHIHLDTTQTA---------------------------------   67
ident               |  | |                                        
Sbjct ---aPHRDfyNVRKVDTHVHHSACMNQkhllrfiksklrkepdevvifrdgtyltlrevf  210
DSSP  ---lLLLLllLLLEEEEEEELLLLLLHhhhhhhhhhhhhllllllleeelleeelhhhhh


DSSP  -------llLLLLL--------lllhHHHH------hhhHLLHHHL-------LHHHHHH
Query -------gqPNWNQ--------sgtlFEGI------erwAERKALL-------THDDVKQ   99
ident           |               |                                 
Sbjct esldltgydLNVDLldvhadkstfhrFDKFnlkynpcgqSRLREIFlkqdnliQGRFLGE  270
DSSP  hhhllllllLLLLLllllllllllllLLLLhhhhlllllLHHHHHHlllllllLLLLHHH


DSSP  HHHHHHHHHHHLLEEEEEEEEELL---lLLLHhHHHHHHhhHHHLllLEEEEEEELLLll
Query RAWQTLKWQIANGIQHVRTHVDVS---dATLTaLKAMLEvkQEVApwIDLQIVAFPQEgi  156
ident    |      |   |                  |                          
Sbjct ITKQVFSDLEASKYQMAEYRISIYgrkmSEWDqLASWIVnnDLYS--ENVVWLIQLPR--  326
DSSP  HHHHHHHHHLLLLLEEEEEEEELLllllLHHHhHHHHHHllLLLL--LLEEEEEEEEL--


DSSP  LLLL-----------LHHHHHHH----------------hhhlLLLEEEEL--hhhlLLH
Query LSYP-----------NGEALLEE----------------alrlGADVVGAI--phfeFTR  187
ident |              |                                           |
Sbjct LYNIykdmgivtsfqNILDNIFIplfeatvdpdshpqlhvflkQVVGFDLVddeskpERR  386
DSSP  LHHHhlllllllllhHHHHHHLLhhhhhhhlhhhllllhhhhlLEEEEEEEllllllLLL


DSSP  H----------------HHHHHHHHHHHHHHHHL----------LEEEEEELLLllLLLL
Query E----------------YGVESLHKTFALAQKYD----------RLIDVHCDEIddEQSR  221
ident                            |                     |  |       
Sbjct PtkhmptpaqwtnafnpAFSYYVYYCYANLYVLNklreskgmttITLRPHSGEA--GDID  444
DSSP  LllllllllllllllllLHHHHHHHHHHHHHHHHhhhlllllllLEELLLLLLL--LLLH


DSSP  HHHHHHHHHhhhllhhhEEEEELHHHHHllhhhHHHHHHHHHHHLLEEEELHHHHHHHLL
Query FVETVAALAhhegmgarVTASHTTAMHSyngayTSRLFRLLKMSGINFVANPLVNIHLQG  281
ident                      |              |  |     |     || |  |  
Sbjct HLAATFLTC--------HSIAHGINLRK-----SPVLQYLYYLAQIGLAMSPLSNNSLFL  491
DSSP  HHHHHHHHL--------LLLLLLHHHHH-----LHHHHHHHHHHLLLEEELHHHHLLLLL


DSSP  lllllllLLLLlLHHHHHHLLLLEEELLLLLLllllLLLL--LLHHHHHHHHHHHLLLll
Query rfdtypkRRGItRVKEMLESGINVCFGHDDVFdpwyPLGT--ANMLQVLHMGLHVCQLmg  339
ident                     | ||    ||                        |  |  
Sbjct ------dYHRN-PFPVFFLRGLNVSLSTDDPL----QIHLtkEPLVEEYSIAASVWKL--  538
DSSP  ------lLLLL-LHHHHHHLLLLEEELLLLHH----HHLLllLHHHHHHHHHHHHHLL--


DSSP  hhHHHHHHHHhLHHHHHHLLLLL-----LLLLLllllleeeellllhhhhhhhlllllee
Query ygQINDGLNLiTHHSARTLNLQD-----YGIAAgnsanliilpaengfdalrrqvpvrys  394
ident      |        |                                             
Sbjct --SACDLCEI-ARNSVYQSGFSHalkshWIGKD--------yykrgpdgndihktnvphi  587
DSSP  --LHHHHHHH-HHHHHHHLLLLHhhhhhHLLLL--------lllllhhhllhhhhlllhh


DSSP  eelleeeeellllleeeellleeeellll
Query vrggkviastqpaqttvyleqpeaidykr  423
ident                              
Sbjct rvefrdtiwkeemqqvylgkavisdevvp  616
DSSP  hhhhhhhhhhhhhhhhlllllllllllll


No 36: Query=1k6wA Sbjct=4mupB Z-score=14.8

back to top
DSSP  llleeeeellllllleeeeeeelleeeeeeeellllllllleeelllleeELLEEEEEEL
Query alqtiinarlpgeeglwqihlqdgkisaidaqsgvmpitensldaeqglvIPPFVEPHIH   60
ident                                                       |    |
Sbjct ------------------------------------lvrklsgtapnpafPRGAVDTQMH   24
DSSP  ------------------------------------llllllllllllllLLLLEELLLL


DSSP  LLlllllllllllllllhhhhhhhhhllhhhLLHH---------hhhHHHH-HHHHHHHH
Query LDttqtagqpnwnqsgtlfegierwaerkalLTHD---------dvkQRAW-QTLKWQIA  110
ident                                                             
Sbjct MY----------------------------lPGYPalpggpglppgaLPGPeDYRRLMQW   56
DSSP  LL----------------------------lLLLLllllllllllllLLLHhHHHHHHHH


DSSP  LLEEEEEEEE---ELLLlllhhHHHHHHHHHHHLllLEEEEEEEllllllllllHHHHhH
Query NGIQHVRTHV---DVSDatltaLKAMLEVKQEVApwIDLQIVAFpqegilsypnGEALlE  167
ident  ||  |          |         |    |         |                 |
Sbjct LGIDRVIITQgnaHQRD-----NGNTLACVAEMG--EAAHAVVI---------iDATTtE  100
DSSP  HLLLEEEEELlhhHLLL-----LHHHHHHHHHHH--HHEEEEEL---------lLLLLlH


DSSP  HHHHLL----LLEEEELHHHlllhhhHHHHHHHHHHHHHHHLLEEEEeELLLllLLLLhh
Query EALRLG----ADVVGAIPHFeftreyGVESLHKTFALAQKYDRLIDVhCDEIddEQSRfv  223
ident                               |      |   |    |             
Sbjct KDMEKLtaagTVGARIMDLP--ggavNLSELDAVDERAHAADWMVAV-QFDG--NGLLdh  155
DSSP  HHHHHHhhllEEEEEEELLL--llllLHHHHHHHHHHHHHLLLEEEE-ELLH--HHHHhh


DSSP  HHHHHHHhhhllhhHEEEEE-LHHHHHLL--HHHHHHHHHHHHHHLLEEEELhhHHHHHL
Query ETVAALAhhegmgaRVTASH-TTAMHSYN--GAYTSRLFRLLKMSGINFVANplVNIHLQ  280
ident               |    |           |     |  |       |           
Sbjct LPRLQKI-----rsRWVFDHhGKFFKGIRtdGPEMAALLKLIDRGNLWFKFA--GVYESS  208
DSSP  HHHHHLL-----llEEEELHhHHLLLLLLllLHHHHHHHHHHHHLLEEEEEL--LHHHLL


DSSP  LLLLllllLLLLlLHHHHHHLL-lLEEELLLLLLLLL----lLLLLllhHHHHHHHHHHl
Query GRFDtypkRRGItRVKEMLESG-iNVCFGHDDVFDPW----yPLGTanmLQVLHMGLHVc  335
ident                             |                           |   
Sbjct RKSW--pyADVAaFSRVIAAHApeRIVWGTNWPHNSVretaaYPDD---ARLAELTLGW-  262
DSSP  LLLL--llHHHHhHHHHHHHHLhhHEEELLLLLLLLLllhhhLLLH---HHHHHHHHLL-


DSSP  llllhhHHHH-HHHHHLHHHHHHLLLLLLllllllllleeeellllhhhhhhhlllllee
Query qlmgygQIND-GLNLITHHSARTLNLQDYgiaagnsanliilpaengfdalrrqvpvrys  394
ident                          |                                  
Sbjct -----lPDEAaRHRALVENPEALFKLSPV-------------------------------  286
DSSP  -----lLLHHhHHHHHLHHHHHHHLLLLL-------------------------------


DSSP  eelleeeeellllleeeellleeeellll
Query vrggkviastqpaqttvyleqpeaidykr  423
ident                              
Sbjct -----------------------------  286
DSSP  -----------------------------


No 37: Query=1k6wA Sbjct=3irsA Z-score=14.8

back to top
DSSP  llleeeeellllllleeeeeeelleeeeeeeellllllllleeelllleeeLLEEEEEEL
Query alqtiinarlpgeeglwqihlqdgkisaidaqsgvmpitensldaeqglviPPFVEPHIH   60
ident                                                             
Sbjct ---------------------------------------------------LKIIDFRLR    9
DSSP  ---------------------------------------------------LLLEELLLL


DSSP  LL------lllLLLLllllllllhhHHHHH-hhllhhhllhhhhhHHHHHHHHHHHHLLE
Query LD------ttqTAGQpnwnqsgtlfEGIER-waerkallthddvkQRAWQTLKWQIANGI  113
ident                              |                          | ||
Sbjct PPamgflnariYTRP----------DIRNRftrqlgfepapsaeeKSLELMFEEMAAAGI   59
DSSP  LLlhhhhhlhhHHLH----------HHHHHhhhhhlllllhhhhhLLHHHHHHHHHHLLL


DSSP  EEEEEEEEL-lllllHHHHHHHHHHHHHLllLEEEEEEELlllLLLL-LLHHHHHHHHHH
Query QHVRTHVDV-sdatlTALKAMLEVKQEVApwIDLQIVAFPqegILSY-PNGEALLEEALR  171
ident                        |            |               |   | | 
Sbjct EQGVCVGRNssvlgsVSNADVAAVAKAYP--DKFHPVGSI---EAATrKEAMAQMQEILD  114
DSSP  LEEEEELLEellleeLLHHHHHHHHHHLL--LLEEEEEEL---LLLLhHHHHHHHHHHHH


DSSP  LLLLEEEELHHHLLLHHHHHH-hHHHHHHHHHHHLLEEEEEELLL--lLLLLLHHHHHHH
Query LGADVVGAIPHFEFTREYGVE-sLHKTFALAQKYDRLIDVHCDEI--dDEQSRFVETVAA  228
ident ||   |   |    |        |    |                   |      |    
Sbjct LGIRIVNLEPGVWATPMHVDDrrLYPLYAFCEDNGIPVIMMTGGNagpDITYTNPEHIDR  174
DSSP  LLLLLEEELHHHLLLLLLLLLhhHHHHHHHHHHLLLLEEEELLLLlllLHHHHLHHHHHH


DSSP  HHHHHLLhhHEEEEE-LHHHHhllhhhhhhHHHHHHHHL-LEEEELhhHHHHhlllllll
Query LAHHEGMgaRVTASH-TTAMHsyngaytsrLFRLLKMSG-INFVANplVNIHlqgrfdty  286
ident           |  ||                                             
Sbjct VLGDFPD-lTVVSSHgNWPWV-------qeIIHVAFRRPnLYLSPD--MYLY--------  216
DSSP  HHHHLLL-lLEEEEHhHLLLH-------hhHHHHHHHLLlEEEELH--HHHL--------


DSSP  llLLLL-lLHHHHHHLLL--LEEELLLLLlllllllLLLL--HHHHHHHhhhhlllllhh
Query pkRRGI-tRVKEMLESGI--NVCFGHDDVfdpwyplGTAN--MLQVLHMglhvcqlmgyg  341
ident                |       ||                     |             
Sbjct --NLPGhaDFIQAANSFLadRMLFGTAYP------mCPLKeyTEWFLTL----------p  258
DSSP  --LLLLhhHHHHHHLLHHhhLLLLLLLLL------lLLHHhhHHHHHLL----------l


DSSP  HHHH-HHHHHLHHHHHhLLLLllllllllllleeeellllhhhhhhhllllleeeellee
Query QIND-GLNLITHHSARtLNLQdygiaagnsanliilpaengfdalrrqvpvrysvrggkv  400
ident    |           | |  |                                       
Sbjct IKPDaMEKILHGNAER-LLAQ---------------------------------------  278
DSSP  LLHHhHHHHHLHHHHH-HHHH---------------------------------------


DSSP  eeellllleeeellleeeellll
Query iastqpaqttvyleqpeaidykr  423
ident                        
Sbjct --------------------agr  281
DSSP  --------------------lll


No 38: Query=1k6wA Sbjct=4ofcA Z-score=14.8

back to top
DSSP  llleeeeellllllleeeeeeelleeeeeeeellllllllleeelllleeellEEEEEEL
Query alqtiinarlpgeeglwqihlqdgkisaidaqsgvmpitensldaeqglvippFVEPHIH   60
ident                                                          | |
Sbjct ----------------------------------------------------mKIDIHSH    8
DSSP  ----------------------------------------------------lLEEEEEE


DSSP  LLL-------------lllllLLLLlllllhhhhhhHHHL-lhhhllhhhhhHHHHHHHH
Query LDT-------------tqtagQPNWnqsgtlfegieRWAE-rkallthddvkQRAWQTLK  106
ident                      |                                      
Sbjct ILPkewpdlkkrfgyggwvqlQHHS-------kgeaKLLKdgkvfrvvrencWDPEVRIR   61
DSSP  LLLlllllhhhhhllllleeeEEEE-------lleeEEEElleeeeeeehhhLLHHHHHH


