Results: dupa

Query: 1j6pA

MOLECULE: METAL-DEPENDENT HYDROLASE OF

Select neighbours (check boxes) for viewing as multiple structural alignment or 3D superimposition. The list of neighbours is sorted by Z-score. Similarities with a Z-score lower than 2 are spurious. Each neighbour has links to pairwise structural alignment with the query structure, and to the PDB format coordinate file where the neighbour is superimposed onto the query structure.

Expand gaps

Summary

    No:  Chain   Z    rmsd lali nres  %id PDB  Description
   1:  1j6p-A 77.4  0.0  407   407  100 PDB  MOLECULE: METAL-DEPENDENT HYDROLASE OF                               
   2:  3ls9-A 48.3  2.0  398   453   21 PDB  MOLECULE: TRIAZINE HYDROLASE;                                        
   3:  2paj-A 43.7  2.5  375   421   24 PDB  MOLECULE: PUTATIVE CYTOSINE/GUANINE DEAMINASE;                       
   4:  4rdv-B 43.1  2.4  389   451   22 PDB  MOLECULE: N-FORMIMINO-L-GLUTAMATE IMINOHYDROLASE;                    
   5:  2uz9-A 42.1  2.5  378   444   21 PDB  MOLECULE: GUANINE DEAMINASE;                                         
   6:  4cqb-A 34.9  2.8  351   402   16 PDB  MOLECULE: N-ISOPROPYLAMMELIDE ISOPROPYL AMIDOHYDROLASE;              
   7:  2oof-A 34.7  2.7  340   403   15 PDB  MOLECULE: 4-IMIDAZOLONE-5-PROPANOATE AMIDOHYDROLASE;                 
   8:  1k6w-A 34.3  2.8  350   423   18 PDB  MOLECULE: CYTOSINE DEAMINASE;                                        
   9:  3mtw-A 31.3  2.9  328   404   13 PDB  MOLECULE: L-ARGININE CARBOXYPEPTIDASE CC2672;                        
  10:  3mkv-A 30.4  2.8  326   414   18 PDB  MOLECULE: PUTATIVE AMIDOHYDROLASE;                                   
  11:  4c5y-A 28.8  3.1  334   436   16 PDB  MOLECULE: OCHRATOXINASE;                                             
  12:  2imr-A 28.3  4.1  297   380   18 PDB  MOLECULE: HYPOTHETICAL PROTEIN DR_0824;                              
  13:  3icj-A 28.1  2.8  315   468   16 PDB  MOLECULE: UNCHARACTERIZED METAL-DEPENDENT HYDROLASE;                 
  14:  2vun-A 27.3  3.3  316   385   17 PDB  MOLECULE: ENAMIDASE;                                                 
  15:  1onx-A 26.9  3.3  313   390   16 PDB  MOLECULE: ISOASPARTYL DIPEPTIDASE;                                   
  16:  3nqb-A 26.5  3.7  318   587   17 PDB  MOLECULE: ADENINE DEAMINASE 2;                                       
  17:  3ooq-A 24.2  2.9  279   384   18 PDB  MOLECULE: AMIDOHYDROLASE;                                            
  18:  1yrr-B 24.0  3.5  300   334   13 PDB  MOLECULE: N-ACETYLGLUCOSAMINE-6-PHOSPHATE DEACETYLASE;               
  19:  3giq-A 23.7  3.7  313   475   15 PDB  MOLECULE: N-ACYL-D-GLUTAMATE DEACYLASE;                              
  20:  2ogj-A 23.6  4.0  310   379   15 PDB  MOLECULE: DIHYDROOROTASE;                                            
  21:  1gkp-A 22.9  3.5  320   458   16 PDB  MOLECULE: HYDANTOINASE;                                              
  22:  3gri-A 22.7  3.2  303   422   17 PDB  MOLECULE: DIHYDROOROTASE;                                            
  23:  3e74-A 22.2  3.6  303   429   18 PDB  MOLECULE: ALLANTOINASE;                                              
  24:  4b3z-D 21.2  4.0  316   477   17 PDB  MOLECULE: DIHYDROPYRIMIDINASE-RELATED PROTEIN 1;                     
  25:  1a4m-A 21.1  2.8  258   349   14 PDB  MOLECULE: ADENOSINE DEAMINASE;                                       
  26:  1a5k-C 18.1  3.7  302   566   16 PDB  MOLECULE: UREASE (GAMMA SUBUNIT);                                    
  27:  2y1h-B 16.5  3.0  220   265   15 PDB  MOLECULE: PUTATIVE DEOXYRIBONUCLEASE TATDN3;                         
  28:  3k2g-B 15.7  3.5  234   358   13 PDB  MOLECULE: RESINIFERATOXIN-BINDING, PHOSPHOTRIESTERASE-               
  29:  3cjp-A 15.3  3.2  211   262   13 PDB  MOLECULE: PREDICTED AMIDOHYDROLASE, DIHYDROOROTASE FAMILY;           
  30:  3gg7-A 15.3  3.1  210   243   10 PDB  MOLECULE: UNCHARACTERIZED METALLOPROTEIN;                            
  31:  2ob3-A 15.2  3.9  230   329   13 PDB  MOLECULE: PARATHION HYDROLASE;                                       
  32:  1bf6-A 15.1  3.6  228   291   10 PDB  MOLECULE: PHOSPHOTRIESTERASE HOMOLOGY PROTEIN;                       
  33:  3irs-A 14.8  3.6  221   281   10 PDB  MOLECULE: UNCHARACTERIZED PROTEIN BB4693;                            
  34:  4dlf-A 14.6  3.7  224   287    8 PDB  MOLECULE: AMIDOHYDROLASE 2;                                          
  35:  4mup-B 14.5  3.2  213   286   11 PDB  MOLECULE: AMIDOHYDROLASE;                                            
  36:  2ffi-A 14.4  3.3  217   273    9 PDB  MOLECULE: 2-PYRONE-4,6-DICARBOXYLIC ACID HYDROLASE, PUTATIV          
  37:  2vc5-A 14.3  4.1  227   314   11 PDB  MOLECULE: ARYLDIALKYLPHOSPHATASE;                                    
  38:  4hk5-D 14.0  3.5  230   380   13 PDB  MOLECULE: URACIL-5-CARBOXYLATE DECARBOXYLASE;                        
  39:  2dvt-A 14.0  3.4  216   325   13 PDB  MOLECULE: THERMOPHILIC REVERSIBLE GAMMA-RESORCYLATE DECARBO          
  40:  4ofc-A 13.9  3.4  214   335   15 PDB  MOLECULE: 2-AMINO-3-CARBOXYMUCONATE-6-SEMIALDEHYDE DECARBOX          
  41:  2qpx-A 13.7  4.0  226   376   11 PDB  MOLECULE: PREDICTED METAL-DEPENDENT HYDROLASE OF THE TIM-BA          
  42:  1v77-A 13.7  2.7  182   202    5 PDB  MOLECULE: HYPOTHETICAL PROTEIN PH1877;                               
  43:  4qrn-A 13.7  3.8  224   352   13 PDB  MOLECULE: 5-CARBOXYVANILLATE DECARBOXYLASE;                          
  44:  2gwg-A 13.6  4.0  224   329   13 PDB  MOLECULE: 4-OXALOMESACONATE HYDRATASE;                               
  45:  2a3l-A 13.1  3.4  243   616   15 PDB  MOLECULE: AMP DEAMINASE;                                             
  46:  3pnu-A 13.0  4.4  242   338   13 PDB  MOLECULE: DIHYDROOROTASE;                                            
  47:  4dzi-C 12.3  3.8  217   388   10 PDB  MOLECULE: PUTATIVE TIM-BARREL METAL-DEPENDENT HYDROLASE;             
  48:  1j5s-A 11.6  3.7  221   451   10 PDB  MOLECULE: URONATE ISOMERASE;                                         
  49:  3qy6-A 11.4  3.3  182   247    9 PDB  MOLECULE: TYROSINE-PROTEIN PHOSPHATASE YWQE;                         
  50:  1itq-A 11.3  3.5  215   369   11 PDB  MOLECULE: RENAL DIPEPTIDASE;                                         
  51:  3iac-A 11.1  3.7  218   469    9 PDB  MOLECULE: GLUCURONATE ISOMERASE;                                     
  52:  3dcp-A  9.4  3.1  169   277    9 PDB  MOLECULE: HISTIDINOL-PHOSPHATASE;                                    
  53:  3f2b-A  8.9  3.3  175   994    9 PDB  MOLECULE: DNA-DIRECTED DNA POLYMERASE III ALPHA CHAIN;               
  54:  3au2-A  8.8  6.6  178   575   11 PDB  MOLECULE: DNA POLYMERASE BETA FAMILY (X FAMILY);                     
  55:  1m65-A  7.9  3.8  190   234   11 PDB  MOLECULE: HYPOTHETICAL PROTEIN YCDX;                                 
  56:  1bks-A  6.9  3.7  177   255    7 PDB  MOLECULE: TRYPTOPHAN SYNTHASE;                                       
  57:  2yb1-A  5.6  3.8  144   284   13 PDB  MOLECULE: AMIDOHYDROLASE;                                            
  58:  3e38-A  5.2  4.0  164   342    9 PDB  MOLECULE: TWO-DOMAIN PROTEIN CONTAINING PREDICTED PHP-LIKE           
  59:  2anu-A  5.2  3.4  134   224   12 PDB  MOLECULE: HYPOTHETICAL PROTEIN TM0559;                               


Pairwise Structural Alignments

Notation: three-state secondary structure definitions by DSSP (reduced to H=helix, E=sheet, L=coil) are shown above the amino acid sequence. Structurally equivalent residues are in uppercase, structurally non-equivalent residues (e.g. in loops) are in lowercase. Amino acid identities are marked by vertical bars.

No 1: Query=1j6pA Sbjct=1j6pA Z-score=77.4

back to top
DSSP  LEEEEEEEEELLLLLLLLEEEEEEEELLEEEEEEELLLLLLEELLLEEEEELEEEEEELH
Query HHXIIGNCLILKDFSSEPFWGAVEIENGTIKRVLQGEVKVDLDLSGKLVXPALFNTHTHA   60
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct HHXIIGNCLILKDFSSEPFWGAVEIENGTIKRVLQGEVKVDLDLSGKLVXPALFNTHTHA   60
DSSP  LEEEEEEEEELLLLLLLLEEEEEEEELLEEEEEEELLLLLLEELLLEEEEELEEEEEELH


DSSP  HHHHHLLLLLLLLHHHHHHLLHHHHHLLLLHHHHHHHHHHHHHHHHLLLEEEEEEEELLH
Query PXTLLRGVAEDLSFEEWLFSKVLPIEDRLTEKXAYYGTILAQXEXARHGIAGFVDXYFHE  120
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct PXTLLRGVAEDLSFEEWLFSKVLPIEDRLTEKXAYYGTILAQXEXARHGIAGFVDXYFHE  120
DSSP  HHHHHLLLLLLLLHHHHHHLLHHHHHLLLLHHHHHHHHHHHHHHHHLLLEEEEEEEELLH


DSSP  HHHHHHHHHHLLEEEEEEEELLLLLLLLLHHHHHHHHHHHHLLHHHLEEEEEEELLLLLL
Query EWIAKAVRDFGXRALLTRGLVDSNGDDGGRLEENLKLYNEWNGFEGRIFVGFGPHSPYLC  180
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct EWIAKAVRDFGXRALLTRGLVDSNGDDGGRLEENLKLYNEWNGFEGRIFVGFGPHSPYLC  180
DSSP  HHHHHHHHHHLLEEEEEEEELLLLLLLLLHHHHHHHHHHHHLLHHHLEEEEEEELLLLLL


DSSP  LHHHHHHHHHHHHHHLLLEEEEELLLLLLLLLLHHHHLLLLLLLLEEEEELLLLLHHHHH
Query SEEYLKRVFDTAKSLNAPVTIHLYETSKEEYDLEDILNIGLKEVKTIAAHCVHLPERYFG  240
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct SEEYLKRVFDTAKSLNAPVTIHLYETSKEEYDLEDILNIGLKEVKTIAAHCVHLPERYFG  240
DSSP  LHHHHHHHHHHHHHHLLLEEEEELLLLLLLLLLHHHHLLLLLLLLEEEEELLLLLHHHHH


DSSP  HHLLLLEEEEELHHHHHHLLLLLLLHHHHHHLLLEEEELLLLLLLLLLLLHHHHHHHHHH
Query VLKDIPFFVSHNPASNLKLGNGIAPVQRXIEHGXKVTLGTDGAASNNSLNLFFEXRLASL  300
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct VLKDIPFFVSHNPASNLKLGNGIAPVQRXIEHGXKVTLGTDGAASNNSLNLFFEXRLASL  300
DSSP  HHLLLLEEEEELHHHHHHLLLLLLLHHHHHHLLLEEEELLLLLLLLLLLLHHHHHHHHHH