DSSP  HHHHLLEEEEEEEE-----------elLLLL-LHHHHHHHHHHHHHLllLEEEEEEELll
Query WQIANGIQHVRTHV-----------dvSDAT-LTALKAMLEVKQEVApwIDLQIVAFPqe  154
ident      |                                                      
Sbjct EMDQKGVTVQALSTvpvmfsywakpedTLNLcQLLNNDLASTVVSYP--RRFVGLGTL--  117
DSSP  HHHHHLLLEEEEELlhhhhlllllhhhHHHHhHHHHHHHHHHHHHLL--LLEEEEELL--


DSSP  LLLLLLLHHHHHHHHHH-LLLLEEEELHHhLLLHhHHHH-hHHHHHHHHHHHLLEEEEEE
Query GILSYPNGEALLEEALR-LGADVVGAIPHfEFTReYGVE-sLHKTFALAQKYDRLIDVHC  212
ident             |     ||   |    |            |    | |        || 
Sbjct PMQAPELAVKEMERCVKeLGFPGVQIGTH-VNEW-DLNAqeLFPVYAAAERLKCSLFVHP  175
DSSP  LLLLHHHHHHHHHHHHHlLLLLEEEEELE-ELLE-ELLLhhHHHHHHHHHHHLLEEEEEL


DSSP  -----------------llLLLLlLLHHHHHH--HHHHHHLLhhHEEEEE-LHHHHHLLH
Query -----------------deIDDEqSRFVETVA--ALAHHEGMgaRVTASH-TTAMHSYNG  252
ident                       |                      |   |   |     |
Sbjct wdmqmdgrmakywlpwlvgMPAEtTIAICSMImgGVFEKFPK-lKVCFAHgGGAFPFTVG  234
DSSP  llllllhhhhlllhhhhlhHHHHhHHHHHHHHllLHHHHLLL-lLEEELHhHLLHHHHHH


DSSP  HHH---------------hhHHHHHHhhLLEEEELHHhhhhhllllllllllllllLHHH
Query AYT---------------srLFRLLKmsGINFVANPLvnihlqgrfdtypkrrgitRVKE  297
ident                         |        |                        | 
Sbjct RIShgfsmrpdlcaqdnpmnPKKYLG--SFYTDALVH----------------dplSLKL  276
DSSP  HHHhhhhhlhhhhlllllllHHHHLL--LLEEELLLL----------------lhhHHHH


DSSP  HHHLLL--LEEELLLLLllllLLLLlllhhHHHHHHHhhlLLLLhhHHHHHH-HHHLHHH
Query MLESGI--NVCFGHDDVfdpwYPLGtanmlQVLHMGLhvcQLMGygQINDGL-NLITHHS  354
ident          |  | |       |||                             |     
Sbjct LTDVIGkdKVILGTDYP----FPLG---elEPGKLIE---SMEE--FDEETKnKLKAGNA  324
DSSP  HHHHHLllLEELLLLLL----LLLL---llLLLHHHH---HLLL--LLHHHHhHHHLHHH


DSSP  HHHLLLLLLLlllllllleeeellllhhhhhhhllllleeeelleeeeellllleeeell
Query ARTLNLQDYGiaagnsanliilpaengfdalrrqvpvrysvrggkviastqpaqttvyle  414
ident    | |                                                      
Sbjct LAFLGLERKQ--------------------------------------------------  334
DSSP  HHHHLLLHHH--------------------------------------------------


DSSP  leeeellll
Query qpeaidykr  423
ident          
Sbjct --------f  335
DSSP  --------l


No 39: Query=1k6wA Sbjct=1v77A Z-score=14.5

back to top
DSSP  llleeeeellllllleeeeeeelleeeeeeeellllllllleeelllleeeLLEEEEEEL
Query alqtiinarlpgeeglwqihlqdgkisaidaqsgvmpitensldaeqglviPPFVEPHIH   60
ident                                                      | |  | 
Sbjct ---------------------------------------------------VKFIEMDIR    9
DSSP  ---------------------------------------------------LLLEEEEEL


DSSP  LLLLlllllllllllllhhhhhhhhhllhhhllhhhhhhhhhhhHHHHHHLlEEEEEEEE
Query LDTTqtagqpnwnqsgtlfegierwaerkallthddvkqrawqtLKWQIANgIQHVRTHV  120
ident                                                        |    
Sbjct DKEA----------------------------------------YELAKEW-FDEVVVSI   28
DSSP  LHHH----------------------------------------HHHHHHH-LLEEEEEE


DSSP  ellllllhhhhhhhhhhhhhlllleeeeeeELLLLLlllllhhhhHHHHHHLLL-----L
Query dvsdatltalkamlevkqevapwidlqivaFPQEGIlsypngealLEEALRLGA-----D  175
ident                                  |             | ||         
Sbjct ------------------------------KFNEEV---------DKEKLREARkeygkV   49
DSSP  ------------------------------EELLLL---------LHHHHHHHHhhhllE


DSSP  EEEELHHhlllhhhHHHHHHHHHHHHHhhLLEEEEEELllllllLLHHHHHHHHHhhhll
Query VVGAIPHfeftreyGVESLHKTFALAQkyDRLIDVHCDeiddeqSRFVETVAALAhhegm  235
ident                      |         || |          |              
Sbjct AILLSNP-------KPSLVRDTVQKFK--SYLIYVESN-----dLRVIRYSIEKG-----   90
DSSP  EEEEELL-------LHHHHHHHHHHLL--LLEEEEELL-----lHHHHHHHHHLL-----


DSSP  hhhEEEEELHHHHHLlhhhHHHHHHHHHHHLLEEEELhHHHHHHlLLLLlllLLLL---l
Query garVTASHTTAMHSYngayTSRLFRLLKMSGINFVANpLVNIHLqGRFDtypKRRG---i  292
ident                       |  |            |                     
Sbjct --vDAIISPWVNRKD-pgiDHVLAKLMVKKNVALGFS-LRPLLY-SNPY-erANLLrfmm  144
DSSP  --lLEEELLLLLLLL-lllLHHHHHHHHHHLLEEEEE-LHHHHH-LLHH-hhHHHHhhhh


DSSP  lLHHHHHHLLLLEEELLLLLLLllllLLLLLHHHHHHHHHhHLLLllhhHHHHHHHHHLH
Query tRVKEMLESGINVCFGHDDVFDpwypLGTANMLQVLHMGLhVCQLmgygQINDGLNLITH  352
ident    |                                  |  |        |      |  
Sbjct kAWKLVEKYKVRRFLTSSAQEK----WDVRYPRDLISLGV-VIGM----EIPQAKASISM  195
DSSP  hHHHHHHHHLLLEEEELLLLLH----HHLLLHHHHHHHHH-HLLL----LHHHHHHLLLH


DSSP  HHHHHLLllllllllllllleeeellllhhhhhhhllllleeeelleeeeellllleeee
Query HSARTLNlqdygiaagnsanliilpaengfdalrrqvpvrysvrggkviastqpaqttvy  412
ident      |                                                      
Sbjct YPEIILK-----------------------------------------------------  202
DSSP  HHHHHHL-----------------------------------------------------


DSSP  llleeeellll
Query leqpeaidykr  423
ident            
Sbjct -----------  202
DSSP  -----------


No 40: Query=1k6wA Sbjct=4dlfA Z-score=14.4

back to top
DSSP  llleeeeellllllleeeeeeelleeeeeeeellllllllleeelllleeeLLEEEEEEL
Query alqtiinarlpgeeglwqihlqdgkisaidaqsgvmpitensldaeqglviPPFVEPHIH   60
ident                                                          | |
Sbjct ---------------------------------------------------ALRIDSHQH    9
DSSP  ---------------------------------------------------LLLEEEEEL


DSSP  LLlllllllllllllllhhhhhhhHHLLH-----hhllhhhhhhHHHHHHHHHHHLLEEE
Query LDttqtagqpnwnqsgtlfegierWAERK-----allthddvkqRAWQTLKWQIANGIQH  115
ident                                                       |     
Sbjct FW---------------------rYRAADypwigagmgvlardyLPDALHPLMHAQALGA   48
DSSP  LL---------------------lLLHHHllllllllhhhllllLHHHHHHHHHHLLLLE


DSSP  EEEEE-ELLLlllHHHHHHHHHHHHHLllLEEEEEEELlllllllllHHHH--hHHHHHL
Query VRTHV-DVSDatlTALKAMLEVKQEVApwIDLQIVAFPqegilsypnGEAL--lEEALRL  172
ident                    ||     |       |                    |    
Sbjct SIAVQaRAGR---DETAFLLELACDEA--RIAAVVGWE---------DLRApqlAERVAE   94
DSSP  EEEELlLLLH---HHHHHHHHHHLLLL--LEEEEEELL---------LLLLllhHHHHHL


DSSP  L----LLEEEELHHHLLLHHHHHH--hhHHHHHHHHHHLLEEEEeELLLllLLLLHHHHH
Query G----ADVVGAIPHFEFTREYGVE--slHKTFALAQKYDRLIDVhCDEIddEQSRFVETV  226
ident                |      |         |  |  |   ||        |   |   
Sbjct WrgtkLRGFRHQLQDEADVRAFVDdadfARGVAWLQANDYVYDV-LVFE--RQLPDVQAF  151
DSSP  LllllEEEEEELHHHLLLHHHHHHlhhhHHHHHHHHHLLLEEEE-LLLH--HHHHHHHHH


DSSP  HHHhhHHLLhhHEEEEELHHHHH-------lLHHHHHHH-HHHHHHHLLEEEELhhHHHH
Query AALahHEGMgaRVTASHTTAMHS-------yNGAYTSRL-FRLLKMSGINFVANplVNIH  278
ident  |   |          |                |        |                 
Sbjct CAR--HDAH--WLVLDHAGKPALaefdrddtALARWRAAlRELAALPHVVCKLS--GLVT  205
DSSP  HHH--LLLL--LEEEHHHHLLLHhhllllllHHHHHHHHhHHHHLLLLEEEEEL--LLLL


DSSP  HLLLLL-llLLLL--lllLHHHHHHLLL--LEEELLLLLlllLLLL-LLLLhhHHHHHHH
Query LQGRFD-tyPKRR--gitRVKEMLESGI--NVCFGHDDVfdpWYPL-GTANmlQVLHMGL  332
ident                        |         || |        |        |     
Sbjct EADWRRglrASDLrhieqCLDAALDAFGpqRLMFGSDWP---VCLLaASYD--EVASLVE  260
DSSP  LLLLLLlllHHHHhhhhhHHHHHHHHHLhhHEEELLLLL---HHHHlLLHH--HHHHHHH


DSSP  HhlLLLLhhHHHH-HHHHHLHHHHHHLLLLllllllllllleeeellllhhhhhhhllll
Query HvcQLMGygQIND-GLNLITHHSARTLNLQdygiaagnsanliilpaengfdalrrqvpv  391
ident                  |     ||   |                               
Sbjct R--WAES-rLSAAeRSALWGGTAARCYALP------------------------------  287
DSSP  H--HHHH-hLLHHhHHHHLLHHHHHHLLLL------------------------------


DSSP  leeeelleeeeellllleeeellleeeellll
Query rysvrggkviastqpaqttvyleqpeaidykr  423
ident                                 
Sbjct --------------------------------  287
DSSP  --------------------------------


No 41: Query=1k6wA Sbjct=4hk5D Z-score=14.2

back to top
DSSP  llleeeeellllllleeeeeeelleeeeeeeellllllllleeelllleeELLEEEEEEL
Query alqtiinarlpgeeglwqihlqdgkisaidaqsgvmpitensldaeqglvIPPFVEPHIH   60
ident                                                    |  |  | |
Sbjct --------------------------------------------------TPVVVDIHTH   10
DSSP  --------------------------------------------------LLLLEEEEEE


DSSP  LLL-----------------llllllLLLLlllLHHH----------------hhHHHHl
Query LDT-----------------tqtagqPNWNqsgTLFE----------------giERWAe   87
ident                                   |                     |   
Sbjct MYPpsyiamlekrqtiplvrtfpqadEPRL---ILLSselaaldaaladpaaklpGRPL-   66
DSSP  ELLhhhhhhhhlllllleeeeelleeEEEE---ELLHhhhhhhhhhhhlllllllLEEL-


DSSP  lhhhllhhhhhHHHHHHHHHHHHLLEEEEEEEE----------elLLLL-LHHHHHHHHH
Query rkallthddvkQRAWQTLKWQIANGIQHVRTHV----------dvSDAT-LTALKAMLEV  136
ident                |       |||                                  
Sbjct -------sthfASLAQKMHFMDTNGIRVSVISLanpwfdflapdeAPGIaDAVNAEFSDM  119
DSSP  -------lhhhLLHHHHHHHHHHLLLLEEEEEEllllllllllllHHHHhHHHHHHHHHH


DSSP  HHHHLllLEEEEEEELlllLLLLL--LHHHHHHHHHHLL-LLEEEELHhHLLLhHHHHH-
Query KQEVApwIDLQIVAFPqegILSYP--NGEALLEEALRLG-ADVVGAIPhFEFTrEYGVE-  192
ident          |   |      || |     |  |    |                      
Sbjct CAQHV--GRLFFFAAL---PLSAPvdAVKASIERVKNLKyCRGIILGT-SGLG-KGLDDp  172
DSSP  HHLLL--LLEEEEEEL---LLLLLhhHHHHHHHHHHLLLlEEEEEELL-LLLL-LLLLLh


DSSP  hHHHHHHHHHHHLLEEEEE------------------------elLLLLllLLHHHHH--
Query sLHKTFALAQKYDRLIDVH------------------------cdEIDDeqSRFVETV--  226
ident  |   |        |   |                                   |     
Sbjct hLLPVFEAVADAKLLVFLHphyglpnevygprseeyghvlplalgFPME-tTIAVARMym  231
DSSP  hHHHHHHHHHHLLLEEEELllllllhhhhlllhhhlllhhhhhlhHHHH-hHHHHHHHhh