DSSP  HHHLLLLLLLLHHHHHHHHLHHHHHHHLLLLLLLLLLLLLLEEEEELLLHHHLLHHHHHH
Query LQKAQNPRNLDVNTCLKXVTYDGAQAXGFKSGKIEEGWNADLVVIDLDLPEXFPVQNIKN  360
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct LQKAQNPRNLDVNTCLKXVTYDGAQAXGFKSGKIEEGWNADLVVIDLDLPEXFPVQNIKN  360
DSSP  HHHLLLLLLLLHHHHHHHHLHHHHHHHLLLLLLLLLLLLLLEEEEELLLHHHLLHHHHHH


DSSP  HHHHLLLLLLLEEEELLEEEEELLLLLLLLHHHHHHHHHHHHHHHHL
Query HLVHAFSGEVFATXVAGKWIYFDGEYPTIDSEEVKRELARIEKELYS  407
ident |||||||||||||||||||||||||||||||||||||||||||||||
Sbjct HLVHAFSGEVFATXVAGKWIYFDGEYPTIDSEEVKRELARIEKELYS  407
DSSP  HHHHLLLLLLLEEEELLEEEEELLLLLLLLHHHHHHHHHHHHHHHHL


No 2: Query=1j6pA Sbjct=3ls9A Z-score=48.3

back to top
DSSP  lEEEEEEE-EELLLL--LLLLEEEEEEEELLEEEEEEElLLLL-----LEELLLEEEEEL
Query hHXIIGNC-LILKDF--SSEPFWGAVEIENGTIKRVLQgEVKV-----DLDLSGKLVXPA   52
ident     |              |       |    |  |              |  |    | 
Sbjct -MILIRGLtRVITFDdqERELEDADILIDGPKIVAVGK-DLSDrsvsrTIDGRGMIALPG   58
DSSP  -LEEEEEEeEEELLLllLLEEEEEEEEEELLEEEEEEL-LLLLlllleEEELLLEEEEEL


DSSP  EEEEEELHHHHHHLLL--LLLLLHHHHHHlLHHHHHLL------LLHHHHHHHHHHHHHH
Query LFNTHTHAPXTLLRGV--AEDLSFEEWLFsKVLPIEDR------LTEKXAYYGTILAQXE  104
ident | | | |      |     |      ||   ||                          |
Sbjct LINSHQHLYEGAMRAIpqLERVTMASWLE-GVLTRSAGwwrdgkFGPDVIREVARAVLLE  117
DSSP  EEEEEELHHHHHHLLLhhHLLLLHHHHHH-HHHHHHHHhhhlllLLHHHHHHHHHHHHHH


DSSP  HHLLLEEEEEEEEL---------LHHHHHHHHHHHLLEEEEEEEELLLL-----------
Query XARHGIAGFVDXYF---------HEEWIAKAVRDFGXRALLTRGLVDSN-----------  144
ident     ||    |                   |  | | |    |                 
Sbjct SLLGGITTVADQHLffpgatadsYIDATIEAATDLGIRFHAARSSMTLGkseggfcddlf  177
DSSP  HHHLLEEEEEEEELlllllllllHHHHHHHHHHHHLLEEEEEELLLLLLhhhlllllhhh


DSSP  -lLLLLHHHHHHHHHHHHLLHH--HLEEEEEEELLLLLLLHHHHHHHHHHHHHHLLLEEE
Query -gDDGGRLEENLKLYNEWNGFE--GRIFVGFGPHSPYLCSEEYLKRVFDTAKSLNAPVTI  201
ident            | |       |  |      ||        |        |         
Sbjct vePVDRVVQHCLGLIDQYHEPEpfGMVRIALGPCGVPYDKPELFEAFAQMAADYDVRLHT  237
DSSP  llLHHHHHHHHHHHHHHHLLLLllLLEEEEELLLLLLLLLHHHHHHHHHHHHHHLLEEEE


DSSP  EELLlLLLL---------LLLHHHHLLLLLLLLEEEEELLLLLHHHHHHHLLLLEEEEEL
Query HLYEtSKEE---------YDLEDILNIGLKEVKTIAAHCVHLPERYFGVLKDIPFFVSHN  252
ident | ||                       |        || |  |        |      | 
Sbjct HFYE-PLDAgmsdhlygmTPWRFLEKHGWASDRVWLAHAVVPPREEIPEFADAGVAIAHL  296
DSSP  EELL-LLHHhhhhhhhllLHHHHHHHLLLLLLLEEEEELLLLLHHHHHHHHHHLLEEEEL


DSSP  HHHHHHLLLLLLLHHHHHHLLLEEEELLLLLLLLLLLLHHHHHHHHHHHHHLL----LLL
Query PASNLKLGNGIAPVQRXIEHGXKVTLGTDGAASNNSLNLFFEXRLASLLQKAQ----NPR  308
ident  |  |  | | ||       |  |  || | |||   ||    ||| |            
Sbjct IAPDLRMGWGLAPIREYLDAGITVGFGTTGSASNDGGNLLGDLRLAALAHRPAdpnePEK  356
DSSP  HHHHHHLLLLLLLHHHHHHLLLEEEELLLLLLLLLLLLHHHHHHHHHHHLHHHllllHHH


DSSP  LLLHHHHHHHHLHHHHHHHLL-LLLLLLLLLLLLEEEEELLLHHHLLHHHHHHHHHHLL-
Query NLDVNTCLKXVTYDGAQAXGF-KSGKIEEGWNADLVVIDLDLPEXFPVQNIKNHLVHAF-  366
ident  |     |   |   |   |    |  |||  ||     ||      |      |     
Sbjct WLSARELLRMATRGSAECLGRpDLGVLEEGRAADIACWRLDGVDRVGVHDPAIGLIMTGl  416
DSSP  LLLHHHHHHHLLHHHHHHLLLlLLLLLLLLLLLLEEEEELLLHHHLLLLLHHHHHHHLLl


DSSP  LLLLLEEEELLEEEEELLLLLLLLHHHHHHHHHHHHHhhhl
Query SGEVFATXVAGKWIYFDGEYPTIDSEEVKRELARIEKelys  407
ident |       | |            | |               
Sbjct SDRASLVVVNGQVLVENERPVLADLERIVANTTALIP----  453
DSSP  LLLLLEEEELLEEEEELLEELLLLHHHHHHHHHHHLL----


No 3: Query=1j6pA Sbjct=2pajA Z-score=43.7

back to top
DSSP  LEEEEEEE-EELLLL------LLLLEEEEEEEELLEEEEEEeLLLL----lLEELLLEEE
Query HHXIIGNC-LILKDF------SSEPFWGAVEIENGTIKRVLqGEVK----vDLDLSGKLV   49
ident     | |   |           |        |   ||                |      
Sbjct PSTLIRNAaAIMTGGrgtaddPSRVPGPDIRIVGDTIDAIG-ALAPrpgetIVDATDCVI   59
DSSP  LEEEEELLlEELLLLllllllLLLLLLLLEEEELLEEEEEL-LLLLlllleEEELLLLEE


DSSP  EELEEEEEELHHHHHHLLLLllllhhhhhhllhhhHHLLLLHHHHHHHHHHHHHHHHLLL
Query XPALFNTHTHAPXTLLRGVAedlsfeewlfskvlpIEDRLTEKXAYYGTILAQXEXARHG  109
ident  ||  ||| |    || |                       |            | || |
Sbjct YPAWVNTHHHLFQSLLKGEP---------------FRALFDERRFRLAARIGLIELARSG  104
DSSP  EELEELLLLLHHHHHLLLLL---------------LHHHLLHHHHHHHHHHHHHHHHLLL


DSSP  EEEEEEEEL---------LHHHHHHHHHHHLLEEEEEEEELLL-------------llLL
Query IAGFVDXYF---------HEEWIAKAVRDFGXRALLTRGLVDS-------------ngDD  147
ident  |   |                        | |  | ||                     
Sbjct CATVADHNYvyypgmpfdSSAILFEEAEKLGLRFVLLRGGATQtrqleadlptalrpeTL  164
DSSP  EEEEEELLLlllllllllHHHHHHHHHHHLLLEEEEEELLLLLlllllllllhhhlllLH


DSSP  LLHHHHHHHHHHHHLLHH--HLEEEEEEELL-LLLLLHHHHHHHHHHHHHHLLLEEEEEL
Query GGRLEENLKLYNEWNGFE--GRIFVGFGPHS-PYLCSEEYLKRVFDTAKSLNAPVTIHLY  204
ident          |              |   |    |  |          |  |      || 
Sbjct DAYVADIERLAARYHDASprAMRRVVMAPTTvLYSISPREMRETAAVARRLGLRMHSHLS  224
DSSP  HHHHHHHHHHHHHLLLLLllLLEEEEELLLLlLLLLLHHHHHHHHHHHHHLLLEEEEELL


DSSP  lllllLLLL-HHHHLLLLLLLLEEEEELLLLLHHHHHHHLLLLEEEEELHHHHHHLllll
Query etskeEYDL-EDILNIGLKEVKTIAAHCVHLPERYFGVLKDIPFFVSHNPASNLKLgngi  263
ident                          || |         |      | | | ||  |    
Sbjct -----GKSPvAFCGEHDWLGSDVWYAHLVKVDADEIALLAQTGTGVAHCPQSNGRL----  275
DSSP  -----LLLHhHHHHHLLLLLLLEEEELLLLLLHHHHHHHHHHLLEEEELHHHHHLL----


DSSP  lLHHHHHHLLLEEEELLLLLLLLLLLLHHHHHHHHHHHHHLLLlllLLHHHHHHHHLHHH
Query aPVQRXIEHGXKVTLGTDGAASNNSLNLFFEXRLASLLQKAQNprnLDVNTCLKXVTYDG  323
ident  ||      |  |  | ||||||       |     | | |               |  |
Sbjct -PVREMADAGVPVSIGVDGAASNEAADMISEVHMTWLAQRARL---ASIAEVIHWGTAGG  331
DSSP  -LLLLHHHHLLLEEELLLHHHHLLLLLHHHHHHHHHHHHHHLL---LLHHHHHHHHLHHH


DSSP  HHHHLL-LLLLLLLLLLLLEEEEELLLHHHLLHHHHHHHHHHLLLLL-LLEEEELLEEEE
Query AQAXGF-KSGKIEEGWNADLVVIDLDLPEXFPVQNIKNHLVHAFSGE-VFATXVAGKWIY  381
ident |   |    ||   |  ||  |  || |  |         |       | |   |||   
Sbjct ARVMGLdEVGKVAVGYAADIAVYRLDDPRYFGLHDPAIGPVASGGRPsVMALFSAGKRVV  391
DSSP  HHHHLLlLLLLLLLLLLLLEEEEELLLHHHLLLLLHHHHHHHLLLLLeEEEEEELLEEEE


DSSP  ELLLLLLLLHHHHHHHHHHHHHHHHL----
Query FDGEYPTIDSEEVKRELARIEKELYS----  407
ident  |      |  |   |  |   ||      
Sbjct VDDLIEGVDIKELGGEARRVVRELLRevvv  421
DSSP  ELLLLLLLLHHHHHHHHHHHHHHHHHhhhl


No 4: Query=1j6pA Sbjct=4rdvB Z-score=43.1

back to top
DSSP  leEEEEEEEELLLlLLLLEEEEEEEE-LLEEEEEEELLL-LLLEELlLEEEEELEEEEEE
Query hhXIIGNCLILKDfSSEPFWGAVEIE-NGTIKRVLQGEV-KVDLDLsGKLVXPALFNTHT   58
ident     |     |            ||   |                | |  | |   | | 
Sbjct --SAIFAERALLP-EGWARNVRFEISaDGVLAEIRPDANaDGAERL-GGAVLPGMPNLHS   56
DSSP  --LEEEEEEEEEL-LEEEEEEEEEELlLLLEEEEELLLLlLLLEEL-LLLEEELEEEEEE


DSSP  LHHHHHHLLLLLL-----LLHHHHHHlLHHHHHLLLLHHHHHHHHHHHHHHHHLLLEEEE
Query HAPXTLLRGVAED-----LSFEEWLFsKVLPIEDRLTEKXAYYGTILAQXEXARHGIAGF  113
ident ||      | ||       ||  |          ||              |    |    
Sbjct HAFQRAMAGLAEVagnpnDSFWTWRE-LMYRMVARLSPEQIEVIACQLYIEMLKAGYTAV  115
DSSP  LHHHHHHLLLLLLlllllLLHHHHHH-HHHHHHLLLLHHHHHHHHHHHHHHHHHHLEEEE


DSSP  EEEEL---------------LHHHHHHHHHHHLLEEEEEEEELLL---------------
Query VDXYF---------------HEEWIAKAVRDFGXRALLTRGLVDS---------------  143
ident                         |  |    |    |   |                  
Sbjct AEFHYvhhdldgrsyadpaeLSLRISRAASAAGIGLTLLPVLYSHagfggqpasegqrrf  175
DSSP  EEEELllllllllllllllhHHHHHHHHHHHHLLEEEEEELLLLEeellleellhhhlll


DSSP  llLLLLHHHHHHHHHHHHlLHHHlEEEEEEELLLLLLLHHHHHHHHHHhHHHLLLEEEEE
Query ngDDGGRLEENLKLYNEWnGFEGrIFVGFGPHSPYLCSEEYLKRVFDTaKSLNAPVTIHL  203
ident        ||    |        |    |   ||           |         || || 
Sbjct inGSEAYLELLQRLRAPL-EAAG-HSLGLCFHSLRAVTPQQIATVLAA-GHDDLPVHIHI  232
DSSP  llLHHHHHHHHHHHHHHH-HHHL-LEELEEELLLLLLLHHHHHHHHLL-LLLLLLEEEEE


DSSP  LLLLLLL---------LLLHHHH-LLLLLllLEEEEELLLLLHHHHHHHLLLLEEEEELH
Query YETSKEE---------YDLEDIL-NIGLKevKTIAAHCVHLPERYFGVLKDIPFFVSHNP  253
ident  |  ||            |     |           |  |                    
Sbjct AEQQKEVddcqawsgrRPLQWLYeNVAVD-qRWCLVHATHADPAEVAAMARSGAVAGLCL  291
DSSP  LLLHHHHhhhhhhhllLHHHHHHhHLLLL-lLEEEEELLLLLHHHHHHHHHHLLEEEELH


DSSP  HHHHHLLLLLLLHHHHHHLLLEEEELLLLLlllLLLLHHHHHHHHHHHHHLL--LLLLL-
Query ASNLKLGNGIAPVQRXIEHGXKVTLGTDGAasnNSLNLFFEXRLASLLQKAQ--NPRNL-  310
ident      || || |       |     | |      ||    | |     |         | 
Sbjct STEANLGDGIFPATDFLAQGGRLGIGSDSH---VSLSVVEELRWLEYGQRLRdrKRNRLy  348
DSSP  HHHHHLLLLLLLHHHHHHLLLEEEELLLLL---LLLLHHHHHHHHHHHHHHHhlLLLLLl


DSSP  ------LHHHHHHHHLHHHHHHHLLLLLLLLLLLLLLEEEEELLLHHHLLHH--HHHHHH
Query ------DVNTCLKXVTYDGAQAXGFKSGKIEEGWNADLVVIDLDLPEXFPVQ--NIKNHL  362
ident          |        |||| |   |    |  ||| | |   |           |  
Sbjct rddqpmIGRTLYDAALAGGAQALGQPIGSLAVGRRADLLVLDGNDPYLASAEgdALLNRW  408
DSSP  llllllHHHHHHHHHHHHHHHHHLLLLLLLLLLLLLLEEEELLLLHHHHLLLlhHHHHHH


DSSP  HHLLLLL-LLEEEELLEEEEELLLLLlLLHHhHHHHHHHHHHHHHl
Query VHAFSGE-VFATXVAGKWIYFDGEYPtIDSEeVKRELARIEKELYs  407
ident   |     |    ||| |   ||           |       ||  
Sbjct LFAGGDRqVRDVMVAGRWVVRDGRHA-GEER-SARAFVQVLGELL-  451
DSSP  HHHLLHHhEEEEEELLEEEELLLLLL-LHHH-HHHHHHHHHHHHL-


No 5: Query=1j6pA Sbjct=2uz9A Z-score=42.1

back to top
DSSP  -LEEEEEeEEELLL----LLLLLEEEEEEEE-LLEEEEEEELLLL------------LLE
Query -HHXIIGnCLILKD----FSSEPFWGAVEIE-NGTIKRVLQGEVK------------VDL   42
ident     |                            | |                        
Sbjct pLAHIFR-GTFVHStwtcPMEVLRDHLLGVSdSGKIVFLEEASQQeklakewcfkpcEIR   59
DSSP  lLLEEEE-EEEEELllllLLEEEEEEEEEELlLLLEEEEEEHHHHhhhhhhhlllhhHEE


DSSP  ELL-LEEEEELEEEEEELHHHHHHLLLLLLLLHHHHHHLLHHHHHLLL-LHHHHHHHHHH
Query DLS-GKLVXPALFNTHTHAPXTLLRGVAEDLSFEEWLFSKVLPIEDRL-TEKXAYYGTIL  100
ident  ||      | |  || ||      |   ||   |||     | | |      |      
Sbjct ELShHEFFMPGLVDTHIHASQYSFAGSSIDLPLLEWLTKYTFPAEHRFqNIDFAEEVYTR  119
DSSP  ELLlLLEEEELEEEEEEEHHHHHHLLLLLLLLHHHHHHHLHHHHHHHHhLHHHHHHHHHH


DSSP  HHHHHHLLLEEEEEEEEL----LHHHHHHHHHHHLLEEEEEEEELLL-------llLLLL
Query AQXEXARHGIAGFVDXYF----HEEWIAKAVRDFGXRALLTRGLVDS-------ngDDGG  149
ident         |                  |     || ||       |              
Sbjct VVRRTLKNGTTTACYFATihtdSSLLLADITDKFGQRAFVGKVCMDLndtfpeykeTTEE  179
DSSP  HHHHHHHLLEEEEEEELLllhhHHHHHHHHHHHHLLEEEEELEELLLlllllllllLHHH


DSSP  HHHHHHHHHHHHL-LHHHLEEEEEEELLLLLLLHHHHHHHHHHHHHHLLLEEEEELLLLL
Query RLEENLKLYNEWN-GFEGRIFVGFGPHSPYLCSEEYLKRVFDTAKSLNAPVTIHLYETSK  208
ident    |      |       |      |     |||         ||        |  |   
Sbjct SIKETERFVSEMLqKNYSRVKPIVTPRFSLSCSETLMGELGNIAKTRDLHIQSHISENRD  239
DSSP  HHHHHHHHHHHHHhHLLLLEEEEEEELLHHHLLHHHHHHHHHHHHHHLLEEEEEELLLHH


DSSP  LL-----------LLLHHHHLLLLLLLLEEEEELLLLLHHHHHHHLLLLEEEEELHHHHH
Query EE-----------YDLEDILNIGLKEVKTIAAHCVHLPERYFGVLKDIPFFVSHNPASNL  257
ident |                      |   ||  ||   |      |         | | |||
Sbjct EVeavknlypsykNYTSVYDKNNLLTNKTVMAHGCYLSAEELNVFHERGASIAHCPNSNL  299
DSSP  HHhhhhhhlllllLHHHHHHHLLLLLLLEEEEELLLLLHHHHHHHHHHLLEEEELHHHHH


DSSP  HLLLLLLLHHHHHHLLLEEEELLLLLlLLLLLLHHHHHHHHHHHHHLLL-----LLLLLH
Query KLGNGIAPVQRXIEHGXKVTLGTDGAaSNNSLNLFFEXRLASLLQKAQN-----PRNLDV  312
ident  |  |   |     |  |  |||| |    |       | |                |  
Sbjct SLSSGFLNVLEVLKHEVKIGLGTDVA-GGYSYSMLDAIRRAVMVSNILLinkvnEKSLTL  358
DSSP  HLLLLLLLHHHHHHLLLEEEELLLLL-LLLLLLHHHHHHHHHHHHHHHHhllllLLLLLH


DSSP  HHHHHHHLHHHHHHHLL--LLLLLLLLLLLLEEEEELLL--HHHLL---------hHHHH
Query NTCLKXVTYDGAQAXGF--KSGKIEEGWNADLVVIDLDL--PEXFP---------vQNIK  359
ident        |  | || |     |  | |   |   |                         
Sbjct KEVFRLATLGGSQALGLdgEIGNFEVGKEFDAILINPKAsdSPIDLfygdffgdisEAVI  418
DSSP  HHHHHHHLHHHHHHLLLllLLLLLLLLLLLLEEEELLLLllLLLLLllhhhhllllLHHH


DSSP  HHHHHlLLLL--LLEEEELLEEEeelLLLLlllhhhhhhhhhhhhhhhhl
Query NHLVHaFSGE--VFATXVAGKWIyfdGEYPtidseevkrelariekelys  407
ident                  | ||                             
Sbjct QKFLY-LGDDrnIEEVYVGGKQV---VPFS--------------------  444
DSSP  HHHHH-HLLHhhEEEEEELLEEE---ELLL--------------------


No 6: Query=1j6pA Sbjct=4cqbA Z-score=34.9

back to top
DSSP  ---LEEEEEEEEELllllLLLEEEEEEEELLEEEEEEeLLLL----lLEELLLEEEEELE
Query ---HHXIIGNCLILkdfsSEPFWGAVEIENGTIKRVLqGEVK----vDLDLSGKLVXPAL   53
ident       || |                 |    |                |  | || |  
Sbjct skdFDLIIRNAYLS----EKDSVYDIGIVGDRIIKIE-AKIEgtvkdEIDAKGNLVSPGF   55
DSSP  lllEEEEEEEEEEL----LLLEEEEEEEELLEEEEEE-LLLLlleeeEEELLLLLEEELE


DSSP  EEEEELHHHHHHL-----LLLL--LLLHHHHHHlLHHHHHLLLLHHHHHHHHHHHHHHHH
Query FNTHTHAPXTLLR-----GVAE--DLSFEEWLFsKVLPIEDRLTEKXAYYGTILAQXEXA  106
ident    |||                              |      |        |       
Sbjct VDAHTHMDKSFTStgerlPKFWsrPYTRDAAIE-DGLKYYKNATHEEIKRHVIEHAHMQV  114
DSSP  EEEEELHHHLLLLlllllLLLLllLLLHHHHHH-HHHHHHHHLLHHHHHHHHHHHHHHHH


DSSP  LLLEEEEEEEEL--------LHHHHHHHHHHH--LLEEEEEEEE--LLLLLL-LLLHHHH
Query RHGIAGFVDXYF--------HEEWIAKAVRDF--GXRALLTRGL--VDSNGD-DGGRLEE  153
ident  ||                   |    |                                
Sbjct LHGTLYTRTHVDvdsvaktkAVEAVLEAKEELkdLIDIQVVAFAqsGFFVDLeSESLIRK  174
DSSP  HLLEEEEEEEEElllllllhHHHHHHHHHHHLllLLEEEEEEELllLLLLLLlHHHHHHH


DSSP  HHHHHhhhllhhhleeEEEEELLL-LLLL--HHHHHHHHHHHHHHLLLEEEEElLLLL-L
Query NLKLYnewngfegrifVGFGPHSP-YLCS--EEYLKRVFDTAKSLNAPVTIHLyETSK-E  209
ident  |                 |   |       |  |   |  ||        |        
Sbjct SLDMG----------cDLVGGVDPaTRENnvEGSLDLCFKLAKEYDVDIDYHI-HDIGtV  223
DSSP  HHHHL----------lLEEELLLLlLLLLlhHHHHHHHHHHHHHLLLEEEEEE-LLLHhH


DSSP  LLL-LHHHHLLL---lLLLLEEEEELLLL-------LHHHHHHHLLLLEEEEELHHHHHh
Query EYD-LEDILNIG---lKEVKTIAAHCVHL-------PERYFGVLKDIPFFVSHNPASNLk  258
ident                         |                   ||          |   
Sbjct GVYsINRLAQKTiengYKGRVTTSHAWCFadapsewLDEAIPLYKDSGMKFVTCFSSTP-  282
DSSP  HHHhHHHHHHHHhhllLLLLEEEEELLHHhhllhhhHHHHHHHHHHHLLEEEEELLLLL-


DSSP  lllLLLLHHHHHHLLLEEEELLLLLL---LLLL-LLHHHHHHHHHHHHHLllLLLLLHHH
Query lgnGIAPVQRXIEHGXKVTLGTDGAA---SNNS-LNLFFEXRLASLLQKAqnPRNLDVNT  314
ident       ||    | |       |                               | |   
Sbjct ---PTMPVIKLLEAGINLGCASDNIRdfwVPFGnGDMVQGALIETQRLEL--KTNRDLGL  337
DSSP  ---LLLLHHHHHHLLLEEEEELLLLLlllLLLLlLLHHHHHHHHHHHHLL--LLHHHHHH