DSSP  hHHHHH-HLLHhhEEEEE-LHHHHHLlHHHH-------------------hHHHHHHHhH
Query aALAHH-EGMGarVTASH-TTAMHSYnGAYT-------------------sRLFRLLKmS  265
ident      |           |         |                            ||  
Sbjct aGVFDHvRNLQ--MLLAHsGGTLPFLaGRIEscivhdghlvktgkvpkdrrTIWTVLK-E  288
DSSP  lLHHHHlLLLL--EEEHHhHLLHHHHhHHHHhhhhllhhhhhlllllllllLHHHHHH-H


DSSP  LLEEEELHHhhhhhllllllllllllllLHHHHHHLLL--LEEELLLLLlllLLLL----
Query GINFVANPLvnihlqgrfdtypkrrgitRVKEMLESGI--NVCFGHDDVfdpWYPL----  319
ident  |   |                             |       || |       |     
Sbjct QIYLDAVIY----------------sevGLQAAIASSGadRLMFGTDHP---FFPPieed  329
DSSP  LEEEELLLL----------------lhhHHHHHHHHHLhhHEELLLLLL---LLLLllll


DSSP  ----LLLLhHHHHHHHHhhLLLLlhhHHHH-HHHHHLHHHHHHLLLLLllllllllllee
Query ----GTANmLQVLHMGLhvCQLMgygQIND-GLNLITHHSARTLNLQDygiaagnsanli  374
ident                                          | | |              
Sbjct vqgpWDSS-RLNAQAVI--KAVG---EGSSdAAAVMGLNAVRVLSLKA------------  371
DSSP  llllLHHH-HHHHHHHH--HHHL---LLLHhHHHHHLHHHHHHLLLHH------------


DSSP  eellllhhhhhhhllllleeeELLEEeeellllleeeellleeeellll
Query ilpaengfdalrrqvpvrysvRGGKViastqpaqttvyleqpeaidykr  423
ident                                                  
Sbjct -----------------elehHHHHH-----------------------  380
DSSP  -----------------hhhhHHHHL-----------------------


No 42: Query=1k6wA Sbjct=4qrnA Z-score=14.0

back to top
DSSP  llleeeeellllllleeeeeeelleeeeeeeellllllllleeellllEEELLEEEEEEL
Query alqtiinarlpgeeglwqihlqdgkisaidaqsgvmpitensldaeqgLVIPPFVEPHIH   60
ident                                                             
Sbjct --------------------------------------smtqdlktggEQGYLRIATEEA   22
DSSP  --------------------------------------llllllllllLLLLLLEEEEEE


DSSP  LLL-----lllllllllllllLHHHHHHHHHLL--hhhllhhhhhHHHH-HHHHHHHHLL
Query LDT-----tqtagqpnwnqsgTLFEGIERWAER--kallthddvkQRAW-QTLKWQIANG  112
ident   |                           |                          | |
Sbjct FATreiidvylrmirdgtadkGMVSLWGFYAQSpseratqilerlLDLGeRRIADMDATG   82
DSSP  ELLhhhhhhhhhhhhhllllhHHHHHHHHHHHLllhhhhhhhhhhHLLLhHHHHHHHHLL


DSSP  EEEEEEEE-----------ellLLLL-HHHHHHHHHHHHHLllLEEEEEEELlllLLLL-
Query IQHVRTHV-----------dvsDATL-TALKAMLEVKQEVApwIDLQIVAFPqegILSY-  159
ident |                           |        |                      
Sbjct IDKAILALtspgvqplhdldeaRTLAtRANDTLADACQKYP--DRFIGMGTV---APQDp  137
DSSP  LLEEEEEEllllllllllhhhhHHHHhHHHHHHHHHHHHLL--LLEEELLLL---LLLLh


DSSP  LLHHHHHHHHHHL-LLLEEEELHhHLLLhHHHHH-hhHHHHHHHHHHLLEEEEE------
Query PNGEALLEEALRL-GADVVGAIPhFEFTrEYGVE-slHKTFALAQKYDRLIDVH------  211
ident            |  |               |  |      |      |     |      
Sbjct EWSAREIHRGARElGFKGIQINS-HTQG-RYLDEeffDPIFRALVEVDQPLYIHpatspd  195
DSSP  HHHHHHHHHHHHLlLLLLEEELL-LLLL-LLLLLhhhHHHHHHHHHHLLLEEELllllll


DSSP  ---------------elLLLLllLLHHHH--hhHHHHHHLLHhHEEEEE-LHHHHHLLHH
Query ---------------cdEIDDeqSRFVET--vaALAHHEGMGaRVTASH-TTAMHSYNGA  253
ident                                                 |   |       
Sbjct smidpmleagldgaifgFGVE-tGMHLLRlitiGIFDKYPSL-QIMVGHmGEALPYWLYR  253
DSSP  lllhhhhhhlllllllhHHHH-hHHHHHHhhhhLHHHHLLLL-LEEELHhHHLHHHHHHH


DSSP  HH-------------------hHHHHHHHhHLLEEEELHHhhhhhllllllllllllllL
Query YT-------------------sRLFRLLKmSGINFVANPLvnihlqgrfdtypkrrgitR  294
ident                            || |                             
Sbjct LDymhqagvrsqryermkplkkTIEGYLK-SNVLVTNSGV---------------awepA  297
DSSP  HHhhhhhhhhllllllllllllLHHHHHH-HLEEEELLLL---------------llhhH


DSSP  HHHHHHLLL--LEEELLLLLLllllllllLLHHHHHHHhhhhlllllhHHHH-HHHHHHL
Query VKEMLESGI--NVCFGHDDVFdpwyplgtANMLQVLHMglhvcqlmgyGQIN-DGLNLIT  351
ident  |          |    |                |  |                      
Sbjct IKFCQQVMGedRVMYAMDYPY-------qYVADEVRAM-------damDMSAqTKKKFFQ  343
DSSP  HHHHHHHHLhhHEELLLLLLL-------lLLHHHHHHH-------hllLLLHhHHHHHHL


DSSP  HHHHHHLLLlllllllllllleeeellllhhhhhhhllllleeeelleeeeellllleee
Query HHSARTLNLqdygiaagnsanliilpaengfdalrrqvpvrysvrggkviastqpaqttv  411
ident         |                                                   
Sbjct TNAEKWFKL---------------------------------------------------  352
DSSP  HHHHHHLLL---------------------------------------------------


DSSP  ellleeeellll
Query yleqpeaidykr  423
ident             
Sbjct ------------  352
DSSP  ------------


No 43: Query=1k6wA Sbjct=2gwgA Z-score=13.9

back to top
DSSP  llleeeeellllllleeeeeeelleeeeeeeellllllllleeelllleeelLEEEEEEL
Query alqtiinarlpgeeglwqihlqdgkisaidaqsgvmpitensldaeqglvipPFVEPHIH   60
ident                                                          | |
Sbjct ----------------------------------------------------XIIDIHGH    8
DSSP  ----------------------------------------------------LLEEEEEE


DSSP  LlLLLLlllllllllllhhhhhhhHHLLHH------------------HLLHHHHHHHHH
Query LdTTQTagqpnwnqsgtlfegierWAERKA------------------LLTHDDVKQRAW  102
ident   ||                                                |       
Sbjct Y-TTAP----------------kaLEDWRNrqiagikdpsvxpkvselKISDDELQASII   51
DSSP  L-LLLL----------------hhHHHHHHhhhhhhhlhhhlllhhhlLLLHHHHHHHHH


DSSP  -HHHHHHHHLLEEEEEEEEE-----lLLLL-LHHHHHHHHHHHHHLllLEEEEEEELlll
Query -QTLKWQIANGIQHVRTHVD-----vSDAT-LTALKAMLEVKQEVApwIDLQIVAFPqeg  155
ident    ||     |               |             | |           |     
Sbjct eNQLKKXQERGSDLTVFSPRagdfnvSSTWaAICNELCYRVSQLFP--DNFIGAAXL--p  107
DSSP  lLHHHHHHHHLLLEEEEELLlllhhhHHHHhHHHHHHHHHHHHHLL--LLEEEEEEL--l


DSSP  LLLLLLHHHhHHHHHHLL-----LLEEEELhHHLL----LHHHHHH-hHHHHHHHHHHHL
Query ILSYPNGEAlLEEALRLG-----ADVVGAIpHFEF----TREYGVE-sLHKTFALAQKYD  205
ident               |                        |                    
Sbjct QSPGVDPKT-CIPELEKCvkeygFVAINLN-PDPSgghwTSPPLTDriWYPIYEKXVELE  165
DSSP  LLLLLLHHH-HHHHHHHHhhlllLLEEEEL-LLLLllllLLLLLLLhhHHHHHHHHHHHL


DSSP  LEEEEE----elLLLLllLLHHHH--hhHHHHHHLLHhHEEEEE-LHHHHHLlHHHHH--
Query RLIDVH----cdEIDDeqSRFVET--vaALAHHEGMGaRVTASH-TTAMHSYnGAYTS--  256
ident      |                       |             |   |            
Sbjct IPAXIHvstgahYLNA-dTTAFXQcvagDLFKDFPEL-KFVIPHgGGAVPYH-WGRFRgl  222
DSSP  LLEEELlllllhHHHH-hHHHHHHhhhlLHHHHLLLL-LEEELHhHLLLHHH-HHHHHhh


DSSP  -------HHHHHHHhHLLEEEELHHhhhhhllllllllllllllLHHHHHhlLLLEEELL
Query -------RLFRLLKmSGINFVANPLvnihlqgrfdtypkrrgitRVKEMLesGINVCFGH  309
ident         |        | |                                  || |  
Sbjct aqexkkpLLEDHVL-NNIFFDTCVY------------hqpgidlLNTVIP--VDNVLFAS  267
DSSP  hhhllllLHHHHLL-LLEEEELLLL------------lhhhhhhHHHHLL--HHHEELLL


DSSP  LLLLllLLLL----llllhhHHHHHHHHhlllllHHHHHH-HHHHHLHHHHHHLL--LLL
Query DDVFdpWYPL----gtanmlQVLHMGLHvcqlmgYGQIND-GLNLITHHSARTLN--LQD  362
ident                                                    |        
Sbjct EXIG--AVRGidprtgfyydDTKRYIEA-----sTILTPEeKQQIYEGNARRVYPrlDAA  320
DSSP  LLLL--LLLLeelllleellLLHHHHHH-----lLLLLHHhHHHHHLHHHHHHLHhhHHH


DSSP  LllllLLLLleeeellllhhhhhhhllllleeeelleeeeellllleeeellleeeelll
Query YgiaaGNSAnliilpaengfdalrrqvpvrysvrggkviastqpaqttvyleqpeaidyk  422
ident                                                             
Sbjct L---kAKGK-------------------------------------------------le  328
DSSP  H---hHHHH-------------------------------------------------hl


DSSP  l
Query r  423
ident  
Sbjct h  329
DSSP  l


No 44: Query=1k6wA Sbjct=2dvtA Z-score=13.9

back to top
DSSP  llleeeeellllllleeeeeeelleeeeeeeellllllllleeelllleeELLEEEEEEL
Query alqtiinarlpgeeglwqihlqdgkisaidaqsgvmpitensldaeqglvIPPFVEPHIH   60
ident                                                       |    |
Sbjct --------------------------------------------------MQGKVALEEH   10
DSSP  --------------------------------------------------LLLEEEEEEE


DSSP  LL----lllLLLLllLLLLLlhhhhhhhhhllhhhllhhhhhHHHH-HHHHHHHHLLEEE
Query LD----ttqTAGQpnWNQSGtlfegierwaerkallthddvkQRAW-QTLKWQIANGIQH  115
ident           ||                                     ||   | ||  
Sbjct FAipetlqdSAGF--VPGDY--------------wkelqhrlLDIQdTRLKLMDAHGIET   54
DSSP  ELlhhhhhhHLLL--LLLLH--------------hhhhhhhhHLLLlHHHHHHHHLLEEE


DSSP  EEEEE-----------elLLLL-LHHHHHHHHHHHHHLllLEEEEEEELllLLLLLLLHH
Query VRTHV-----------dvSDAT-LTALKAMLEVKQEVApwIDLQIVAFPqeGILSYPNGE  163
ident                          |     |              |             
Sbjct MILSLnapavqaipdrrkAIEIaRRANDVLAEECAKRP--DRFLAFAAL--PLQDPDAAT  110
DSSP  EEEEElllhhhhlllhhhHHHHhHHHHHHHHHHHHHLL--LLEEEEELL--LLLLHHHHH


DSSP  HHHHHHHH-LLLLEEEELhHHLL-----LHHHHHH-hHHHHHHHHHHHLLEEEEE-----
Query ALLEEALR-LGADVVGAIpHFEF-----TREYGVE-sLHKTFALAQKYDRLIDVH-----  211
ident   |      ||         |       |  |              | |     |     
Sbjct EELQRCVNdLGFVGALVN-GFSQegdgqTPLYYDLpqYRPFWGEVEKLDVPFYLHprnpl  169
DSSP  HHHHHHHHlLLLLEEEEE-LLLLlllllLLLLLLLhhHHHHHHHHHHHLLLEEEElllll


DSSP  -----------------elLLLLllLLHHHHHH--HHHHHHLLHhHEEEEE-LHHHHHLL
Query -----------------cdEIDDeqSRFVETVA--ALAHHEGMGaRVTASH-TTAMHSYN  251
ident                                     |             |         
Sbjct pqdsriydghpwllgptwaFAQE-tAVHALRLMasGLFDEHPRL-NIILGHmGEGLPYMM  227
DSSP  hhhlhhhlllhhhlhhhlhHHHH-hHHHHHHHHhlLHHHHLLLL-LEEELHhHLLHHHHH


DSSP  HHHH---------------hHHHHHHHhHLLEEEELhHHHHhhllllllllllllllLHH
Query GAYT---------------sRLFRLLKmSGINFVANpLVNIhlqgrfdtypkrrgitRVK  296
ident                     |                                       
Sbjct WRIDhrnawvklpprypakrRFMDYFN-ENFHITTS-GNFR----------tqtlidAIL  275
DSSP  HHHHhlllllllllllllllLHHHHHH-HHEEEELL-LLLL----------hhhhhhHHL


DSSP  HHHhllLLEEELLLLLLllllllLLLL--HHHHHHHhhhhlllllhhHHHH-HHHHHLHH
Query EMLesgINVCFGHDDVFdpwyplGTAN--MLQVLHMglhvcqlmgygQIND-GLNLITHH  353
ident |         |  |  |                                           
Sbjct EIG--aDRILFSTDWPF------ENIDhaSDWFNAT----------sIAEAdRVKIGRTN  317
DSSP  LLL--hHHEELLLLLLL------LLHHhhHHHHHHL----------lLLHHhHHHHHLHH


DSSP  HHHHLLLLllllllllllleeeellllhhhhhhhllllleeeelleeeeellllleeeel
Query SARTLNLQdygiaagnsanliilpaengfdalrrqvpvrysvrggkviastqpaqttvyl  413
ident   |   |                                                     
Sbjct ARRLFKLD----------------------------------------------------  325
DSSP  HHHHLLLL----------------------------------------------------


DSSP  lleeeellll
Query eqpeaidykr  423
ident           
Sbjct ----------  325
DSSP  ----------


No 45: Query=1k6wA Sbjct=3pnuA Z-score=13.7

back to top
DSSP  llleeeeellllLLLEeeeeeelleeeeeeeellllllllleeelLLLEEELLEEEEEEL
Query alqtiinarlpgEEGLwqihlqdgkisaidaqsgvmpitensldaEQGLVIPPFVEPHIH   60
ident             |                                            | |
Sbjct ------------ENLY---------------------------fqSNAMKLKNPLDMHLH   21
DSSP  ------------LLLL---------------------------llLLLEEEELLEEEEEL


DSSP  LLlllllllllllllllhhhhhhhhhllhhhllhhhHHHHHHHHHHHHHHlLEEEEEEEE
Query LDttqtagqpnwnqsgtlfegierwaerkallthddVKQRAWQTLKWQIAnGIQHVRTHV  120
ident |                                     |                     
Sbjct LR----------------------------------DNQMLELIAPLSAR-DFCAAVIMP   46
DSSP  LL----------------------------------LHHHHHHHHHHHHL-LLLEEEELL


DSSP  ----ELLLllLHHHHHHHHHHHH-HLLL-LEEEEEEELlllllllllHHHH---HHHHHH
Query ----DVSDatLTALKAMLEVKQE-VAPW-IDLQIVAFPqegilsypnGEAL---LEEALR  171
ident           |  |||                    |                 |  |  
Sbjct nlipPLCN--LEDLKAYKMRILKaCKDEnFTPLMTLFF---------KNYDekfLYSAKD   95
DSSP  llllLLLL--HHHHHHHHHHHHHhHLLLlLEEEEEEEL---------LLLLhhhHHHHLL


DSSP  lLLLEEEELHHHL----llhhHHHH--hhHHHHHHHHHHLLEEEEEEL--llLLLL-LLH
Query lGADVVGAIPHFE----ftreYGVE--slHKTFALAQKYDRLIDVHCD--eiDDEQ-SRF  222
ident          |                     |            ||           | |
Sbjct -EIFGIXLYPAGIttnsnggvSSFDieylKPTLEAMSDLNIPLLVHGEtndfVMDReSNF  154
DSSP  -LLLEEEELLLLLllllllllLLLLhhhhHHHHHHHHHLLLLEEELLLllllHHHLlHHH


DSSP  HhHHHHHHHHHLLhhHEEEEELHHHhhllhhhhhhhhHHHHHHL-LEEEELHHhHHHHlL
Query VeTVAALAHHEGMgaRVTASHTTAMhsyngaytsrlfRLLKMSG-INFVANPLvNIHLqG  281
ident       || |          | |               |||                   
Sbjct AkIYEKLAKHFPR-lKIVMEHITTK---------tlcELLKDYEnLYATITLH-HLII-T  202
DSSP  HhHHHHHHHHLLL-lLEEELLLLLH---------hhhHHHHHLLlEEEEELLH-HHLL-L


DSSP  LLL--LLLL------------LLLLlLHHHHH-hlLLLEEELLLLLLL---lLLLLLLL-
Query RFD--TYPK------------RRGItRVKEML-esGINVCFGHDDVFD---pWYPLGTA-  322
ident   |                          |        | || |              | 
Sbjct LDDviGGKMnphlfckpiakrYEDKeALCELAfsgYEKVMFGSDSAPHpkgcAAGVFSAp  262
DSSP  HHHhhLLLLlhhhllllllllHHHHhHHHHHHhllLLLEEELLLLLLLllllLLLLLLHh


DSSP  LHHHHHHhhhhhlllllHHHHHH-HHHHHLHHHHHHlLLLLLlllllLLLLEEEELL---
Query NMLQVLHmglhvcqlmgYGQIND-GLNLITHHSARTlNLQDYgiaagNSANLIILPA---  378
ident   | ||                                                |     
Sbjct VILPVLA------elfkQNSSEEnLQKFLSDNTCKI-YDLKF-----KEDKILTLEEkew  310
DSSP  HHHHHHH------hhhhHHLLHHhHHHHHLHHHHHH-HLLLL-----LLLLEEEEELlle


DSSP  -------------llhhhhhHHLLLLLEeeelleeeeellllleeeellleeeellll
Query -------------engfdalRRQVPVRYsvrggkviastqpaqttvyleqpeaidykr  423
ident                                                           
Sbjct qvpnvyedkynqvvpymageILKFQLKH------------------------------  338
DSSP  elllleelllleelllllllEELLEELL------------------------------


No 46: Query=1k6wA Sbjct=1itqA Z-score=13.4

back to top
DSSP  llleeeeellllllleeeeeeelleeeeeeeellllllllleeelllleEELLEEEEEEL
Query alqtiinarlpgeeglwqihlqdgkisaidaqsgvmpitensldaeqglVIPPFVEPHIH   60
ident                                                     |    |  
Sbjct --------------------------------------dffrdeaerimRDSPVIDGHND   22
DSSP  --------------------------------------lhhhhhhhhhhLLLLEEEEEEL


DSSP  LLLLlllllllllllllhhhhhhhhhllhhHLLHHH-------hhhhhhHHHH-HHHHLL
Query LDTTqtagqpnwnqsgtlfegierwaerkaLLTHDD-------vkqrawQTLK-WQIANG  112
ident |                                                 |      |  
Sbjct LPWQ-----------------------lldMFNNRLqderanlttlagtHTNIpKLRAGF   59
DSSP  HHHH-----------------------hhhHHLLLLllhhhllllllllLLLHhHHHHLL


DSSP  EEEEEEEEEL--------LLLL-LHHHHHHHHHHHHHLL------------------LLE
Query IQHVRTHVDV--------SDAT-LTALKAMLEVKQEVAP------------------WID  145
ident        |               |                                    
Sbjct VGGQFWSVYTpcdtqnkdAVRRtLEQMDVVHRMCRMYPEtflyvtssagirqafregKVA  119
DSSP  EEEEEEEELLlhhhllllHHHHhHHHHHHHHHHHHHLLLleeelllhhhhhhhhhllLEE


DSSP  EEEEEELLLlllllLLHHHHHHHHHHLLLLEEEEL-hHHLL-------------LHHHHH
Query LQIVAFPQEgilsyPNGEALLEEALRLGADVVGAI-pHFEF-------------TREYGV  191
ident   |                 |     ||                              | 
Sbjct SLIGVEGGH---siDSSLGVLRALYQLGMRYLTLThsCNTPwadnwlvdtgdsePQSQGL  176
DSSP  EEEEEELHH---hlLLLHHHHHHHHHLLEEEEELLllLLLLllllhhhllllllLLLLLL


DSSP  H-hHHHHHHHHHHHLLEEEEEELllllllLLHHHHHHHHhhhHLLHhhEEEEEL------
Query E-sLHKTFALAQKYDRLIDVHCDeiddeqSRFVETVAALahhEGMGarVTASHT------  244
ident                 |||                   |         |  ||       
Sbjct SpfGQRVVKELNRLGVLIDLAHV-----sVATMKATLQL---SRAP--VIFSHSsaysvc  226
DSSP  LhhHHHHHHHHHHHLLEEELLLL-----lHHHHHHHHHH---LLLL--LEELLLllllll


DSSP  ---HHHHhllhhhhHHHHHHHHHHLLEEEELHhHHHHHLLLlllllllllllLHHHHHHL
Query ---TAMHsyngaytSRLFRLLKMSGINFVANPlVNIHLQGRfdtypkrrgitRVKEMLES  301
ident                   || |        |   |                       | 
Sbjct asrRNVP-------DDVLRLVKQTDSLVMVNF-YNNYISCT-nkanlsqvadHLDHIKEV  277
DSSP  lllLLLL-------HHHHHHHHHHLLEEEELL-LHHHHLLL-llllhhhhhhHHHHHHHH


DSSP  LL--LEEELLLLLlllLLLL----LLLL-HHHHHHhhhhhllLLLHHHHHH-HHHHHLHH
Query GI--NVCFGHDDVfdpWYPL----GTAN-MLQVLHmglhvcqLMGYGQIND-GLNLITHH  353
ident      | || |                               |                 
Sbjct AGarAVGFGGDFD--gVPRVpeglEDVSkYPDLIA------eLLRRNWTEAeVKGALADN  329
DSSP  LLhhHEEELLLLL--lLLLLllllLLLLlHHHHHH------hHHHLLLLHHhHHHHHLHH


DSSP  HHHHLLllllllllllllleeeellllhhhhhhhllllleeeelleeeeellllleeeel
Query SARTLNlqdygiaagnsanliilpaengfdalrrqvpvrysvrggkviastqpaqttvyl  413
ident   |                                                         
Sbjct LLRVFE------------------------------aveqasnltqapeeepipldqlgg  359
DSSP  HHHHHH------------------------------hhhhllllllllllllllhhhlll


DSSP  lleeeellll
Query eqpeaidykr  423
ident           
Sbjct scrthygyss  369
DSSP  llllllllll


No 47: Query=1k6wA Sbjct=2qpxA Z-score=13.1

back to top
DSSP  llleeeeellllllleeeeeeelleeeeeeeellllllllleeelllleeELLEEEEEEL
Query alqtiinarlpgeeglwqihlqdgkisaidaqsgvmpitensldaeqglvIPPFVEPHIH   60
ident                                                     |    | |
Sbjct ----------------------------------------gxddlsefvdQVPLLDHHCH   20
DSSP  ----------------------------------------lllllhhhhhHLLEEEEEEL


DSSP  LllLLLLLLLLLLL----llLHHH--------------------hhhhhhllhhhllhhh
Query LdtTQTAGQPNWNQ----sgTLFE--------------------gierwaerkallthdd   96
ident          ||         |                                       
Sbjct F--LIDGKVPNRDDrlaqvsTEADkdypladtknrlayhgflalakefaldannplaaxn   78
DSSP  L--LLLLLLLLHHHhhhhhlLLLLllllhhhhlllhhhhhhhhhhhhhllllllllllll


DSSP  hhhhhhHHHHHHHHLLEEEEEEEEEllllllhhhhhhhHHHHHHLL--LLEEEEEEELLL
Query vkqrawQTLKWQIANGIQHVRTHVDvsdatltalkamlEVKQEVAP--WIDLQIVAFPQE  154
ident                                             |    |          
Sbjct dpgyatYNHRIFGHFHFKELLIDTG------fvpddpiLDLDQTAElvGIPVKAIYRLET  132
DSSP  hhhhhhHHHHHHHHLLEEEEEEELL------lllllllLLHHHHHHhhLLLEEEEEEHHH


DSSP  llLLLL------------LHHHHHHHHHHLLLLEEEELHHHL------------------
Query giLSYP------------NGEALLEEALRLGADVVGAIPHFE------------------  184
ident                           |   |      |                      
Sbjct -hAEDFxlehdnfaawwqAFSNDVKQAKAHGFVGFXSIAAYRvglhlepvnvieaaagfd  191
DSSP  -hHHHHhlllllhhhhhhHHHHHHHLLLLLLLLLEEELHHHHlllllllllhhhhhhhhh


DSSP  ----------LLHHHHHHHHHHHHHHHHHHLLEEEEEELLL----LLLLLLH--HHHHHH
Query ----------FTREYGVESLHKTFALAQKYDRLIDVHCDEI----DDEQSRF--VETVAA  228
ident                    |          |     |        |              
Sbjct twkhsgekrlTSKPLIDYXLYHVAPFIIAQDXPLQFHVGYGdadtDXYLGNPllXRDYLK  251
DSSP  hhhhhlllllLLHHHHHHHHHHHHHHHHHHLLLEEEEELLLllllLHHHLLHhhHHHHHH


DSSP  HHHHHLLhhHEEEEELHHHhhllhhhhhhhhHHHHHHL-LEEEEL-HHHHHHhlllllll
Query LAHHEGMgaRVTASHTTAMhsyngaytsrlfRLLKMSG-INFVAN-PLVNIHlqgrfdty  286
ident      |    |   |                 |        |                  
Sbjct AFTKKGL--KVVLLHCYPY-------hreagYLASVFPnLYFDISlLDNLGP--------  294
DSSP  HHHHHLL--LEEEEELLLL-------hhhhhHHHHHLLlEEEELLlHHHHLH--------


DSSP  lllllllLHHHHHHLLL--LEEELLLLLLLlllllLLLL--HHHHhHHHHHhlLLLL---
Query pkrrgitRVKEMLESGI--NVCFGHDDVFDpwyplGTAN--MLQVlHMGLHvcQLMG---  339
ident           |  |        |  |                 |     |          
Sbjct --sgasrVFNEAVELAPytRILFASDASTY----pEXYGlaARQF-KQALV--AHFNqlp  345
DSSP  --hhhhhHHHHHLLLLLhhHEELLLLLLLL----hHHHHhhHHHH-HHHHH--HHHHlll