DSSP  HHHHHLHHHHHHHLLL-LLLLLLLLLLLEEEEELllhhhllhhhHHHHHHHLLLlLLLEE
Query CLKXVTYDGAQAXGFK-SGKIEEGWNADLVVIDLdlpexfpvqnIKNHLVHAFSgEVFAT  373
ident   |  |  ||   |      || |  |||||                             
Sbjct IWKMITSEGARVLGIEkNYGIEVGKKADLVVLNS---------lSPQWAIIDQA-KRLCV  387
DSSP  HHHHHLHHHHHHHLLHhHLLLLLLLLLLEEEELL---------lLHHHHHHHLL-LEEEE


DSSP  EELLEEEEELLLLLLllhhhhhhhhhhhhhhhhl
Query XVAGKWIYFDGEYPTidseevkrelariekelys  407
ident    |  |  |                        
Sbjct IKNGRIIVKDEVIVA-------------------  402
DSSP  EELLEEEEELLEELL-------------------


No 7: Query=1j6pA Sbjct=2oofA Z-score=34.7

back to top
DSSP  --LEEEEEEEEELLL-----LLLLLEEEEEEEELLEEEEEEELLLL----lLEELLLEEE
Query --HHXIIGNCLILKD-----FSSEPFWGAVEIENGTIKRVLQGEVK----vDLDLSGKLV   49
ident         |                   |     | |                |  ||||
Sbjct lnCERVWLNVTPATLrsdlaDYGLLEPHALGVHEGRIHALVPXQDLkypahWQDXKGKLV   60
DSSP  llLLEEEEEEEELLLlllllLLLLLLLEEEEEELLEEEEEEEHHHLlllllLEELLLLEE


DSSP  EELEEEEEELHHHhhhllLLLLLL--------------hhHHHHlLHHHHHLLLLHHHHH
Query XPALFNTHTHAPXtllrgVAEDLS--------------feEWLFsKVLPIEDRLTEKXAY   95
ident  | |   |||                                             |    
Sbjct TPGLIDCHTHLIF---agSRAEEFelrqkgvpyaeiarkgGGII-STVRATRAASEDQLF  116
DSSP  EELEEEEEELLLL---llLLHHHHhhhhhlllhhhhhhllLLHH-HHHHHHHHLLHHHHH


DSSP  HHHHHHHHHHHLLLEEEEEEEEL----------LHHHHHHHHHHHLLEEEEEEEEL----
Query YGTILAQXEXARHGIAGFVDXYF----------HEEWIAKAVRDFGXRALLTRGLV----  141
ident            | |                                 |   |        
Sbjct ELALPRVKSLIREGVTTVEIKSGygltledelkXLRVARRLGEALPIRVKTTLLAAhavp  176
DSSP  HHHHHHHHHHHHHLEEEEEEELLllllhhhhhhHHHHHHHHHHHLLLEEEEEEEEEllll


DSSP  -----lLLLLLLLHH-HHHHHHHHHHLlhhhleeEEEEeLLLL--LLLHHHHHHHHHHHH
Query -----dSNGDDGGRL-EENLKLYNEWNgfegrifVGFGpHSPY--LCSEEYLKRVFDTAK  193
ident                 |                              |      |   | 
Sbjct peyrddPDSWVETICqEIIPAAAEAGL------aDAVD-VFCEhiGFSLAQTEQVYLAAD  229
DSSP  hhhlllHHHHHHHHHhLHHHHHHHLLL------lLEEE-EEELllLLLHHHHHHHHHHHH


DSSP  HHLLLEEEEELLLllLLLLLhhhhlllLLLLLEEEEELLLLLHHHHHHHLLLLEEEEELH
Query SLNAPVTIHLYETskEEYDLedilnigLKEVKTIAAHCVHLPERYFGVLKDIPFFVSHNP  253
ident      |  |                           |   |       |          |
Sbjct QYGLAVKGHXDQL--SNLGG---stlaANFGALSVDHLEYLDPEGIQALAHRGVVATLLP  284
DSSP  HLLLEEEEEELLL--LLLLH---hhhhHHLLLLEEEELLLLLHHHHHHHHHHLLEEEELH


DSSP  HHHHHLLL-LLLLHHHHHHLLLEEEELLLLLL-LLLLLLHHHHHHHHHHHHhlllllLLL
Query ASNLKLGN-GIAPVQRXIEHGXKVTLGTDGAA-SNNSLNLFFEXRLASLLQkaqnprNLD  311
ident      |      ||      |       |          |   |  |  |        | 
Sbjct TAFYFLKEtKLPPVVALRKAGVPXAVSSDINPgTAPIVSLRXAXNXACTLF------GLT  338
DSSP  HHHHHLLLlLLLLHHHHHHLLLLEEELLLLLLlLLLLLLHHHHHHHHHHHH------LLL


DSSP  HHHHHHHHLHHHHHHHLL--LLLLLLLLLLLLEEEEELLlhhhllhhhHHHHHHHLLLLL
Query VNTCLKXVTYDGAQAXGF--KSGKIEEGWNADLVVIDLDlpexfpvqnIKNHLVHAFSGE  369
ident        ||   | | |     |    |  ||  |                 |       
Sbjct PVEAXAGVTRHAARALGEqeQLGQLRVGXLADFLVWNCG---------HPAELSYLIGVD  389
DSSP  HHHHHHHLLHHHHHHLLLllLLLLLLLLLLLLEEEELLL---------LLLHHHHLLLLL


DSSP  -LLEEEELLEEEEEllllllllhhhhhhhhhhhhhhhhl
Query -VFATXVAGKWIYFdgeyptidseevkrelariekelys  407
ident       | |                              
Sbjct qLVSRVVNGEETLH-------------------------  403
DSSP  lEEEEEELLEELLL-------------------------


No 8: Query=1j6pA Sbjct=1k6wA Z-score=34.3

back to top
DSSP  LEEEEEeEEELlllLLLLEEEEEEEELLEEEEEEEL--LLLL---LEELLLEEEEELEEE
Query HHXIIGnCLILkdfSSEPFWGAVEIENGTIKRVLQG--EVKV---DLDLSGKLVXPALFN   55
ident     |     |     |          | |                ||    || |    
Sbjct ALQTII-NARL---PGEEGLWQIHLQDGKISAIDAQsgVMPItenSLDAEQGLVIPPFVE   56
DSSP  LLLEEE-EELL---LLLLLEEEEEEELLEEEEEEEEllLLLLlllEEELLLLEEELLEEE


DSSP  EEELHHHHHHLL---LLLLLLHHHHHhLLHHHHHLLLLHHHHHHHHHHHHHHHHLLLEEE
Query THTHAPXTLLRG---VAEDLSFEEWLfSKVLPIEDRLTEKXAYYGTILAQXEXARHGIAG  112
ident  | |   |   |           |            ||                  ||  
Sbjct PHIHLDTTQTAGqpnWNQSGTLFEGI-ERWAERKALLTHDDVKQRAWQTLKWQIANGIQH  115
DSSP  EEELLLLLLLLLlllLLLLLLHHHHH-HHHHLLHHHLLHHHHHHHHHHHHHHHHHLLEEE


DSSP  EEEEEL-------LHHHHHHHHHHH--LLEEEEEEEE---LLLLLLL-LLHHHHHHHHHh
Query FVDXYF-------HEEWIAKAVRDF--GXRALLTRGL---VDSNGDD-GGRLEENLKLYn  159
ident                                           |         |       
Sbjct VRTHVDvsdatltALKAMLEVKQEVapWIDLQIVAFPqegILSYPNGeALLEEALRLGA-  174
DSSP  EEEEEEllllllhHHHHHHHHHHHHllLLEEEEEEELlllLLLLLLHhHHHHHHHHLLL-


DSSP  hhllhhhleeEEEEElLLLLL-----LHHHHHHHHHHHHHHLLLEEEEELLLLLLLLL-L
Query ewngfegrifVGFGPhSPYLC-----SEEYLKRVFDTAKSLNAPVTIHLYETSKEEYD-L  213
ident              |   |          | |   |  |         |  |   |     
Sbjct ----------DVVGA-IPHFEftreyGVESLHKTFALAQKYDRLIDVHCDEIDDEQSRfV  223
DSSP  ----------LEEEE-LHHHLllhhhHHHHHHHHHHHHHHHLLEEEEEELLLLLLLLLhH


DSSP  HHHHLlLLLL----lLEEEEELLLL-------LHHHHHHHLLLLEEEEELHHHHHHLLL-
Query EDILNiGLKE----vKTIAAHCVHL-------PERYFGVLKDIPFFVSHNPASNLKLGN-  261
ident |                 | |             | |  ||        ||  |  |   
Sbjct ETVAA-LAHHegmgaRVTASHTTAMhsyngayTSRLFRLLKMSGINFVANPLVNIHLQGr  282
DSSP  HHHHH-HHHHhllhhHEEEEELHHHhhllhhhHHHHHHHHHHHLLEEEELHHHHHHHLLl


DSSP  --------LLLLHHHHHHLLLEEEELLLLLL---LLLL-LLHHHHHHHHHHHHHllLLLL
Query --------GIAPVQRXIEHGXKVTLGTDGAA---SNNS-LNLFFEXRLASLLQKaqNPRN  309
ident         ||  |    | |  |  | |            |                   
Sbjct fdtypkrrGITRVKEMLESGINVCFGHDDVFdpwYPLGtANMLQVLHMGLHVCQ--LMGY  340
DSSP  llllllllLLLLHHHHHHLLLLEEELLLLLLlllLLLLlLLHHHHHHHHHHHLL--LLLH


DSSP  lLHHHHHHHHLHHHHHHH-LLLLlLLLLLLLLLEEEEELllhhhllhhhHHHHHHHLLLl
Query lDVNTCLKXVTYDGAQAX-GFKSgKIEEGWNADLVVIDLdlpexfpvqnIKNHLVHAFSg  368
ident    |  |   |   |          |  |  | |                          
Sbjct gQINDGLNLITHHSARTLnLQDY-GIAAGNSANLIILPA---------eNGFDALRRQV-  389
DSSP  hHHHHHHHHHLHHHHHHLlLLLL-LLLLLLLLLEEEELL---------lLHHHHHHHLL-


DSSP  LLLEEEELLEEEEELLllllllhhhhhhhhhhhhhhhhl
Query EVFATXVAGKWIYFDGeyptidseevkrelariekelys  407
ident  |      || |                           
Sbjct PVRYSVRGGKVIASTQ-----paqttvyleqpeaidykr  423
DSSP  LLLEEEELLEEEEELL-----llleeeellleeeellll


No 9: Query=1j6pA Sbjct=3mtwA Z-score=31.3

back to top
DSSP  -LEEEEEEEEELLLLLLLLE-EEEEEEELLEEEEEEELLLL-----lLEELLLEEEEELE
Query -HHXIIGNCLILKDFSSEPF-WGAVEIENGTIKRVLQGEVK-----vDLDLSGKLVXPAL   53
ident            |   |        |    | |                 || |    | |
Sbjct aEIKAVSAARLLDVASGKYVdNPLVIVTDGRITSIGKKGDAvpagatAVDLPGVTLLPGL   60
DSSP  lLEEEEEEEEEEELLLLEEEeLEEEEEELLEEEEEEELLLLllllleEEEEEEEEEEELE


DSSP  EEEEELHHHhhHLLLlllllhhhhhhllHHHHHLLLLHHHHHHHHHHHHHHHHLLLEEEE
Query FNTHTHAPXtlLRGVaedlsfeewlfskVLPIEDRLTEKXAYYGTILAQXEXARHGIAGF  113
ident    | |     |  |                                        |    
Sbjct IDMHVHLDS--LAEV-------------GGYNSLEYSDRFWSVVQTANAKKTLEAGFTTV  105
DSSP  EEEEELLLL--LLLL-------------LHHHHHHLLHHHHHHHHHHHHHHHHHLLEEEE


DSSP  EEEELLHHHHHHHHHHH------LLEEEEE-EEELLLL------------llLLLH----
Query VDXYFHEEWIAKAVRDF------GXRALLT-RGLVDSN------------gdDGGR----  150
ident                        | |                                  
Sbjct RNVGAADYDDVGLREAIdagyvpGPRIVTAaISFGATGghcdstffppsmdqKNPFnsds  165
DSSP  EELLLLLLHHHHHHHHHhlllllLLEEEELlLLEELLLlllllllllhhhllLLLLllll