DSSP  ---HHHHHH-HHHHHLHHHHHHLLL-LLLLLllllllleeeellllhhhhhhhlllllee
Query ---YGQIND-GLNLITHHSARTLNL-QDYGIaagnsanliilpaengfdalrrqvpvrys  394
ident      |            ||                                        
Sbjct fvdLAQKKAwINAICWQTSAKLYHQeRELRV-----------------------------  376
DSSP  lllHHHHHHhHHHHHLHHHHHHLLLhHHHLL-----------------------------


DSSP  eelleeeeellllleeeellleeeellll
Query vrggkviastqpaqttvyleqpeaidykr  423
ident                              
Sbjct -----------------------------  376
DSSP  -----------------------------


No 48: Query=1k6wA Sbjct=4dziC Z-score=12.7

back to top
DSSP  llleeeeellllllleeeeeeelleeeeeeeellllllllleeellllEEELLEEEEEEL
Query alqtiinarlpgeeglwqihlqdgkisaidaqsgvmpitensldaeqgLVIPPFVEPHIH   60
ident                                                            |
Sbjct ------------------------------------------------ALNYRVIDVDNH   12
DSSP  ------------------------------------------------LLLLLEEEEEEE


DSSP  LLL-------------------llllllLLLL-llllhHHHHHHHhLLHH----------
Query LDT-------------------tqtagqPNWN-qsgtlFEGIERWaERKA----------   90
ident                               |          |                  
Sbjct YYEpldsftrhldkkfkrrgvqmlsdgkRTWAvigdrvNHFIPNP-TFDPiivpgcldll   71
DSSP  LLLllllllllllhhhlllleeeeelllLEEEeelleeLLLLLLL-LLLLeelllllhhh


DSSP  ------------------hllhhhhhHHHHHHHHHHHHLLEEEEEEEE------------
Query ------------------llthddvkQRAWQTLKWQIANGIQHVRTHV------------  120
ident                           |             |                   
Sbjct frgeipdgvdpaslmkverladhpeyQNRDARIAVMDEQDIETAFMLPtfgcgveealkh  131
DSSP  hhllllllllhhhllleelhhhlhhhLLHHHHHHHHHHHLEEEEEEELlhhhhhhhhlll


DSSP  ------elLLLL-LHHHHHHHhhHHHHLlllEEEEEEELlllLLLL-lLHHHhhHHHHHL
Query ------dvSDAT-LTALKAMLevKQEVApwiDLQIVAFPqegILSY-pNGEAllEEALRL  172
ident           |  |                             |             |  
Sbjct dieatmasVHAFnLWLDEDWG-fDRPDH---RIIAAPIV---SLADptRAVEevDFVLAR  184
DSSP  lhhhhhhhHHHHhHHHHHHLL-lLLLLL---LEEELLLL---LLLLhhHHHHhhHHHHHL


DSSP  LLLEEEELHHHLLL---HHHHHH-hhHHHHHHHHHHLLEEEEE-----------------
Query GADVVGAIPHFEFT---REYGVE-slHKTFALAQKYDRLIDVH-----------------  211
ident ||  |   |                     |           |                 
Sbjct GAKLVLVRPAPVPGlvkPRSLGDrshDPVWARLAEAGVPVGFHlsdsgylhiaaawggak  244
DSSP  LLLLEELLLLLLLLlllLLLLLLhhhHHHHHHHHHHLLLEEEEllllllhhhhhhlllll


DSSP  ---elllLLLLL--LHHHHHH--HHHHHHLLhhHEEEE-ELHHHhhllhHHHHHH-----
Query ---cdeiDDEQS--RFVETVA--ALAHHEGMgaRVTAS-HTTAMhsyngAYTSRL-----  258
ident         |                                            ||     
Sbjct dpldqvlLDDRAihDTMASMIvhGVFTRHPK-lKAVSIeNGSYF---vhRLIKRLkkaan  300
DSSP  lhhhhhhHLLHHhhHHHHHHHhlLHHHHLLL-lLEEEElLLLLH---hhHHHHHHhhhhh


DSSP  ----------HHHHHhHLLEEEElhhhhhhhllllllllllllLLLHHHHHHLLL--LEE
Query ----------FRLLKmSGINFVAnplvnihlqgrfdtypkrrgITRVKEMLESGI--NVC  306
ident              |                                  |           
Sbjct tqpqyfpedpVEQLR-NNVWIAP------------------yyEDDLPELARVIGvdKIL  341
DSSP  hlhhhllllhHHHHH-HHEEELL------------------llLLLHHHHHHHHLhhHLL


DSSP  ELLLLLllllLLLLllLHHHHhHHHHhhlLLLLhhhHHHHHHHHLHHHHHHLLLLlllll
Query FGHDDVfdpwYPLGtaNMLQVlHMGLhvcQLMGygqINDGLNLITHHSARTLNLQdygia  366
ident || |         |           |            |            |  |     
Sbjct FGSDWP----HGEGlaSPVSF-TAEL---KGFS---ESDIRKIMRDNALDLLGVQ-----  385
DSSP  LLLLLL----LLLLllLHHHH-HHHH---LLLL---HHHHHHHHLHHHHHHHLLL-----


DSSP  lllllleeeellllhhhhhhhllllleeeelleeeeellllleeeellleeeellll
Query agnsanliilpaengfdalrrqvpvrysvrggkviastqpaqttvyleqpeaidykr  423
ident                                                          
Sbjct ------------------------------------------------------vgs  388
DSSP  ------------------------------------------------------lll


No 49: Query=1k6wA Sbjct=3qy6A Z-score=12.1

back to top
DSSP  llleeeeellllllleeeeeeelleeeeeeeellllllllleeelllleeellEEEEEEL
Query alqtiinarlpgeeglwqihlqdgkisaidaqsgvmpitensldaeqglvippFVEPHIH   60
ident                                                          | |
Sbjct -----------------------------------------------------MIDIHCH    7
DSSP  -----------------------------------------------------LEELLLL


DSSP  LL----LLLLlllllllllllhhhhhhhhhllhhhllhhhHHHHHHHHHHHHHHLLEEEE
Query LD----TTQTagqpnwnqsgtlfegierwaerkallthddVKQRAWQTLKWQIANGIQHV  116
ident                                                        ||   
Sbjct ILpamdDGAG------------------------------DSADSIEMARAAVRQGIRTI   37
DSSP  LLllllLLLL------------------------------LHHHHHHHHHHHHHLLLLEE


DSSP  EEEE------ELLLllLHHHHHHHHHHHHHL---LLLEEEEEEellllllllllhhhhhh
Query RTHV------DVSDatLTALKAMLEVKQEVA---PWIDLQIVAfpqegilsypngealle  167
ident                      |                                      
Sbjct IATPhhnngvYKNE-pAAVREAADQLNKRLIkedIPLHVLPGQ-----------------   79
DSSP  ELLLeellllLLLL-hHHHHHHHHHHHHHHHhllLLLEEELLL-----------------


DSSP  hhhhlllleeEELHhhlllhhhhhhhHHHHHHHHHH-HLLE------EEEEELLllllLL
Query ealrlgadvvGAIPhfeftreygvesLHKTFALAQK-YDRL------IDVHCDEiddeQS  220
ident                                    |           |            
Sbjct ----------EIRI------------YGEVEQDLAKrQLLSlndtkyILIEFPF----DH  113
DSSP  ----------EEEL------------LLLHHHHHHLlLLLLhhhlleEEEELLL----LL


DSSP  LH--HHHHHHHHHHHLLHhhEEEEELHH---HHHLLHhHHHHHHHHHhhhlLEEEELHHH
Query RF--VETVAALAHHEGMGarVTASHTTA---MHSYNGaYTSRLFRLLkmsgINFVANPLV  275
ident      |         |        |                 |                 
Sbjct VPryAEQLFYDLQLKGYI--PVIAHPERnreIRENPS-LLYHLVEKG----AASQITSGS  166
DSSP  LLllHHHHHHHHHHLLLE--EEEELHHHlhhHHHLLH-HHHHHHHLL----LEEEEEHHH


DSSP  -hHHHLLLllllllLLLL-lLHHHHhhllLLEEELLLLLLllllLLLLLLHHHHHHHHHH
Query -nIHLQGRfdtypkRRGI-tRVKEMlesgINVCFGHDDVFdpwyPLGTANMLQVLHMGLH  333
ident                      |              |                 |     
Sbjct laGIFGKQ-----lKAFSlrLVEAN----LIHFVASDAHN---vKTRNFHTQEALYVLEK  214
DSSP  hlLLLLHH-----hHHHHhhHHHLL----LLLEEELLLLL---lLLLLLLHHHHHHHHHH


DSSP  hlLLLLhhhhHHHHHHHlHHHHHHLLLLllllllllllleeeellllhhhhhhhllllle
Query vcQLMGygqiNDGLNLItHHSARTLNLQdygiaagnsanliilpaengfdalrrqvpvry  393
ident                |        |  |                                
Sbjct --EFGS----ELPYMLT-ENAELLLRNQ--------------------------------  235
DSSP  --HHLL----HHHHHHH-HHHHHHHLLL--------------------------------


DSSP  eeelleeeeellllleeeellleeeellll
Query svrggkviastqpaqttvyleqpeaidykr  423
ident                               
Sbjct ------------------tifrqppqpvkr  247
DSSP  ------------------llllllllllll


No 50: Query=1k6wA Sbjct=1j5sA Z-score=11.8

back to top
DSSP  llleeeeellllllleeeeeeelleeeeeeeellllllllleeelllleeELLEEEEEEL
Query alqtiinarlpgeeglwqihlqdgkisaidaqsgvmpitensldaeqglvIPPFVEPHIH   60
ident                                                     | | || |
Sbjct ---------------------------hmflgedylltnraavrlfnevkDLPIVDPHNH   33
DSSP  ---------------------------llllllllllllhhhhhhhhhhlLLLEEELLLL


DSSP  LLlllllllllllllllhhhhhhhhhllhhhllhhhhHHHHH------------------
Query LDttqtagqpnwnqsgtlfegierwaerkallthddvKQRAW------------------  102
ident ||                                                          
Sbjct LD-----------------------------------AKDIVenkpwndiwevegatdhy   58
DSSP  LL-----------------------------------HHHHHhllllllhhhhhllllhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  102
ident                                                             
Sbjct vwelmrrcgvseeyitgsrsnkekwlalakvfprfvgnptyewihldlwrrfnikkvise  118
DSSP  hhhhhhhllllhhhllllllhhhhhhhhhhhhhhhlllhhhhhhhhhhhhhllllllllh


DSSP  -----------------hHHHHHHHLLEEEEEEEEELlllLLHHhHHHHHHHHHHlLLLE
Query -----------------qTLKWQIANGIQHVRTHVDVsdaTLTAlKAMLEVKQEVaPWID  145
ident                     |           |  |      |        |  |     
Sbjct etaeeiweetkkklpemtPQKLLRDMKVEILCTTDDP---VSTL-EHHRKAKEAV-EGVT  173
DSSP  hhhhhhhhhhhhhlllllHHHHHHHLLEEEEELLLLL---LLLL-HHHHHHHHHL-LLLE


DSSP  EEEEEELLLLLLL----------------------llLHHHHHHHHHHLL----LLEEEE
Query LQIVAFPQEGILS----------------------ypNGEALLEEALRLG----ADVVGA  179
ident       |                                   |                 
Sbjct ILPTWRPDRAMNVdkegwreyvekmgerygedtstldGFLNALWKSHEHFkehgCVASDH  233
DSSP  EELLLLLHHHHLLllllhhhhhhhhhhhhllllllhhHHHHHHHHHHHHHhlllLLEEEE


DSSP  LHH--------------------------hllLHHHHHHHHHHHHHHHHHHLLEEEEeEL
Query IPH--------------------------fefTREYGVESLHKTFALAQKYDRLIDVhCD  213
ident                                    |            |           
Sbjct ALLepsvyyvdenraravhekafsgekltqdeINDYKAFMMVQFGKMNQETNWVTQL-HI  292
DSSP  EELllllllllhhhhhhhhhhhlllllllhhhHHHHHHHHHHHHHHHHHHHLLEEEE-EE


DSSP  LL--------------------LLLLLLHhhhHHHHHHHHLLhhHEEEeELHHHHHllhh
Query EI--------------------DDEQSRFvetVAALAHHEGMgaRVTAsHTTAMHSynga  253
ident                            |                                
Sbjct GAlrdyrdslfktlgpdsggdiSTNFLRIaegLRYFLNEFDGklKIVL-YVLDPTH----  347
DSSP  LEellllhhhhhhlllllllleELLLLLHhhhHHHHHHHLLLllLEEE-EELLHHH----


DSSP  hhHHHHHHHHHHL-LEEEElhhhHHHHllllllllllllllLHHHHHHLLL---LEEELL
Query ytSRLFRLLKMSG-INFVAnplvNIHLqgrfdtypkrrgitRVKEMLESGI---NVCFGH  309
ident                   |                        |                
Sbjct -lPTISTIARAFPnVYVGA--pwWFND-------spfgmemHLKYLASVDLlynLAGMVT  397
DSSP  -hHHHHHHHHHLLlEEELL--llLLLL-------lhhhhhhHHHHHHLLLLhhhLLLLLL


DSSP  LLLLllllllLLLL--HHHHHHHHHHhlLLLL---------HHHHHHHHHHHLHHHHHHL
Query DDVFdpwyplGTAN--MLQVLHMGLHvcQLMG---------YGQINDGLNLITHHSARTL  358
ident |                                                           
Sbjct DSRK-----lLSFGsrTEMFRRVLSN--VVGEmvekgqipiKEARELVKHVSYDGPKALF  450
DSSP  LLLL-----lLHHHhhHHHHHHHHHH--HHHHhhhlllllhHHHHHHHHHHHLHHHHHHH


DSSP  Lllllllllllllleeeellllhhhhhhhllllleeeelleeeeellllleeeellleee
Query Nlqdygiaagnsanliilpaengfdalrrqvpvrysvrggkviastqpaqttvyleqpea  418
ident                                                             
Sbjct F-----------------------------------------------------------  451
DSSP  L-----------------------------------------------------------