DSSP  ----hHHHHHHHHHHLlhhhleeEEEEELLLL------------LLLHHHHHHHHHHHHH
Query ----lEENLKLYNEWNgfegrifVGFGPHSPY------------LCSEEYLKRVFDTAKS  194
ident           |                                     |  | | | |  
Sbjct pdearKAVRTLKKYGA-------QVIXICATGgvfsrgnepgqqQLTYEEMKAVVDEAHM  218
DSSP  hhhhhHHHHHHHHLLL-------LEEEEELLLllllllllllllLLLHHHHHHHHHHHHH


DSSP  HLLLEEEEELlllllLLLL-hHHHLLLLllllEEEEELLLLLHHHHHHHLLLLEEEEELH
Query LNAPVTIHLYetskeEYDL-eDILNIGLkevkTIAAHCVHLPERYFGVLKDIPFFVSHNP  253
ident     |  |                  |         |                   |   
Sbjct AGIKVAAHAH-----GASGirEAVRAGV----DTIEHASLVDDEGIKLAVQKGAYFSMDI  269
DSSP  LLLEEEEEEL-----LHHHhhHHHHLLL----LEEEELLLLLHHHHHHHHHHLLEEELLL


DSSP  HHHHHLL-------------------LLLL--LHHHHHHLLLEEEELLLLLlLLLLLLHH
Query ASNLKLG-------------------NGIA--PVQRXIEHGXKVTLGTDGAaSNNSLNLF  292
ident                                         | |   |||           
Sbjct YNTDYTQaegkkngvlednlrkdrdiGELQreNFRKALKAGVKMVYGTDAG-IYPHGDNA  328
DSSP  LLHHHHHhhhhhhlllhhhhhhhhhhHHHHhhHHHHHHHHLLEEELLLLLL-LLLLLLHH


DSSP  HHHHHHHHHHhllllllLLHHHHHHHHLHHHHHHHLL--LLLLLLLLLLLLEEEEELllh
Query FEXRLASLLQkaqnprnLDVNTCLKXVTYDGAQAXGF--KSGKIEEGWNADLVVIDLdlp  350
ident                            |   | | |     |    |   |         
Sbjct KQFAVMVRYG-------ATPLQAIQSATLTAAEALGRskDVGQVAVGRYGDMIAVAG---  378
DSSP  HHHHHHHHLL-------LLHHHHHHHLLHHHHHHHLLllLLLLLLLLLLLLEEEELL---


DSSP  hhllhhhHHHHHHHlLLLLLLEEEELLEEEEELlllllllhhhhhhhhhhhhhhhhl
Query exfpvqnIKNHLVHaFSGEVFATXVAGKWIYFDgeyptidseevkrelariekelys  407
ident             |             |                              
Sbjct -------DPLADVT-TLEKPVFVMKGGAVVKAP-----------------------x  404
DSSP  -------LLLLLHH-HHHLLLEEEELLEEEELL-----------------------l


No 10: Query=1j6pA Sbjct=3mkvA Z-score=30.4

back to top
DSSP  -LEEEEEEEEELlLLLL--LLEEEEEEEELLEEEEEEELLLL----lLEELLLEEEEELE
Query -HHXIIGNCLILkDFSS--EPFWGAVEIENGTIKRVLQGEVK----vDLDLSGKLVXPAL   53
ident        |   | |             || | |  |     |       |  ||   | |
Sbjct lTTFLFRNGALL-DPDHpdLLQGFEILIEDGFIREVSDKPIKssnahVIDVKGKTIMPGL   59
DSSP  lLEEEEEEEEEL-LLLLllLEEEEEEEEELLEEEEEELLLLLlllleEEELLLLEEEELE


DSSP  EEEEELHHHhHHLLllllllhhhhhhllHHHHHLLLLHHHHHHHhHHHHHHHHLLLEEEE
Query FNTHTHAPXtLLRGvaedlsfeewlfskVLPIEDRLTEKXAYYGtILAQXEXARHGIAGF  113
ident    | |                                               | |    
Sbjct IDLHVHVVA-IEFN--------------LPRVATLPNVLVTLRA-VPIMRAMLRRGFTTV  103
DSSP  EEEEELLLL-LLLL--------------HHHHLLLLHHHHHHHH-HHHHHHHHHLLEEEE


DSSP  EEEELLHHHHHHHHH---HHLLEEEEEE-EELL---------------------------
Query VDXYFHEEWIAKAVR---DFGXRALLTR-GLVD---------------------------  142
ident  |          ||      | |       |                             
Sbjct RDAGGAGYPFKQAVEsglVEGPRLFVSGrALSQtgghadprarsdymppdspcgccvrvg  163
DSSP  EELLLLLHHHHHHHHlllLLLLEEEELLlEEELlllllllllllllllllllllllllll


DSSP  ------LLLLL-lLHHHHHHHHHhhhllhhhleeEEEEELLL------------LLLLHH
Query ------SNGDD-gGRLEENLKLYnewngfegrifVGFGPHSP------------YLCSEE  183
ident          |       | |                                     || 
Sbjct algrvaDGVDEvrRAVREELQMG----------aDQIXIMASggvasptdpvgvFGYSED  213
DSSP  lleeelLLHHHhhHHHHHHHHHL----------lLLEEEELLllllllllllllLLLLHH


DSSP  HHHHHHHHHHHHLLLEEEEELllllLLLLLHHHHLLLLllllEEEEELLLLLHHHHHHHL
Query YLKRVFDTAKSLNAPVTIHLYetskEEYDLEDILNIGLkevkTIAAHCVHLPERYFGVLK  243
ident         |      |  | |               |         |             
Sbjct EIRAIVAEAQGRGTYVLAHAY----TPAAIARAVRCGV----RTIEHGNLIDDETARLVA  265
DSSP  HHHHHHHHHHLLLLLEEEEEL----LHHHHHHHHHLLL----LEEEELLLLLHHHHHHHH


DSSP  LLLEEEEELHHHHHHLL-------------------LLLL--LHHHHHHLLLEEEELLLL
Query DIPFFVSHNPASNLKLG-------------------NGIA--PVQRXIEHGXKVTLGTDG  282
ident      |         |                     |            | |   ||| 
Sbjct EHGAYVVPTLVTYDALAsegekyglppesiakiadvHGAGlhSIEIMKRAGVKMGFGTDL  325
DSSP  HHLLEEELLHHHHHHHHhhlllllllhhhhllhhhhHLLHhhHHHHHHHHLLLLLLLLLL


DSSP  LLLLLLLLhHHHHHHHHHhhhlllllLLLHHHHHHHHLHHHHHHHLL--LLLLLLLLLLL
Query AASNNSLNlFFEXRLASLlqkaqnprNLDVNTCLKXVTYDGAQAXGF--KSGKIEEGWNA  340
ident       |    | |             |         |   |   |   | | |  |  |
Sbjct LGEAQRLQ-SDEFRILAE--------VLSPAEVIASATIVSAEVLGMqdKLGRIVPGAHA  376
DSSP  LHHHHHHL-LHHHHHHHL--------LLLHHHHHHHLLHHHHHHLLLllLLLLLLLLLLL


DSSP  LEEEEELllhhhllhhhHHHHHHHL-LLLL--LLEEEELLEEEEELlllllllhhhhhhh
Query DLVVIDLdlpexfpvqnIKNHLVHA-FSGE--VFATXVAGKWIYFDgeyptidseevkre  397
ident |  | |                |                |                    
Sbjct DVLVVDG----------NPLKSVDClLGQGehIPLVMKDGRLFVNE--------------  412
DSSP  LEEEELL----------LLLLLLLLlLLLLllLLEEEELLEEEEEL--------------


DSSP  hhhhhhhhhl
Query lariekelys  407
ident           
Sbjct --------le  414
DSSP  --------ll


No 11: Query=1j6pA Sbjct=4c5yA Z-score=28.8

back to top
DSSP  ---LEEEEEEEEELLLLLLLLEEEEEEEELLEEEEEEELLLL---------lLEELllEE
Query ---HHXIIGNCLILKDFSSEPFWGAVEIENGTIKRVLQGEVK---------vDLDLsgKL   48
ident       ||   |            |  |    |  |                        
Sbjct deaKVTIIYAGLLIPGDGEPLRNAALVISDKIIAFVGSEADIpkkylrstqsTHRV--PV   58
DSSP  lllLEEEEEEEEELLLLLLLEEEEEEEEELLEEEEEEEHHHLlhhhhhhlllEEEE--EE


DSSP  EEELEEEEEELHhHHHHllllllllhhhhhhLLHHHHHLLLLHHHHHHHHHHHHHHHHLL
Query VXPALFNTHTHApXTLLrgvaedlsfeewlfSKVLPIEDRLTEKXAYYGTILAQXEXARH  108
ident   | |   | |                                            |    
Sbjct LMPGLWDCHMHF-GGDD------------dyYNDYTSGLATHPASSGARLARGCWEALQN  105
DSSP  EEELEEEEEELL-LLLL------------llLLLLHHHHHLLHHHHHHHHHHHHHHHHHL


DSSP  LEEEEEEEELLHHHHHHHHH---HHLLEEEEE-EEELLL---------------------
Query GIAGFVDXYFHEEWIAKAVR---DFGXRALLT-RGLVDS---------------------  143
ident |     |        |||       |         |                        
Sbjct GYTSYRDLAGYGCEVAKAINdgtIVGPNVYSSgAALSQTaghgdifalpagevlgsygvm  165
DSSP  LEEEEEELLLLHHHHHHHHHlllLLLLEEEELlLEEELLllllllllllhhhhhhhhlll


DSSP  ----------------LLLL-lLHHHHHHHHHhhhllhhhleEEEEEELLLL--------
Query ----------------NGDD-gGRLEENLKLYnewngfegriFVGFGPHSPY--------  178
ident                                                             
Sbjct nprpgywgagplciadGVEEvrRAVRLQIRRG----------AKVIXVMASGgvmsrddn  215
DSSP  llllllllllleeellLHHHhhHHHHHHHHHL----------LLLEEEELLLllllllll


DSSP  ----LLLHHHHHHHHHHHHHHLLLEEEEELllllLLLLLHHHHLLLLllllEEEEELLLL
Query ----LCSEEYLKRVFDTAKSLNAPVTIHLYetskEEYDLEDILNIGLkevkTIAAHCVHL  234
ident       | | ||     |   |  |  |                 |         |    
Sbjct pnfaQFSPEELKVIVEEAARQNRIVSAHVH----GKAGIMAAIKAGC----KSLEHVSYA  267
DSSP  llllLLLHHHHHHHHHHHHHLLLLEEEEEL----LHHHHHHHHHHLL----LEEEELLLL


DSSP  LHHHHHHHLLLLEEEEELHHHHHHLL------------------LLLL--LHHHHHHLLL
Query PERYFGVLKDIPFFVSHNPASNLKLG------------------NGIA--PVQRXIEHGX  274
ident  |      |                                           |  |  | 
Sbjct DEEVWELMKEKGILYVATRSVIEIFLasngeglvkeswaklqalADSHlkAYQGAIKAGV  327
DSSP  LHHHHHHHHHHLLEEELLHHHHHHHHhhllllllllhhhlllhhHHHHhhHHHHHHHLLL


DSSP  EEEELLLLLllllLLLHHHHHHHHHHHHhlllllLLLHHHHHHHHLHHHHHHH---LLLL
Query KVTLGTDGAasnnSLNLFFEXRLASLLQkaqnprNLDVNTCLKXVTYDGAQAX---GFKS  331
ident    |||| |          |   |                  |  |              
Sbjct TIALGTDTA---pGGPTALELQFAVERG------GMTPLEAIKAATANAPLSVgpqAPLT  378
DSSP  LEELLLLLL---lLLLLHHHHHHHHHLL------LLLHHHHHHHHLLLHHHHHhhhLLLL


DSSP  LLLLLLLLLLEEEEELllhhhllhhhHHHHHHHlLLLL---LLEEEELLEEEEEL--LLL
Query GKIEEGWNADLVVIDLdlpexfpvqnIKNHLVHaFSGE---VFATXVAGKWIYFD--GEY  386
ident |   ||  ||                           |   |      ||       |  
Sbjct GQLREGYEADVIALEE----------NPLEDIK-VFQEpkaVTHVWKGGKLFKGPgiGPW  427
DSSP  LLLLLLLLLLEEEELL----------LLLLLHH-HHHLhhhEEEEEELLEEEELLllLLL


DSSP  LLlLHHHhhhhhhhhhhhhhl
Query PTiDSEEvkrelariekelys  407
ident                      
Sbjct GEdARNP------------fl  436
DSSP  LLlLLLL------------ll


No 12: Query=1j6pA Sbjct=2imrA Z-score=28.3

back to top
DSSP  leeeeEEEE---elLLLLLLLEEEEeeeelleeEEEEE------LLLL-lleELLLE--e
Query hhxiiGNCL---ilKDFSSEPFWGAveiengtiKRVLQ------GEVK-vdlDLSGK--l   48
ident                   |                |                        
Sbjct --htpRLLTcdvlyTGAQSPGGVVV------vgETVAAaghpdeLRRQyphaAEERAgav   52
DSSP  --lleEEEEeleeeLLEELLEEEEE------elLEEEEeelhhhHHHHllllEEEELlle


DSSP  EEELEEEEEELHHHhhhlllllllLHHHHhhLLHHHhhllllhhHHHHHHHHHHHHHHLL
Query VXPALFNTHTHAPXtllrgvaedlSFEEWlfSKVLPiedrltekXAYYGTILAQXEXARH  108
ident   |   | |||              |       |                        | 
Sbjct IAPPPVNAHTHLDM-sayefqalpYFQWI--PEVVI---rgrhlRGVAAAQAGADTLTRL  106
DSSP  ELLLLLEEEEELLL-lhhhhhhlhHHHLL--HHHHH---hhlllLHHHHHHHHHHHHHHL


DSSP  LEEEEEEEELLhHHHHHHHHHH-LLEEEEEEEELLLLL-LLLLHHHHHHHHHHHHL-LHH
Query GIAGFVDXYFHeEWIAKAVRDF-GXRALLTRGLVDSNG-DDGGRLEENLKLYNEWN-GFE  165
ident |  |  |          |          |                         |     
Sbjct GAGGVGDIVWA-PEVMDALLAReDLSGTLYFEVLNPFPdKADEVFAAARTHLERWRrLER  165
DSSP  LLLLEEEEELL-HHHHHHHHLLlLLLEEEEEEELLLLHhHHHHHHHHHHHHHHHHHlLLL


DSSP  HLEEEEEEELLLLLLLHHHHHHHHHHHHHHLLLEEEEELLLLLLL---------------
Query GRIFVGFGPHSPYLCSEEYLKRVFDTAKSLNAPVTIHLYETSKEE---------------  210
ident      |  || |   |        | |     |  ||  |   |                
Sbjct PGLRLGLSPHTPFTVSHRLMRLLSDYAAGEGLPLQIHVAEHPTELemfrtgggplwdnrm  225
DSSP  LLEEEEEEELLLLLLLHHHHHHHHHHHHHHLLLLEEEELLLHHHHhhhhhlllllhhhll


DSSP  --------------------LLLHHHHL-LLLLlLLEEEEELLLLLHHHHHHHLLLLEEE
Query --------------------YDLEDILN-IGLKeVKTIAAHCVHLPERYFGVLKDIPFFV  249
ident                                |        | |                |
Sbjct palyphtlaevigrepgpdlTPVRYLDElGVLA-ARPTLVHMVNVTPDDIARVARAGCAV  284
DSSP  hhhllllhhhhhllllllllLHHHHHHHhLLHH-HLLEEEELLLLLHHHHHHHHHHLLLE


DSSP  EELHHHHHHLLLLLLLHHHHHHLLLEEEELLLLLLLLLLLLHHHHHHHHHHHHHlllllL
Query SHNPASNLKLGNGIAPVQRXIEHGXKVTLGTDGAASNNSLNLFFEXRLASLLQKaqnprN  309
ident    | ||  |  |          |  | ||||  ||   ||   |   |  |        
Sbjct VTCPRSNHHLECGTFDWPAFAAAGVEVALGTDSVASGETLNVREEVTFARQLYP-----G  339
DSSP  EELHHHHHHLLLLLLLHHHHHHLLLLEEELLLLHHHHLLLLLHHHHHHHHHHLL-----L


DSSP  LLHHHHHHHHLHHHHHHHLllLLLLLL-lllllEEEEelllhhhllhhhhhhhhhhlLLL
Query LDVNTCLKXVTYDGAQAXGfkSGKIEE-gwnadLVVIdldlpexfpvqniknhlvhaFSG  368
ident ||           |    |                                         
Sbjct LDPRVLVRAAVKGGQRVVG--TPFLRRgetwqeGFRW--------------------ELS  377
DSSP  LLHHHHHHHHHHHHHHHHL--LLLLLLlllllhHHLH--------------------HHL


DSSP  LLleeeelleeeeellllllllhhhhhhhhhhhhhhhhl
Query EVfatxvagkwiyfdgeyptidseevkrelariekelys  407
ident                                        
Sbjct RD------------------------------------l  380
DSSP  LL------------------------------------l


No 13: Query=1j6pA Sbjct=3icjA Z-score=28.1

back to top
DSSP  LEEEEEEEEELLLL-LLLLEeEEEEEELLEEEEEEELLLLL---------LEELLLEEEE
Query HHXIIGNCLILKDF-SSEPFwGAVEIENGTIKRVLQGEVKV---------DLDLSGKLVX   50
ident       |  |   |           | |                        || || | 
Sbjct CMKALINGTIYTSFsPVKKV-SGLVISNERVLYAGDSSTALriaelaggeIIDLKGKFVM   59
DSSP  LEEEEELLEEEEEElLEEEE-LEEEEELLEEEEEELHHHHHhhhhhhlleEEELLLLEEE


DSSP  ELEEEEEELHHH-HHHL-------------------------------------------
Query PALFNTHTHAPX-TLLR-------------------------------------------   66
ident || |  | |                                                   
Sbjct PAFFDSHLHLDElGMSLemvdlrgvksmeelvervkkgrgriifgfgwdqdelgrwptre  119
DSSP  ELEEEEEELHHHhHHHHhleellllllhhhhhhhhhlllllleeeeeelhhhhlllllhh


DSSP  ----------lllLLLL---------------------------hhhhhHLLHHHHHL-L
Query ----------gvaEDLS---------------------------feewlFSKVLPIED-R   88
ident                                                        |    
Sbjct dldvidrpvflyrRCFHvavmnskmidllnlkpskdfdestgivreralEESRKIINEkI  179
DSSP  hhlllllleeeeeLLLLeeeelhhhhhhhllllllleelllleeehhhhHHHHHHHHHlL


DSSP  LLHHHHHHHHHHHHHHHHLLLEEEEEE-EELL--HHHHHHHH--HHHLLEEEEEEEElll
Query LTEKXAYYGTILAQXEXARHGIAGFVD-XYFH--EEWIAKAV--RDFGXRALLTRGLvds  143
ident || |        ||      |                                       
Sbjct LTVKDYKHYIESAQEHLLSLGVHSVGFmSVGEkaLKALFELEreGRLKMNVFAYLSP---  236
DSSP  LLHHHHHHHHHHHHHHHHHLLEEEEEEeEELHhhHHHHHHHHhlLLLLLEEEEEELH---


DSSP  lllllLHHHHHHhhhHHHLLHhHLEE-EEEEeLLLL------------------------
Query ngddgGRLEENLklyNEWNGFeGRIF-VGFGpHSPY------------------------  178
ident        |               |    |                               
Sbjct -----ELLDKLEelnLGKFEG-RRLRiWGVX-LFVDgslgartallsepytdnpttsgel  289
DSSP  -----HHHHHHHhhlLLLEEL-LLEEeEEEE-EELLllllllllllllllllllllllll


DSSP  LLLHHHHHHHHHHHHHHLLLEEEEELlLLLL-lllLHHHHLLLLLlllEEEEELLLLLHH
Query LCSEEYLKRVFDTAKSLNAPVTIHLYeTSKE-eydLEDILNIGLKevkTIAAHCVHLPER  237
ident          |   || |   |  |     |     |                |       
Sbjct VMNKDEIVEVIERAKPLGLDVAVHAI-GDKAvdvaLDAFEEAEFS---GRIEHASLVRDD  345
DSSP  LLLHHHHHHHHHHHLLLLLEEEEEEL-LHHHhhhhHHHHHHHLLL---LEEEELLLLLHH


DSSP  HHHHHLLLLEEEEELHHHHHHLL-----------llLLLHHHHHHlLLEEEELLLLLllL
Query YFGVLKDIPFFVSHNPASNLKLG-----------ngIAPVQRXIEhGXKVTLGTDGAasN  286
ident      |      |  |                                |    ||     
Sbjct QLERIKELKVRISAQPHFIVSDWwivnrvgeerakwAYRLKTLSS-ITKLGFSTDSP--I  402
DSSP  HHHHHHHHLLEEEELLLHHHHLLlhhhhhhhhhhhhLLLHHHHHH-HLLEEELLLLL--L


DSSP  LLLLHHHHHHHHHHHHhLLLLlLLLHHHHHHHHLHHHHHHHLL-LLLLLLLLLLLLEEEE
Query NSLNLFFEXRLASLLQkAQNPrNLDVNTCLKXVTYDGAQAXGF-KSGKIEEGWNADLVVI  345
ident            |                 |   |   ||       || | |  |     
Sbjct EPADPWVSIDAAVNRYvVDPGeRVSREEALHLYTHGSAQVTLAeDLGKLERGFRAEYIIL  462
DSSP  LLLLHHHHHHHHHHLLlLLHHhLLLHHHHHHHLLHHHHHHLLLlLLLLLLLLLLLLEEEE


DSSP  ELllhhhllhhhHHHHhhhllllllleeeelleeeeellllllllhhhhhhhhhhhhhhh
Query DLdlpexfpvqnIKNHlvhafsgevfatxvagkwiyfdgeyptidseevkrelariekel  405
ident |                                                           
Sbjct DR----------DPLK--------------------------------------------  468
DSSP  LL----------LLLL--------------------------------------------


DSSP  hl
Query ys  407
ident   
Sbjct --  468
DSSP  --


No 14: Query=1j6pA Sbjct=2vunA Z-score=27.3

back to top
DSSP  LEEEEEEE-EELLLL--LLLLEEEEEEEELLEEEEEEELLLL------lLEELLLEEEEE
Query HHXIIGNC-LILKDF--SSEPFWGAVEIENGTIKRVLQGEVK------vDLDLSGKLVXP   51
ident    || |   |      |          | | |      |           |  |  | |
Sbjct SKTIIKNIgKIVSGDikSPVLQADTIVVEDGLIAAIGGEELMkdagdatIIDAAGSTVTP   60
DSSP  LEEEEELLlEEELLLllLLEELLLEEEEELLEEEEEELHHHHlllllleEEELLLLEEEE


DSSP  LEEEEEELHH---hHHHLLllllllhhhhhhllhhhhhllllhhhhhhhhhHHHHHHHLL
Query ALFNTHTHAP---xTLLRGvaedlsfeewlfskvlpiedrltekxayygtiLAQXEXARH  108
ident  |  || |                                                    
Sbjct GLLDTHVHVSggdyAPRQK------------------------------tmDFISSALHG   90
DSSP  LEEEEEELLLllleEHHHL------------------------------eeLHHHHHHLL


DSSP  LEEEEEEEEL---------------LHHHHHHHHHH---HLLEEEE-EEEELlllllLLL
Query GIAGFVDXYF---------------HEEWIAKAVRD---FGXRALL-TRGLVdsngdDGG  149
ident |                              |        |         |       | 
Sbjct GVTTMISAGSphfpgrpkdaagtkaLAITLSKSYYNarpAGVKVHGgAVILE-----KGL  145
DSSP  LEEEEEELLLlllllllllhhhhhhHHHHHHHHHHHllhHHLEEELlEELLL-----LLL


DSSP  HHHHHHHHHHHHLlhhhleeEEEEELL-llLLLHHHHHHHHHHHHHHLLLEEEEElLLLL
Query RLEENLKLYNEWNgfegrifVGFGPHS-pyLCSEEYLKRVFDTAKSLNAPVTIHLyETSK  208
ident   |       |            |          |        |      |  |      
Sbjct TEEDFIEMKKEGV-------WIVGEVGlgtIKNPEDAAPMVEWAHKHGFKVQMHT-GGTS  197
DSSP  LHHHHHHHHHLLL-------LEEEEELlllLLLHHHHHHHHHHHHHLLLEEEEEL-LLLL


DSSP  ----LLLLLHHHHLLLLllllEEEEEL-----LLLL---HHHHHHHLlllEEEEELhHHH
Query ----EEYDLEDILNIGLkevkTIAAHC-----VHLP---ERYFGVLKdipFFVSHNpASN  256
ident           |              |              |         |         
Sbjct ipgsSTVTADDVIKTKP----DVVSHInggptAISVqevDRIMDETD---FAMEIV-QCG  249
DSSP  llllLLLLHHHHHHHLL----LEEELLlllllLLLHhhhHHHHHHLL---LEEEEE-LLL