DSSP  ellll
Query idykr  423
ident      
Sbjct -----  451
DSSP  -----


No 51: Query=1k6wA Sbjct=3dcpA Z-score=11.5

back to top
DSSP  llleeeeellllllleeeeeeelleeeeeeeellllllllleeelllleeelLEEEEEEL
Query alqtiinarlpgeeglwqihlqdgkisaidaqsgvmpitensldaeqglvipPFVEPHIH   60
ident                                                          | |
Sbjct ----------------------------------------------------XKRDGHTH    8
DSSP  ----------------------------------------------------LLEEEEEL


DSSP  LL----LLLLlllllllllllhhhhhhhhhllhhhllhhhhhhHHHHHHHHHHHLLEEEE
Query LD----TTQTagqpnwnqsgtlfegierwaerkallthddvkqRAWQTLKWQIANGIQHV  116
ident        |                                            |       
Sbjct TEfcphGTHD---------------------------------DVEEXVLKAIELDFDEY   35
DSSP  LLllllLLLL---------------------------------LHHHHHHHHHHLLLLEE


DSSP  EEEEELL----------------------LLLL-HHHHHHHHHHHHHLLLLEEEEEEEll
Query RTHVDVS----------------------DATL-TALKAMLEVKQEVAPWIDLQIVAFpq  153
ident                                 |    |     |   |      |     
Sbjct SIVEHAPlssefxkntagdkeavttasxaXSDLpYYFKKXNHIKKKYASDLLIHIGFE--   93
DSSP  EEEEELLllhhhhhllllllhhhhlllllHHHHhHHHHHHHHHHHHLLLLLEEEEEEE--


DSSP  llllllllhhhhhhhhhhlllleeEELHhhlllhhhHHHHhHHHHHHHhHHLL----eeE
Query egilsypngealleealrlgadvvGAIPhfeftreyGVESlHKTFALAqKYDR----liD  209
ident                                            |                
Sbjct ------------------------VDYL--------IGYE-DFTRDFL-NEYGpqtddgV  119
DSSP  ------------------------EELL--------LLLH-HHHHHHH-HHHHhhlleeE


DSSP  EEEL-----------------------------lllLLLLL-HHHHHHHHHHhhllhhHE
Query VHCD-----------------------------eidDEQSR-FVETVAALAHhegmgaRV  239
ident                                            |                
Sbjct LSLHflegqggfrsidfsaedynegivqfyggfeqaQLAYLeGVKQSIEADL--glfkPR  177
DSSP  EELLeeeelleeeellllhhhhhhhlhhhhllhhhhHHHHHhHHHHHHHLLL--llllLL


DSSP  EEEELHHHH--------------hlLHHHHHHHHHHHHHHLLEEEELHhHHHHHLLLlll
Query TASHTTAMH--------------syNGAYTSRLFRLLKMSGINFVANPlVNIHLQGRfdt  285
ident    |                               | |        |             
Sbjct RXGHISLCQkfqqffgedtsdfseeVXEKFRVILALVKKRDYELDFNT-AGLFKPLC---  233
DSSP  EELLLLHHHllhhhhlllhhhllhhHHHHHHHHHHHHHHHLLEEEEEL-HHHHLLLL---


DSSP  llllLLLL---LHHHHHHLLLLEEELLLLLLllllllLLLLHhhHHHHHHHHLLlllhhh
Query ypkrRGIT---RVKEMLESGINVCFGHDDVFdpwyplGTANMlqVLHMGLHVCQlmgygq  342
ident             |    |  |    | |                                
Sbjct ---gETYPpkkIVTLASELQIPFVYGSDSHG-----vQDIGR--GYSTYCQKLE------  277
DSSP  ---lLLLLlhhHHHHHHHLLLLEEEELLLLL-----hHHLLL--LHHHHHHHLL------


DSSP  hhhhhhhhlhhhhhhllllllllllllllleeeellllhhhhhhhllllleeeelleeee
Query indglnlithhsartlnlqdygiaagnsanliilpaengfdalrrqvpvrysvrggkvia  402
ident                                                             
Sbjct ------------------------------------------------------------  277
DSSP  ------------------------------------------------------------


DSSP  ellllleeeellleeeellll
Query stqpaqttvyleqpeaidykr  423
ident                      
Sbjct ---------------------  277
DSSP  ---------------------


No 52: Query=1k6wA Sbjct=3iacA Z-score=10.8

back to top
DSSP  llleeeeellllllleeeeeeelleeeeeeeellllllllleeelllleeELLEEEEEEL
Query alqtiinarlpgeeglwqihlqdgkisaidaqsgvmpitensldaeqglvIPPFVEPHIH   60
ident                                                     |    | |
Sbjct --------------------------atfxtedfllkndiartlyhkyaaPXPIYDFHCH   34
DSSP  --------------------------llllllllllllhhhhhhhhhlllLLLEEELLLL


DSSP  LL------------lllLLLL-lllLLLL-------------------------------
Query LD------------ttqTAGQ-pnwNQSG-------------------------------   76
ident |                                                           
Sbjct LSpqeiaddrrfdnlgqIWLEgdhyKWRAlrsagvdeslitgketsdyekyxawantvpk   94
DSSP  LLhhhhhhllllllhhhHHHLlllhHHHHhhhllllhhhlllllllhhhhhhhhhhhhhh


DSSP  --------------------lhhhhhhhhhllhhhllhhhhhhhhhHHHHHHHHLLEEEE
Query --------------------tlfegierwaerkallthddvkqrawQTLKWQIANGIQHV  116
ident                                                            |
Sbjct tlgnplyhwthlelrrpfgitgtlfgpdtaesiwtqcneklatpafSARGIXQQXNVRXV  154
DSSP  llllhhhhhhhhhhhlllllllllllhhhhhhhhhhhhhhhllhhhLHHHHHHHLLEEEE


DSSP  EEEEELlllllhHHHHhhHHHHHHL----LLLEEEEEEELLLLLLLLL------------
Query RTHVDVsdatltALKAmlEVKQEVA----PWIDLQIVAFPQEGILSYP------------  160
ident  |  |             |     |      |       |                    
Sbjct GTTDDP------IDSL--EYHRQIAaddsIDIEVAPSWRPDKVFKIELdgfvdylrklea  206
DSSP  ELLLLL------LLLL--HHHHHHHhlllLLLEEELLLLLHHHHLLLLllhhhhhhhhhh


DSSP  ----------lhhhHHHHHHHLL----LLEEEELHHhlLLHH------------------
Query ----------ngeaLLEEALRLG----ADVVGAIPHfeFTRE------------------  188
ident                |   |                    |                   
Sbjct aadvsitrfddlrqALTRRLDHFaacgCRASDHGIE--TLRFapvpddaqldailgkrla  264
DSSP  hhllllllhhhhhhHHHHHHHHHhhllLLEEEEEEL--LLLLlllllhhhhhhhhhhhhl


DSSP  -----------hHHHHHHHHHHHHHHHLLEEEEeELLL---------------------L
Query -----------yGVESLHKTFALAQKYDRLIDVhCDEI---------------------D  216
ident                 |                                           
Sbjct getlseleiaqfTTAVLVWLGRQYAARGWVXQL-HIGAirnnntrxfrllgpdtgfdsiG  323
DSSP  lllllhhhhhhhHHHHHHHHHHHHHHHLLEEEE-EELEellllhhhhhhhllllllleeL


DSSP  LLLLL-hHHHHHHHHHH-HLLHhHEEEeELHHHHHllhhhhhhhHHHHHHHL-------L
Query DEQSR-fVETVAALAHH-EGMGaRVTAsHTTAMHSyngaytsrlFRLLKMSG-------I  267
ident |                                                           
Sbjct DNNISwaLSRLLDSXDVtNELP-KTIL-YCLNPRD-----nevlATXIGNFQgpgiagkV  376
DSSP  LLLLHhhHHHHHHHHHLlLLLL-EEEE-EELLHHH-----hhhhHHHHHHLLlllllllE


DSSP  EEEElhhHHHHhlllllllllLLLL-lLHHHHHHLLL---LEEELLLLLLllllllLLLL
Query NFVAnplVNIHlqgrfdtypkRRGI-tRVKEMLESGI---NVCFGHDDVFdpwyplGTAN  323
ident  |                     |           |     |    |             
Sbjct QFGS-gwWFND---------qKDGXlrQLEQLSQXGLlsqFVGXLTDSRS-----fLSYT  421
DSSP  EELL-llHHHL---------lHHHHhhHHHHHHHHLLhhhLLLLLLLLLL-----lLLLH


DSSP  -HHHHHHHHHHhlLLLL-----------HHHHHHHHHHHLHHHHHhLLLLllllllllll
Query -MLQVLHMGLHvcQLMG-----------YGQINDGLNLITHHSARtLNLQdygiaagnsa  371
ident               |                             |               
Sbjct rHEYFRRILCN--LLGQwaqdgeipddeAXLSRXVQDICFNNAQR-YFTI----------  468
DSSP  hHHHHHHHHHH--HHHHhhhlllllllhHHHHHHHHHHHLHHHHH-HLLL----------


DSSP  leeeellllhhhhhhhllllleeeelleeeeellllleeeellleeeellll
Query nliilpaengfdalrrqvpvrysvrggkviastqpaqttvyleqpeaidykr  423
ident                                                     
Sbjct ---------------------------------------------------k  469
DSSP  ---------------------------------------------------l


No 53: Query=1k6wA Sbjct=3au2A Z-score=10.1

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct mrnqelarifeeiglmseflgdnpfrvrayhqaartlydldtpieeiaekgkealmelpg   60
DSSP  llhhhhhhhhhhhhhhhhhllllhhhhhhhhhhhhhhhhllllhhhhhlllhhhhlllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct vgpdlaekileflrtgkvrkheelsrkvprgvlevmevpgvgpktarllyeglgidslek  120
DSSP  llhhhhhhhhhhhhhlllhhhhhhhhhllhhhhhhhllllllhhhhhhhhhhhllllhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct lkaaldrgdltrlkgfgpkraerireglalaqaagkrrplgavlslarslleairalpgv  180
DSSP  hhhhhhhlhhhhlllllhhhhhhhhhhhhhhhhlllleehhhhhhhhhhhhhhhhlllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct eraelcgsarrykdtvgdldflvasregeravegfvrlpqvkevyakgkeratvflkngl  240
DSSP  leeeelhhhhlllleelleeeeeelllhhhhhhhhhlllleeeeeeellleeeeeellll


DSSP  ----------------------llleeeeellllllleeeeeeelleeeeeeeELLLL--
Query ----------------------alqtiinarlpgeeglwqihlqdgkisaidaQSGVM--   36
ident                                                             
Sbjct qvdlrvvppesygaglqyltgskahsirlralaqekglklseygvfrgekriaGETEEev  300
DSSP  eeeeeeelhhhhhhhhhhhhllhhhhhhhhhhhhhllleeelleeeelleeeeLLLHHhh


DSSP  --------------------llllleeelllleeELLEEEEEELLL--LLLLllllllll
Query --------------------pitensldaeqglvIPPFVEPHIHLD--TTQTagqpnwnq   74
ident                                            |      |         
Sbjct yaalglpwippplredqgeveaalegrlpkllelPQVKGDLQVHSTysDGQN--------  352
DSSP  hhhlllllllhhhlllllhhhhhhlllllllllhHHLLEEEEELLLllLLLL--------


DSSP  lllhhhhhhhhhllhhhllhhhhhhHHHHHHHHHHHLLEEEEEEEE---------eLLLL
Query sgtlfegierwaerkallthddvkqRAWQTLKWQIANGIQHVRTHV---------dVSDA  125
ident                                      |                   |  
Sbjct -------------------------TLEELWEAAKTMGYRYLAVTDhspavrvaggPSPE  387
DSSP  -------------------------LHHHHHHHHHHHLLLEEEEEEelhhhhllllLLHH


DSSP  L-LHHHHHHHHHHHHHLlLLEEEEEEellllllllllhhhhhhhhhhlllleeEELHHhl
Query T-LTALKAMLEVKQEVApWIDLQIVAfpqegilsypngealleealrlgadvvGAIPHfe  184
ident   |                  |   |                               |  
Sbjct EaLKRVGEIRRFNETHG-PPYLLAGA---------------------------EVDIH--  417
DSSP  HhHHHHHHHHHHHHHHL-LLEEEEEE---------------------------EEELL--


DSSP  llhHHHHhhHHHHHHHHHhhllEEEEeELLL-LLLL----lLHHHHHHHHHhhhllhhHE
Query ftrEYGVesLHKTFALAQkydrLIDVhCDEI-DDEQ----sRFVETVAALAhhegmgaRV  239
ident      |   |            |  |                                  
Sbjct ---PDGT--LDYPDWVLR-eldLVLV-SVHSrFNLPkadqtKRLLKALENP------fVH  464
DSSP  ---LLLL--LLLLHHHHL-lllEEEE-ELLLlLLLLhhhhhHHHHHHHLLL------lLL


DSSP  EEEELHH------hHHLLhhHHHHHHHHHHHHLLEEEELH-HHHHhhlllllllllllll
Query TASHTTA------mHSYNgaYTSRLFRLLKMSGINFVANP-LVNIhlqgrfdtypkrrgi  292
ident    | ||                  |   |  |                           
Sbjct VLAHPTArllgrraPIEA--DWEAVFQKAKEKGVAVEIDGyYDRM-----------dlpd  511
DSSP  EELLLLLlllllllLLLL--LHHHHHHHHHHHLLEEEEELlLLLL-----------lllh


DSSP  lLHHHHHHLLLLEEELLLLLLllllllLLLL-HHHHHHHHHHhlllllhhhhhHHHHhhl
Query tRVKEMLESGINVCFGHDDVFdpwyplGTAN-MLQVLHMGLHvcqlmgygqinDGLNlit  351
ident          |       |              |                     |     
Sbjct dLARMAYGMGLWISLSTDAHQ-----tDHLRfMELAVGTAQR---------awIGPE--r  555
DSSP  hHHHHHHHLLLLEEEELLLLL-----hHHHHhHHHHHHHHHH---------llLLLL--l