DSSP  HhllLLLL--LHHHHHHLLL--EEEELLLLLL-LLLLLL-HHHHHHHHHHHHhlllllLL
Query LklgNGIA--PVQRXIEHGX--KVTLGTDGAA-SNNSLN-LFFEXRLASLLQkaqnprNL  310
ident       ||     |  | |    |  | |                               
Sbjct N---PKIAdyVARRAAEKGQlgRVIFGNDAPSgTGLIPLgILRNMCQIASMS------DI  300
DSSP  L---HHHHhhHHHHHHHHLLhhHEEEELLLLLlLLLLLLhHHHHHHHHHHHL------LL


DSSP  LHHHHHHHHLHHHHHHHLLLLLLLLLLLLLLEEEEELLLHHHLLhhHHHHHHH-HLLLlL
Query DVNTCLKXVTYDGAQAXGFKSGKIEEGWNADLVVIDLDLPEXFPvqNIKNHLV-HAFSgE  369
ident |        |       |   | |  |  |||   |  |                     
Sbjct DPEVAVCMATGNSTAVYGLNTGVIAPGKEADLIIMDTPLGSVAE--DAMGAIAaGDIP-G  357
DSSP  LHHHHHHHHLHHHHHHHLLLLLLLLLLLLLLEEEEELLLLLLLL--LHHHHHHhLLLL-E


DSSP  LLEEEELLEEEEELLLlllllhhhhhhhhhhhhhhhhl
Query VFATXVAGKWIYFDGEyptidseevkrelariekelys  407
ident        |                              
Sbjct ISVVLIDGEAVVTKSR----------ntppakraakil  385
DSSP  EEEEEELLEEEELLLL----------llllllllleel


No 15: Query=1j6pA Sbjct=1onxA Z-score=26.9

back to top
DSSP  -------LEEEEEEEEELlLLLLlLEEEEEEEELLEEEEEEELLLL------lLEELLLE
Query -------HHXIIGNCLILkDFSSePFWGAVEIENGTIKRVLQGEVK------vDLDLSGK   47
ident                              |   || |  |               |||| 
Sbjct midytaaGFTLLQGAHLY-APED-RGICDVLVANGKIIAVASNIPSdivpnctVVDLSGQ   58
DSSP  llllhhhLLEEEEEEEEE-LLLE-EEEEEEEEELLEEEEEELLLLLlllllleEEELLLL


DSSP  EEEELEEEEEELHHHhhhllllllllhhhhHHLLhHHHHllllhhhhhHHHHhhHHHHHL
Query LVXPALFNTHTHAPXtllrgvaedlsfeewLFSKvLPIEdrltekxayYGTIlaQXEXAR  107
ident    |     | |                                                
Sbjct ILCPGFIDQHVHLIG-------------ggGEAG-PTTR--------tPEVA--LSRLTE   94
DSSP  EEEELEEEEEELLLL-------------llLLLL-HHHL--------lLLLL--HHHHHH


DSSP  LLEEEEEEEE---------lLHHHHHHHHHHHLLEEEEEE-EELLlllllllHHHH---H
Query HGIAGFVDXY---------fHEEWIAKAVRDFGXRALLTR-GLVDsngddggRLEE---N  154
ident  |    |                    |    |  |                        
Sbjct AGVTSVVGLLgtdsisrhpeSLLAKTRALNEEGISAWMLTgAYHV------pSRTItgsV  148
DSSP  LLEEEEEELLllllllllhhHHHHHHHHHHHHLLEEEEEEeLLLL------lLLLLlllH


DSSP  HHHH-HHHLlhhhleEEEEEELLL---LLLLH-HHHHHHHHHHHHHL------LLEEEEE
Query LKLY-NEWNgfegriFVGFGPHSP---YLCSE-EYLKRVFDTAKSLN------APVTIHL  203
ident  |               |                 |                      | 
Sbjct EKDVaIIDR------VIGVXCAISdhrSAAPDvYHLANMAAESRVGGllggkpGVTVFHM  202
DSSP  HHHHhHLLL------EEEEEEEELlllLLLLLhHHHHHHHHHHHHHHhhhlllLEEEEEE


DSSP  LlllLLLLLLHHHHLLL----lLLLLEEEEELLLL--LHHH-HHHHLLLlEEEEELhHHH
Query YetsKEEYDLEDILNIG----lKEVKTIAAHCVHL--PERY-FGVLKDIpFFVSHNpASN  256
ident          |  |            |    |                           | 
Sbjct G---DSKKALQPIYDLLencdvPISKLLPTHVNRNvpLFEQaLEFARKG-GTIDIT-SSI  257
DSSP  L---LLLLLLHHHHHHHhllllLHHHEEEELHHHLhhHHHHhHHHHHLL-LLEEEE-LLL


DSSP  HhllLLLL---LHHHHHHLLL---EEEELLLLLLL--------------LLLLL-HHHHH
Query LklgNGIA---PVQRXIEHGX---KVTLGTDGAAS--------------NNSLN-LFFEX  295
ident        |      |    |     |||  ||  |                    |    
Sbjct D---EPVApaeGIARAVQAGIplaRVTLSSDGNGSqpffddegnlthigVAGFEtLLETV  314
DSSP  L---LLLLhhhHHHHHHHLLLlhhHEEEELLLLLEeeeellllleeeeeELLLHhHHHHH


DSSP  HHHHHHHhlllllLLLHHHHHHHHLHHHHHHHLL-LLLLLLLLLLLLEEEEELllhhhll
Query RLASLLQkaqnprNLDVNTCLKXVTYDGAQAXGF-KSGKIEEGWNADLVVIDLdlpexfp  354
ident                     |   |   |        | |  |  ||| |          
Sbjct QVLVKDY------DFSISDALRPLTSSVAGFLNLtGKGEILPGNDADLLVMTP-------  361
DSSP  HHHHHHH------LLLHHHHHHHHLHHHHHHLLLlLLLLLLLLLLLLEEEELL-------


DSSP  hhhhhhhhhhllllLLLEEEELLEEEEELLLLLLLlhHHHHhhhhhhhhhhhl
Query vqniknhlvhafsgEVFATXVAGKWIYFDGEYPTIdsEEVKrelariekelys  407
ident                       ||    ||                       
Sbjct ------------elRIEQVYARGKLMVKDGKACVK-gTFET-----------d  390
DSSP  ------------llLEEEEEELLEEEEELLEELLL-lLLLL-----------l


No 16: Query=1j6pA Sbjct=3nqbA Z-score=26.5

back to top
DSSP  -----------------------lEEEEEEEEELLLLLLLLEEEEEEEELLEEEEEEELL
Query -----------------------hHXIIGNCLILKDFSSEPFWGAVEIENGTIKRVLQGE   37
ident                            |           |       |    |  |    
Sbjct epadlnddtlraravaaargdqrfDVLITGGTLVDVVTGELRPADIGIVGALIASVHEPA   60
DSSP  llhhhllhhhhhhhhhhhhlllleEEEEELLEEELLLLLLEEELEEEEELLEEEEEELLL


DSSP  LLL----LEELLLEEEEELEEEEEELHHHHHhllllllllhhhhhhllhhhhhllllhhh
Query VKV----DLDLSGKLVXPALFNTHTHAPXTLlrgvaedlsfeewlfskvlpiedrltekx   93
ident          |  |  | | |  || |                                  
Sbjct SRRdaaqVIDAGGAYVSPGLIDTHXHIESSX-----------------------------   91
DSSP  LLLleeeEEELLLLEEEELEEEEEELHHHHL-----------------------------


DSSP  hhHHHHHHHHHHHLLLEEEEEEEEL---------LHHHHHHHHHHHLLEEEEEEEEL--L
Query ayYGTILAQXEXARHGIAGFVDXYF---------HEEWIAKAVRDFGXRALLTRGLV--D  142
ident                |    |                | |||      || |        
Sbjct --ITPAAYAAAVVARGVTTIVWDPHefgnvhgvdGVRWAAKAIENLPLRAILLAPSCvpS  149
DSSP  --LLHHHHHHHHHLLLEEEEEELLHhhhhhhlhhHHHHHHHHHLLLLLEEEEEELLLllL


DSSP  LLL---llLLHH-HHHHHHHHHHLlhhhleEEEEEELLllLLLH-----HHHHHHHHHHH
Query SNG---ddGGRL-EENLKLYNEWNgfegriFVGFGPHSpyLCSE-----EYLKRVFDTAK  193
ident   |               |             |                           
Sbjct APGlerggADFDaAILADLLSWPE------IGGIAEIX--NXRGvierdPRXSGIVQAGL  201
DSSP  LLLlllllLLLLhHHHHHHHLLLL------EEEEEEEL--LHHHhhlllHHHHHHHHHHH


DSSP  HHLLLEEEEELllllLLLL--LHHHHLLLLllllEEEEELlLLLHhHHHHHLLLLEEEEE
Query SLNAPVTIHLYetskEEYD--LEDILNIGLkevkTIAAHCvHLPErYFGVLKDIPFFVSH  251
ident      |  |            |      |               |               
Sbjct AAEKLVCGHAR----GLKNadLNAFXAAGV----SSDHEL-VSGE-DLXAKLRAGLTIEL  251
DSSP  HHLLEEEELLL----LLLHhhHHHHHHLLL----LEELLL-LLHH-HHHHHHHLLLEEEE


DSSP  LhHHHHhlllLLLL-HHHHHHLL----lEEEELLLLLLLLLL---LLHHHHHHHHHHHHh
Query NpASNLklgnGIAP-VQRXIEHG----xKVTLGTDGAASNNS---LNLFFEXRLASLLQk  303
ident    |         |               ||| ||            |    |       
Sbjct R-GSHD----HLLPeFVAALNTLghlpqTVTLCTDDVFPDDLlqgGGLDDVVRRLVRYG-  305
DSSP  E-LLLH----HHHHhHHHHHHHHlllllLEEEELLLLLHHHHhhlLLHHHHHHHHHHLL-


DSSP  llllllLLHHHHHHHHLHHHHHHHLL-LLLLLLLLLLLLEEEEElllhhhllhhhhhhHH
Query aqnprnLDVNTCLKXVTYDGAQAXGF-KSGKIEEGWNADLVVIDldlpexfpvqniknHL  362
ident       |     |   |   ||  |    | |  |  || ||                 |
Sbjct ------LKPEWALRAATLNAAQRLGRsDLGLIAAGRRADIVVFE--------------DL  345
DSSP  ------LLHHHHHHHHLHHHHHHHLLlLLLLLLLLLLLLEEEEL--------------LL


DSSP  HHlllLLLLEEEELLEEEEELLLLLLLLHhhHHHH-------------------------
Query VHafsGEVFATXVAGKWIYFDGEYPTIDSeeVKRE-------------------------  397
ident               |      |                                      
Sbjct NG---FSARHVLASGRAVAEGGRXLVDIP--TCDTtvlkgsxklplrxandflvksqgak  400
DSSP  LL---LLEEEEEELLEEEEELLEELLLLL--LLLLhhhllllllllllhhhhllllllle


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  397
ident                                                             
Sbjct vrlatidrprftqwgeteadvkdgfvvppegatxisvthrhgxaepttktgfltgwgrwn  460
DSSP  eeeeeeellllleeeeeeeeeelleellllleeeeeeellllllllleeeeeeellllll


DSSP  -----------------------------hhhhhHHHHL---------------------
Query -----------------------------larieKELYS---------------------  407
ident                                                             
Sbjct gafattvshdshnltvfggnagdxalaanavigtGGGXAvasegkvtailplplsglvsd  520
DSSP  leeeelllllllleeeeellhhhhhhhhhhhhhlLLEEEeeelleeeeeeelllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  407
ident                                                             
Sbjct apleevarafedlreavgkvvewqppylvfkacfgatlacnigphqtdxgiadvltgkvx  580
DSSP  llhhhhhhhhhhhhhhhhhhlllllllllhhhhhlllllllllleelllleeelllleee


DSSP  -------
Query -------  407
ident        
Sbjct espviev  587
DSSP  llleeel


No 17: Query=1j6pA Sbjct=3ooqA Z-score=24.2

back to top
DSSP  lEEEEEEEEELLLlLLLLEEEEEEEELLEEEEEEELLLL---lLEELLLEEEEELEEEEE
Query hHXIIGNCLILKDfSSEPFWGAVEIENGTIKRVLQGEVK---vDLDLSGKLVXPALFNTH   57
ident       |        | || | |   ||    |            || ||   |     |
Sbjct -KILFKNATVFPI-TSRPFKGDVLVSNGKVEKVGENIEDpdaeIVDLTGKFLFPGFVDAH   58
DSSP  -LEEEEEEEELLL-LLLLEEEEEEEELLEEEEEELLLLLllleEEELLLLEEEELEEEEE