DSSP  HHHHH--hlLLLLlllllllllleeeellllhhhhhhhllllleeeelleeeeellllle
Query HHSAR--tlNLQDygiaagnsanliilpaengfdalrrqvpvrysvrggkviastqpaqt  409
ident           |                                                 
Sbjct VLNTLdyedLLSW-----------------------------------------------  568
DSSP  LHHHLlhhhHHHH-----------------------------------------------


DSSP  eeellleeeellll
Query tvyleqpeaidykr  423
ident               
Sbjct -------lkarrgv  575
DSSP  -------hhlllll


No 54: Query=1k6wA Sbjct=1m65A Z-score=9.4

back to top
DSSP  llleeeeellllllleeeeeeelleeeeeeeellllllllleeelllleeellEEEEEEL
Query alqtiinarlpgeeglwqihlqdgkisaidaqsgvmpitensldaeqglvippFVEPHIH   60
ident                                                       |  | |
Sbjct ----------------------------------------------------yPVDLHMH    8
DSSP  ----------------------------------------------------lLEELLLL


DSSP  L---lLLLLlllllllllllhhhhhhhhhllhhhllhhhhhhHHHHHHHHHHHLLEEEEE
Query L---dTTQTagqpnwnqsgtlfegierwaerkallthddvkqRAWQTLKWQIANGIQHVR  117
ident                                                       ||    
Sbjct TvastHAYS---------------------------------TLSDYIAQAKQKGIKLFA   35
DSSP  LllllLLLL---------------------------------LHHHHHHHHHHHLLLEEE


DSSP  EEEELL----llLLHHHHHHHHHhhHHLL-LLEEEEEEEllllllllllhhhhhhhhhhl
Query THVDVS----daTLTALKAMLEVkqEVAP-WIDLQIVAFpqegilsypngealleealrl  172
ident                    |                                        
Sbjct ITDHGPdmedapHHWHFINMRIW--PRVVdGVGILRGIE---------------------   72
DSSP  EEEELLllllllLLHHHHHHHHL--LLEElLEEEEEEEE---------------------


DSSP  llleeEELHhhlllhhhHHHHHhhhhhhHHHHLL----eEEEEE----llllLLLLL--H
Query gadvvGAIPhfeftreyGVESLhktfalAQKYDR----lIDVHC----deidDEQSR--F  222
ident        |          |                    |            |       
Sbjct -----ANIK--------NVDGE----idCSGKMFdsldlIIAGFhepvfaphDKATNtqA  115
DSSP  -----EELL--------LLLLL----llLLHHHHhhlleEEEELllllllllLHHHHhhH


DSSP  HHHHHHHHhhhllhhhEEEEELHHhHHLLhhHHHHHHHHHHHHLLEEEELHHHhhhhlll
Query VETVAALAhhegmgarVTASHTTAmHSYNgaYTSRLFRLLKMSGINFVANPLVnihlqgr  282
ident      |             ||      |                     |          
Sbjct MIATIASG------nvHIISHPGN-PKYE-iDVKAVAEAAAKHQVALEINNSS-------  160
DSSP  HHHHHHLL------llLEELLLLL-LLLL-lLHHHHHHHHHHHLLEEEEELLL-------


DSSP  llllllllLLLL-HHHHHHLLLLEEELLLLLLlllllllLLLHhhHHHHHHHHLLLllhh
Query fdtypkrrGITR-VKEMLESGINVCFGHDDVFdpwyplgTANMlqVLHMGLHVCQLmgyg  341
ident                     |  |  | |                     |         
Sbjct --------NCREvAAAVRDAGGWVALGSDSHT------aFTMG--EFEECLKILDA----  200
DSSP  --------LHHHhHHHHHHHLLLEEEELLLLL------hHHLL--LLHHHHHHHHH----


DSSP  hhhHHHHHhlhHHHH-hlLLLL----lllllllLLLEeeellllhhhhhhhllllleeee
Query qinDGLNLithHSAR-tlNLQD----ygiaagnSANLiilpaengfdalrrqvpvrysvr  396
ident                    |              | |                       
Sbjct vdfPPERI---LNVSprrLLNFlesrgmapiaeFADL-----------------------  234
DSSP  lllLHHHL---HHHLhhhHHHHhhhllllllhhHLLL-----------------------


DSSP  lleeeeellllleeeellleeeellll
Query ggkviastqpaqttvyleqpeaidykr  423
ident                            
Sbjct ---------------------------  234
DSSP  ---------------------------


No 55: Query=1k6wA Sbjct=3f2bA Z-score=9.3

back to top
DSSP  ------------------------------------------------------llleee
Query ------------------------------------------------------alqtii    6
ident                                                             
Sbjct vrrletiveeerrvvvqgyvfdaevselksgrtlltmkitdytnsilvkmfsrdkedael   60
DSSP  lllhhhlllleeeeeeeeeeeeeeeeellllleeeeeeeelllleeeeeeelllhhhhhh


DSSP  eellllllleeeeeeelleeeeeeeelllLLLLLL--eeellllEEELLEEEEEELLL--
Query narlpgeeglwqihlqdgkisaidaqsgvMPITEN--sldaeqgLVIPPFVEPHIHLD--   62
ident                                  |                || | |    
Sbjct msgvkkgmwvkvrgsvqndtfvrdlviiaNDLNEIaanerqdtaPEGEKRVELHLHTPms  120
DSSP  hhlllllleeeeeeeeeeelllleeeeeeEEEEEElllllllllLLLLLLLLLLLLLLll


DSSP  --LLLLlllllllllllhhhhhhhhhllhhhllhhhhhhHHHHHHHHHHHLLEEEEEEEE
Query --TTQTagqpnwnqsgtlfegierwaerkallthddvkqRAWQTLKWQIANGIQHVRTHV  120
ident      |                                             |        
Sbjct qmDAVT---------------------------------SVTKLIEQAKKWGHPAIAVTD  147
DSSP  llLLLL---------------------------------LHHHHHHHHHHLLLLLEEELL


DSSP  ELlllllhhHHHHHHHHHHHLL--LLEEEEEEELlLLLL------llllhhhhhHHHHHl
Query DVsdatltaLKAMLEVKQEVAP--WIDLQIVAFPqEGIL------sypngeallEEALRl  172
ident                     |                                       
Sbjct HA-------VVQSFPEAYSAAKkhGMKVIYGLEA-NIVDdpfhvtllaqnetglKNLFK-  198
DSSP  LL-------LLLLHHHHHHHHHhhLLLEEEEEEE-EEELlleeeeeeellhhhhHHHHH-


DSSP  llleeeelhhhlllhhhhhhHHHHHHHHHhhHLLEEEE----EELLLlllllLHHHHHHh
Query gadvvgaiphfeftreygveSLHKTFALAqkYDRLIDV----HCDEIddeqsRFVETVAa  228
ident                                   |                         
Sbjct ----lvslshiqyfhrvpriPRSVLVKHR--DGLLVGSgcdkGELFD-----NVEDIAR-  246
DSSP  ----hhhhhhllllllllleEHHHHHHLL--LLEEEELllllLLLLL-----LLLLLHH-


DSSP  hhhhhllhhheeeeelhhhhhllhhhhhhhhhhhhhhlLEEEELHhhHHHHLLLLLllLL
Query lahhegmgarvtashttamhsyngaytsrlfrllkmsgINFVANPlvNIHLQGRFDtyPK  288
ident                                             |               
Sbjct ------------------------------------fyDFLEVHP--PDVYKPLYV--KD  266
DSSP  ------------------------------------hlLLEEELL--HHHHLLLLL--LL


DSSP  LL---LLLL--HHHHHHLLLLEEELLLLLL------------------------llllll
Query RR---GITR--VKEMLESGINVCFGHDDVF------------------------dpwypl  319
ident       | |  |       | |                                      
Sbjct EEmikNIIRsiVALGEKLDIPVVATGNVHYlnpedkiyrkilihsqgganplnrhelpdv  326
DSSP  HHhhhHHHHhhHHHHHHLLLLEEELLLLLLllhhhhhhhhhhhhllhhhlllllllllll


DSSP  LLLLHHHHHHHHHHhlllllhhHHHHHHHHHLHHHHHHLLLLL-----------------
Query GTANMLQVLHMGLHvcqlmgygQINDGLNLITHHSARTLNLQD-----------------  362
ident         |                               |                   
Sbjct YFRTTNEMLDCFSF-------lGPEKAKEIVVDNTQKIASLIGdvkpikdelytpriega  379
DSSP  LLLLHHHHHHHHHH-------hHHHHHHHHHLHHHHHHHHLLLllllllllllllllllh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  362
ident                                                             
Sbjct deeiremsyrrakeiygdplpklveerlekelksiighgfaviylishklvkkslddgyl  439
DSSP  hhhhhhhhhhhhhhhhlllllhhhhhhhhhhhhhhhhlllhhhhhhhhhhhhhhhhllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  362
ident                                                             
Sbjct vgsrgsvgssfvatmteitevnplpphyvcpnckhseffndgsvgsgfdlpdkncprcgt  499
DSSP  leelhhhhhlhhhhhllllllllllleeelllllleeellllllllhhhlllllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  362
ident                                                             
Sbjct kykkdghdipfetflgfkgdkvpdidlnfsgeyqprahnytkvlfgednvyragtigtva  559
DSSP  lleeellllllhhhhllllllllleeeeeelllhhhhhhhhhhhhlllleeeeeeeeell


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  362
ident                                                             
Sbjct dktaygfvkayasdhnlelrgaeidrlaagctgvkrttgqhpggiivvpdymeiydftpi  619
DSSP  hhhhhhhhhhhhhhllllllhhhhhhhhhhhllleeeeeeeeeeeeellllllhhhllle


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  362
ident                                                             
Sbjct qypaddtssewrtthfdfhsihdnllkldilghddptvirmlqdlsgidpktiptddpdv  679
DSSP  elhhhllllllleeeeehhhhllllleeeeeeehhhhhhhhhhhhhlllhhhlllllhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  362
ident                                                             
Sbjct mgifssteplgvtpeqimcnvgtigipefgtrfvrqmleetrpktfselvqisglshgtd  739
DSSP  hhlllllhhhlllhhhhllllllllllllllhhhhhhhhhhllllhhhhhhhhhhlllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  362
ident                                                             
Sbjct vwlgnaqeliqngtctlsevigcrddimvyliyrglepslafkimesvrkgkgltpefea  799
DSSP  lllllhhhhhhlllllhhhllllhhhhhhhhhhllllhhhhhhhhhhhlllllllhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  362
ident                                                             
Sbjct emrkhdvpewyidsckkikymfpkahaaayvlmavriayfkvhhpllyyasyftvraedf  859
DSSP  hhhhllllhhhhhhhhhllllllhhhhhhhhhhhhhhhhhhhhlhhhhhhhhhhhlllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  362
ident                                                             
Sbjct dldamikgsaairkrieeinakgiqatakekslltvlevalemcergfsfknidlyrsqa  919
DSSP  lhhhhhhlhhhhhhhhhhhhhlhhhllhhhhhhhhhhhhhhhhhhllleellllllllll


DSSP  --------------lllllllllleeeellllhhhhhhhllllleeeelleeeeelllll
Query --------------ygiaagnsanliilpaengfdalrrqvpvrysvrggkviastqpaq  408
ident                                                             
Sbjct tefvidgnslippfnaipglgtnvaqaivrareegeflskedlqqrgklsktlleylesr  979
DSSP  llleeelleeellhhhlllllhhhhhhhhhhhhllllllhhhhhhhhlllhhhhhhhhhl


DSSP  eeeellleeeellll
Query ttvyleqpeaidykr  423
ident                
Sbjct gcldslpdhnqlslf  994
DSSP  lllllllllllllll


No 56: Query=1k6wA Sbjct=1bksA Z-score=7.7

back to top
DSSP  llleeeeellllllleeeeeeelleeeeeeeellllllllleeelllleEELLEEEEeEL
Query alqtiinarlpgeeglwqihlqdgkisaidaqsgvmpitensldaeqglVIPPFVEPhIH   60
ident                                                             
Sbjct -------------------------------------meryenlfaqlnDRREGAFV-PF   22
DSSP  -------------------------------------lhhhhhhhhhhhHLLLLEEE-EE


DSSP  LLlllllllllllllllhhhhhhhhhllhhhLLHHHHHHHHHHHHHHHhhlleeeEEEEE
Query LDttqtagqpnwnqsgtlfegierwaerkalLTHDDVKQRAWQTLKWQiangiqhVRTHV  120
ident                                                             
Sbjct VT--------------------------lgdPGIEQSLKIIDTLIDAG------aDALEL   50
DSSP  EE--------------------------lllLLHHHHHHHHHHHHHLL------lLLEEE


DSSP  EL----------------------llLLLHHHHHHHHHHHHHLlllEEEEEEElLLLLll
Query DV----------------------sdATLTALKAMLEVKQEVApwiDLQIVAFpQEGIls  158
ident  |                                               |          
Sbjct GVpfsdpladgptiqnanlrafaagvTPAQCFEMLALIREKHP---TIPIGLL-MYANlv  106
DSSP  ELlllllllllhhhhhhhhhhhhhllLHHHHHHHHHHHHHHLL---LLLEEEE-ELHHhh


DSSP  LLLHH-hHHHHHHHLLLLEEEELHhhlllhhhHHHHHHHHHHHHHHHLLEEEEeELLLLL
Query YPNGE-aLLEEALRLGADVVGAIPhfeftreyGVESLHKTFALAQKYDRLIDVhCDEIDD  217
ident   ||           | | |             ||        |                
Sbjct FNNGIdaFYARCEQVGVDSVLVAD-------vPVEESAPFRQAALRHNIAPIF-ICPPNA  158
DSSP  HLLLHhhHHHHHHHHLLLEEEELL-------lLHHHLHHHHHHHHHLLLEEEE-EELLLL


DSSP  LllLHHHHHHHHHhhhllhhHEEEEELhhhhhllhhhhhhhHHHHHHHLLEEEELHHHhh
Query EqsRFVETVAALAhhegmgaRVTASHTtamhsyngaytsrlFRLLKMSGINFVANPLVni  277
ident         ||          |                      |                
Sbjct D-dDLLRQVASYG-------RGYTYLL------alplhhliEKLKEYHAAPALQGFGI--  202
DSSP  L-hHHHHHHHHHL-------LLLEEEL------lllhhhhhHHHHHHLLLLEEELLLL--


DSSP  hhlllllllllllllllHHHHhhllllEEELLLLLLLLL-------------lllLLLL-
Query hlqgrfdtypkrrgitrVKEMlesginVCFGHDDVFDPW-------------yplGTAN-  323
ident                  |                                          
Sbjct --------sspeqvsaaVRAG-----aAGAISGSAIVKIieknlaspkqmlaelrSFVSa  249
DSSP  --------llhhhhhhhHHHL-----lLEEEELLHHHHHhhhllllhhhhhhhhhHHHHh


DSSP  -HHHHhhhhhhhlllllhhhhhhhhhhhlhhhhhhllllllllllllllleeeellllhh
Query -MLQVlhmglhvcqlmgygqindglnlithhsartlnlqdygiaagnsanliilpaengf  382
ident                                                             
Sbjct mKAAS-------------------------------------------------------  254
DSSP  hHHLL-------------------------------------------------------


DSSP  hhhhhllllleeeelleeeeellllleeeellleeeellll
Query dalrrqvpvrysvrggkviastqpaqttvyleqpeaidykr  423
ident                                          
Sbjct ----------------------------------------r  255
DSSP  ----------------------------------------l


No 57: Query=1k6wA Sbjct=2yb1A Z-score=7.2

back to top
DSSP  llleeeeellllllleeeeeeelleeeeeeeellllllllleeelllleeellEEEEEEL
Query alqtiinarlpgeeglwqihlqdgkisaidaqsgvmpitensldaeqglvippFVEPHIH   60
ident                                                          | |
Sbjct ----------------------------------------------------aNIDLHFH    8
DSSP  ----------------------------------------------------lLEELLLL


DSSP  L--LLLLllllllllllllhhhhhhhhhllhhhllhhhhhhHHHHHHHHHHHLLEEEEEE
Query L--DTTQtagqpnwnqsgtlfegierwaerkallthddvkqRAWQTLKWQIANGIQHVRT  118
ident                                                    |        
Sbjct SrtSDGA---------------------------------lTPTEVIDRAAARAPALLAL   35
DSSP  LllLLLL---------------------------------lLHHHHHHHHHLLLLLEEEE


DSSP  EEELlllllhhHHHHHHHHHHHLL-LLEEEEEEEllllllllllhhhhhhhhhhllllee
Query HVDVsdatltaLKAMLEVKQEVAP-WIDLQIVAFpqegilsypngealleealrlgadvv  177
ident                 |     |   |                                 
Sbjct TDHD------cTGGLAEAAAAAARrGIPFLNGVE--------------------------   63
DSSP  LLLL------lLLLHHHHHHHHHHlLLLEEEEEE--------------------------


DSSP  EELH--------------------------------------------------------
Query GAIP--------------------------------------------------------  181
ident                                                             
Sbjct VSVSwgrhtvhivglgidpaepalaaglksiregrlerarqmgasleaagiagcfdgamr  123
DSSP  EEEEelleeeeeeeellllllhhhhhhhhhhhllhhhhhhhhhhhhhhlllllhhhhhhl


DSSP  -------------------------------------hhlLLHHHHhhHHHHHHHHHhhH
Query -------------------------------------hfeFTREYGveSLHKTFALAqkY  204
ident                                                 ||          
Sbjct wcdnpemisrthfarhlvdsgavkdmrtvfrkyltpgkpgYVSHQW-aSLEDAVGWI-vG  181
DSSP  llllhhhllhhhhhhhhhhllllllhhhhhhhllllllllLLLLLL-lLHHHHHHHH-hH


DSSP  LLEeeeeelllllllllhhhhhhhhhhhhllhhHEEEEELHHHhhllhhHHHHHHHHHHH
Query DRLidvhcdeiddeqsrfvetvaalahhegmgaRVTASHTTAMhsyngaYTSRLFRLLKM  264
ident                                       |                ||   
Sbjct AGG------------------------------MAVIAHPGRY----dmGRTLIERLILD  207
DSSP  LLL------------------------------EEEELLHHHL----llLHHHHHHHHHH


DSSP  HL----LEEEELHHHHHhhllllllllllLLLL--LHHHHHHLLLLEEELLLLLLLLLll
Query SG----INFVANPLVNIhlqgrfdtypkrRGIT--RVKEMLESGINVCFGHDDVFDPWyp  318
ident                                            |     | |        
Sbjct FQaaggQGIEVASGSHS------------LDDMhkFALHADRHGLYASSGSDFHAPGE--  253
DSSP  HHhlllLEEEEEELLLL------------HHHHhhHHHHHHHHLLEEEEELLLLLLLL--


DSSP  llLLLHhhHHHHHhhhlllllhhhhhhhhhhhlhHHHHhlLLLLlllllllllleeeell
Query lgTANMlqVLHMGlhvcqlmgygqindglnlithHSARtlNLQDygiaagnsanliilpa  378
ident                                      |   |                  
Sbjct --DVGH--TEDLP-----------------picrPIWR--ELEA----------------  274
DSSP  --LLLL--LLLLL-----------------llllLHHH--HLHH----------------


DSSP  llhhhhhhhllllleeeELLEeeeellllleeeellleeeellll
Query engfdalrrqvpvrysvRGGKviastqpaqttvyleqpeaidykr  423
ident                                              
Sbjct ------------rilrpADAE-----------------------n  284
DSSP  ------------hllllLHHH-----------------------l


No 58: Query=1k6wA Sbjct=2anuA Z-score=7.1

back to top
DSSP  llleeeeellllllleeeeeeelleeeeeeeellllllllleeelllleEELLEEEEEEL
Query alqtiinarlpgeeglwqihlqdgkisaidaqsgvmpitensldaeqglVIPPFVEPHIH   60
ident                                                          | |
Sbjct -------------------------------------------------TEWLLCDFHVH   11
DSSP  -------------------------------------------------LEEEEEEEEEL


DSSP  L--LLLLllllllllllllhhhhhhhhhllhhhllhhhhhhHHHHHHHHHHHLLEEEEEE
Query L--DTTQtagqpnwnqsgtlfegierwaerkallthddvkqRAWQTLKWQIANGIQHVRT  118
ident                                                      |   |  
Sbjct TnxSDGH---------------------------------lPLGEVVDLFGKHGVDVVSI   38
DSSP  LllLLLL---------------------------------lLHHHHHHHHHHLLLLEEEE


DSSP  EEEL-------------------lLLLL-HHHHHHHHHHHHHLL--LLEEEEEEElllll
Query HVDV-------------------sDATL-TALKAMLEVKQEVAP--WIDLQIVAFpqegi  156
ident                                ||                |          
Sbjct TDHIvdrrtleqrkrngeplgaitEDKFqDYLKRLWREQKRAWEeyGXILIPGVE-----   93
DSSP  EEEEelhhhhhhhhhlllllllllLLLHhHHHHHHHHHHHHHHHhhLLEEEEEEE-----


DSSP  lllllhhhhhhhhhhlllleeeELHHHL---------llhhhhHHHHHHHHHHHHhHLLE
Query lsypngealleealrlgadvvgAIPHFE---------ftreygVESLHKTFALAQkYDRL  207
ident                                                             
Sbjct ----------------------ITNNTDlyhivavdvkeyvdpSLPVEEIVEKLK-EQNA  130
DSSP  ----------------------EEELLLleeeeeellllllllLLLHHHHHHHHH-HLLL


DSSP  eeeeelllllllllhhhhhhhhhhhhllhhHEEEEELHhhhhllhhhhhhHHHHHHHHLL
Query idvhcdeiddeqsrfvetvaalahhegmgaRVTASHTTamhsyngaytsrLFRLLKMSGI  267
ident                                | | |                   |    
Sbjct ------------------------------LVIAAHPD--rkklswylwaNXERFKDTFD  158
DSSP  ------------------------------EEEELLLL--llllllhhhhLLLLLLLLLL


DSSP  EEE-ELHHhhhhhlllllllllllllllHHHHHHLLLLEEELLLLLLlllllLLLLLHhh
Query NFV-ANPLvnihlqgrfdtypkrrgitrVKEMLESGINVCFGHDDVFdpwypLGTANMlq  326
ident     ||                                     |        |       
Sbjct AWEiANRD------------------dlFNSVGVKKYRYVANSDFHE-----LWHVYS--  193
DSSP  EEEeEELL------------------eeLHHHHHLLLLEEEELLLLL-----HHHHLL--


DSSP  hhhhhhhhlllllhhhhhhhhhHHLH---hhhhhLLLLllllllllllleeeellllhhh
Query vlhmglhvcqlmgygqindglnLITH---hsartLNLQdygiaagnsanliilpaengfd  383
ident                                                             
Sbjct ---------------------wKTLVkseknieaIKEA----------------------  210
DSSP  ---------------------eEEEEeelllhhhHHHH----------------------


DSSP  hhhhllllleeeelleeeeellllleeeellleeeellll
Query alrrqvpvrysvrggkviastqpaqttvyleqpeaidykr  423
ident                                         
Sbjct --------------------------irkntdvaiylxrk  224
DSSP  --------------------------hhhllleeeeelll


No 59: Query=1k6wA Sbjct=3e38A Z-score=6.4

back to top
DSSP  llleeeeellllllleeeeeeelleeeeeeeellllllllleeelllleEELLEEEEEEL
Query alqtiinarlpgeeglwqihlqdgkisaidaqsgvmpitensldaeqglVIPPFVEPHIH   60
ident                                                          | |
Sbjct -----------------------------------aqrrneiqvpdldgYTTLKCDFHXH   25
DSSP  -----------------------------------llllllllllllllLEEEEEELLLL


DSSP  LL--LLLLlllllllllllhhhhhhhhhllhhhllhhhhhhHHHHHHHHHHHLLEEEEEE
Query LD--TTQTagqpnwnqsgtlfegierwaerkallthddvkqRAWQTLKWQIANGIQHVRT  118
ident                                                      |      
Sbjct SVfsDGLV---------------------------------WPTVRVDEAYRDGLDAISL   52
DSSP  LLllLLLL---------------------------------LHHHHHHHHHHLLLLEELL


DSSP  EEELL------llLLHHHHHHHHHHHHHL-LLLEEEEEEEllllllllllhhhhhhhhhh
Query HVDVS------daTLTALKAMLEVKQEVA-PWIDLQIVAFpqegilsypngealleealr  171
ident                                 | |                         
Sbjct TEHIEyrphkqdvVSDHNRSFDLCREQAEkLGILLIKGSE--------------------   92
DSSP  EEELLllllllllLLLLLHHHHHHHHHHHhHLLEELLEEE--------------------


DSSP  lllleeeELHHH----------lllhhhhhHHHHHHHHHHHhHLLEeeeeelllllllll
Query lgadvvgAIPHF----------eftreygvESLHKTFALAQkYDRLidvhcdeiddeqsr  221
ident                                     |  |                    
Sbjct -------ITRAXapghfnaiflsdsnpleqKDYKDAFREAK-KQGA--------------  130
DSSP  -------EELLLllleeeeelllllhhhllLLHHHHHHHHH-HLLL--------------


DSSP  hhhhhhhhhhhhllhhHEEEEELHH------hHHLLhhhhhhhhhhHHHH-lLEEEELHH
Query fvetvaalahhegmgaRVTASHTTA------mHSYNgaytsrlfrlLKMS-gINFVANPL  274
ident                      |                                      
Sbjct ----------------FXFWNHPGWdsqqpdtTKWW----pehtalYQEGcxHGIEVANG  170
DSSP  ----------------EEEELLLLLlllllllLLLL----hhhhhhHHLLllLEEEEEEL


DSSP  HHhhhlllllllllllLLLL-HHHHHHLLLLEEELLLLLLLlllLLLL--llhHHHHhhh
Query VNihlqgrfdtypkrrGITR-VKEMLESGINVCFGHDDVFDpwyPLGT--anmLQVLhmg  331
ident                          |          |                       
Sbjct HL--------------YXPEaIQWCLDKNLTXIGTSDIHQP--iQTDYdfekgEHRT---  211
DSSP  LE--------------ELLHhHHHHHHHLLEEEEELLLLLL--hHHHLlhhhlLLLL---


DSSP  hhhlllllhhhhhhhhhhHLHHhhhhllLLLL--------------llllllllleeeeL
Query lhvcqlmgygqindglnlITHHsartlnLQDY--------------giaagnsanliilP  377
ident                             ||                              
Sbjct -----------------xTFVF-akersLQGIrealdnrrtaayfhelligredllrpfF  253
DSSP  -----------------eEEEE-ellllHHHHhhhhhllleeeeelleeellhhhhhhhH


DSSP  LLL------------------hhHHHHHllllleeeelleeeeellllleeeellleeee
Query AEN------------------gfDALRRqvpvrysvrggkviastqpaqttvyleqpeai  419
ident                          |                                  
Sbjct EKCvkieevsrneqgvtlsitnvTDLVL-----------klkktahdtllvyfrdxtlkp  302
DSSP  HHHeeeeeeeeelleeeeeeeelLLLLE-----------eeeelllllleellleeeell


DSSP  LLLL------------------------------------
Query DYKR------------------------------------  423
ident                                         
Sbjct HTRYtvrigfkqgikggdvnfevtnfivapdkglkytisl  342
DSSP  LEEEeeeeeellllllleeeeeeeeeeeelleeeeeeeel