DSSP  ELHHHHHHLLLlllllhhhhhhllhHHHH------------llllhhhHHHHhhHHHHHH
Query THAPXTLLRGVaedlsfeewlfskvLPIE------------drltekxAYYGtiLAQXEX  105
ident  |                                                     |    
Sbjct SHIGLFEEGVG--------------YYYSdgneatdpvtphvkaldgfNPQD--PAIERA  102
DSSP  ELLLLLLLLLL--------------HHHLllllllllllllllhhhhlLLLL--HHHHHH


DSSP  HLLLEEEEEEEE-----------llhhhhhHHHHHhlleeeeeeeelllllllllhhhhh
Query ARHGIAGFVDXY-----------fheewiaKAVRDfgxralltrglvdsngddggrleen  154
ident    |                                                        
Sbjct LAGGVTSVXIVPgsanpvggqgsvikfrsiIVEEC-------------------------  137
DSSP  HLLLEEEEEELLllllleeeeeeeeellllLHHHH-------------------------


DSSP  hhhhhhhllhhHLEE-EEEEElLLLL-----------------lLHHHHHH---------
Query lklynewngfeGRIF-VGFGPhSPYL-----------------cSEEYLKR---------  187
ident                  |                                          
Sbjct -----------IVKDpAGLKX-AFGEnpkrvygerkqtpstrxgTAGVIRDyftkvknyx  185
DSSP  -----------EEEEeEEEEE-ELLHhhhhhhhhlllllllhhhHHHHHHHhhhhhhhhh


DSSP  ---------------------hhHHHHHHLLLEEEEELllllLLLLLHHHHLLL-llLLL
Query ---------------------vfDTAKSLNAPVTIHLYetskEEYDLEDILNIG-lkEVK  225
ident                                |   |         |      |       
Sbjct kkkelaqkegkeftetdlkxevgEXVLRKKIPARXHAH----RADDILTAIRIAeefGFN  241
DSSP  hhhhhhhhlllllllllhhhhhhHHHHLLLLLEEEEEL----LHHHHHHHHHHHhhhLLL


DSSP  EEEEELLLLLHhHHHHHLLLLEEEE-ELHHhhHHLL-----LLLL-LHHHHHHLLLEEEE
Query TIAAHCVHLPErYFGVLKDIPFFVS-HNPAsnLKLG-----NGIA-PVQRXIEHGXKVTL  278
ident     |          ||      |                              |    |
Sbjct LVIEHGTEAYK-ISKVLAEKKIPVVvGPLL--TFRTklelkDLTXeTIAKLLKDGVLIAL  298
DSSP  EEEEELLLHHH-HHHHHHHHLLLEEeLLLL--LLLLlhhhlLLLLlHHHHHHHLLLLEEE


DSSP  LLLLLllLLLL-LHHHHHHHhHHHHhlllllLLLHHHHHHHHLHHHHHHHLL--LLLLLL
Query GTDGAasNNSL-NLFFEXRLaSLLQkaqnprNLDVNTCLKXVTYDGAQAXGF--KSGKIE  335
ident   |       |                           ||  |   |   |     | ||
Sbjct XCDHP--VIPLeFATVQAAT-AXRY------GAKEEDLLKILTVNPAKILGLedRIGSIE  349
DSSP  LLLLL--LLLHhHHHHHHHH-HHHH------LLLHHHHHHLLLHHHHHHLLLllLLLLLL


DSSP  LLLLLLEEEEELllhhhllhhhhhhHHHHLLLlLLLEEEELLEEEEELLllllllhhhhh
Query EGWNADLVVIDLdlpexfpvqniknHLVHAFSgEVFATXVAGKWIYFDGeyptidseevk  395
ident  |  |||||                |     |  |      |                  
Sbjct PGKDADLVVWSG-------------HPFDXKS-VVERVYIDGVEVFRRE-----------  384
DSSP  LLLLLLEEEELL-------------LLLLLLL-LEEEEEELLEEEEELL-----------


DSSP  hhhhhhhhhhhl
Query relariekelys  407
ident             
Sbjct ------------  384
DSSP  ------------


No 18: Query=1j6pA Sbjct=1yrrB Z-score=24.0

back to top
DSSP  leEEEEEEEELLLlLLLLEEEEEEEELLEEEEEEELLLL----LLEELLLEEEEELEEEE
Query hhXIIGNCLILKDfSSEPFWGAVEIENGTIKRVLQGEVK----VDLDLSGKLVXPALFNT   56
ident          |           || |  | || |              | |    |     
Sbjct --YALTQGRIFTG-HEFLDDHAVVIADGLIKSVCPVAELppeiEQRSLNGAILSPGFIDV   57
DSSP  --LEEELLEEELL-LLEELLEEEEEELLEEEEEEEHHHLllllLEEELLLLEEEELEEEE


DSSP  EELHhHHHHllllllllhhhhhhllhhhhHLLLLhhHHHHHHHHHHHHHHLLLEEEEEEE
Query HTHApXTLLrgvaedlsfeewlfskvlpiEDRLTekXAYYGTILAQXEXARHGIAGFVDX  116
ident                                              |      |       
Sbjct QLNG-CGGV-----------------qfnDTAEA--VSVETLEIMQKANEKSGCTNYLPT   97
DSSP  EELE-ELLE-----------------ellLLLLL--LLHHHHHHHHHHHHLLLEEEEEEE


DSSP  EL---------LHHHHHHHHHHHLLE-EEEEEEELLlllllLLHHHHHHHHHHhhllhhh
Query YF---------HEEWIAKAVRDFGXR-ALLTRGLVDsngddGGRLEENLKLYNewngfeg  166
ident                              |                              
Sbjct LIttsdelmkqGVRVMREYLAKHPNQaLGLHLEGPW---lnAALVDFLCENAD-------  147
DSSP  ELlllhhhhhhHHHHHHHHHHHLLLLlLLEEEELLL---llLHHHHHHHHLHH-------


DSSP  leEEEEEELLLllLLHHhhHHHHHHHHHHLLLEEEEEllllllLLLLHHHHlLLLL-LLL
Query riFVGFGPHSPylCSEEylKRVFDTAKSLNAPVTIHLyetskeEYDLEDILnIGLK-EVK  225
ident           |          |          |             |      |      
Sbjct --VITKVTLAP--EMVP--AEVISKLANAGIVVSAGH-----sNATLKEAK-AGFRaGIT  195
DSSP  --HEEEEEELH--HHLL--HHHHHHHHHHLLEEEELL-----lLLLHHHHH-HHHHhLEE


DSSP  EeEEELL--LLLH--------HHHHHHLllLEEEEELHHhHHHLllLLLLHHHHHHLLL-
Query TiAAHCV--HLPE--------RYFGVLKdiPFFVSHNPAsNLKLgnGIAPVQRXIEHGX-  274
ident   | |                                    |      |           
Sbjct F-ATHLYnaMPYItgrepglaGAILDEA--DIYCGIIAD-GLHV--DYANIRNAKRLKGd  249
DSSP  E-ELLLLllLLLLlllllhhhHHHHHLL--LLEEEEELL-LLLL--LHHHHHHHHHHHHh


DSSP  EEEELLLLLLLLLLlLHHHHHHHHHHHHhlllllLLLHHHHHHHHLHHHHHHHLL--LLL
Query KVTLGTDGAASNNSlNLFFEXRLASLLQkaqnprNLDVNTCLKXVTYDGAQAXGF--KSG  332
ident |  | ||              |                   |   |   | | |     |
Sbjct KLCLVTDATSGSSL-TMIEGVRNLVEHC------GIALDEVLRMATLYPARAIGVekRLG  302
DSSP  HEEEELLLLLLLLL-LHHHHHHHHHHHH------LLLHHHHHHHHLHHHHHHLLLllLLL


DSSP  LLLLLLLLLEEEEElllhhhllhhhhhhhhhhlLLLLLLEEEELLEEEEELlllllllhh
Query KIEEGWNADLVVIDldlpexfpvqniknhlvhaFSGEVFATXVAGKWIYFDgeyptidse  392
ident     |  | |                              | | |               
Sbjct TLAAGKVANLTAFT-------------------PDFKITKTIVNGNEVVTQ---------  334
DSSP  LLLLLLLLLEEEEL-------------------LLLLEEEEEELLEEEEEL---------


DSSP  hhhhhhhhhhhhhhl
Query evkrelariekelys  407
ident                
Sbjct ---------------  334
DSSP  ---------------


No 19: Query=1j6pA Sbjct=3giqA Z-score=23.7

back to top
DSSP  --LEEEEEEEEELLLLLLLLEEEEEEEELLEEEEEEElLLLL----LEELLLEEEEELEE
Query --HHXIIGNCLILKDFSSEPFWGAVEIENGTIKRVLQgEVKV----DLDLSGKLVXPALF   54
ident       |    |                 | |                | ||| | |   
Sbjct ekLDFKITGGWIIDGTGAPRRRADLGVRDGRIAAIGE-LGAHparhAWDASGKIVAPGFI   59
DSSP  llEEEEEELLEELLLLLLLLEELEEEEELLEEEEEEL-LLLLleeeEEELLLLEEEELEE


DSSP  EEEELHHhhhhllllllllhhhhhhllhhhhhllllhhhhhhHHHH---hHHHHHLLLEE
Query NTHTHAPxtllrgvaedlsfeewlfskvlpiedrltekxayyGTIL---aQXEXARHGIA  111
ident   | |                                                    || 
Sbjct DVHGHDD-----------------------------------LMFVekpdLRWKTSQGIT   84
DSSP  ELLLLLL-----------------------------------LHHHhlllLHHHHLLLEE


DSSP  EEEEE----ELLH-----------------------HHHHHHHH--HHLLEEEEEEEEL-
Query GFVDX----YFHE-----------------------EWIAKAVR--DFGXRALLTRGLV-  141
ident   |                                      |              |   
Sbjct TVVVGncgvSAAPaplpgntaaalallgetplfadvPAYFAALDaqRPMINVAALVGHAn  144
DSSP  EEEELllllLLLLllllllllhhhhhhllllllllhHHHHHHHHhlLLLLEEEEEEEHHh


DSSP  --------lLLLL----LLLHHHHHHHHHHHHLlhhhleeEEEEElLLLL-----LLHHH
Query --------dSNGD----DGGRLEENLKLYNEWNgfegrifVGFGPhSPYL-----CSEEY  184
ident                                         |||                 
Sbjct lrlaamrdpQAAPtaaeQQAMQDMLQAALEAGA-------VGFST-GLAYqpgavAQAAE  196
DSSP  hhhhhllllLLLLlhhhHHHHHHHHHHHHHHLL-------LEEEE-ELLLllhhhLLHHH


DSSP  HHHHHHHHHHHLLLEEEEELLLLLLLLL-LHHHHlLLLL--LLLEEEEELLL-------l
Query LKRVFDTAKSLNAPVTIHLYETSKEEYD-LEDILnIGLK--EVKTIAAHCVH-------l  234
ident |      |       | |            |  |          |   |           
Sbjct LEGLARVAAERRRLHTSHIRNEADGVEAaVEEVL-AIGRgtGCATVVSHHKCmmpqnwgr  255
DSSP  HHHHHHHHHHLLLEEEEELLLLLLLHHHhHHHHH-HHHHhhLLEEEELLLLLllhhhlll


DSSP  LHHHHHHHLL-----LLEEEEELHHhHHHL------------------------------
Query PERYFGVLKD-----IPFFVSHNPAsNLKL------------------------------  259
ident                        |                                    
Sbjct SRATLANIDRareqgVEVALDIYPY-PGSStiliperaetiddiritwstphpecsgeyl  314
DSSP  HHHHHHHHHHhhhllLLEEEEELLL-LEEEeellhhhllllllleeeeelllhhhllllh


DSSP  --------------------------LLLL---LLHHHHHhlllEEEELLLLL-----LL
Query --------------------------GNGI---APVQRXIehgxKVTLGTDGA-----AS  285
ident                                                 | ||        
Sbjct adiaarwgcdkttaarrlapagaiyfAMDEdevKRIFQHP----CCMVGSDGLpndarPH  370
DSSP  hhhhhhhlllhhhhhhhhlleeeeeeLLLHhhhHHHHHLL----LEEELLLLLlllllLL


DSSP  LLLLLHHHHHH-HHHHHHHlllllLLLHHHHHHHHLHHHHHHHLL-LLLLLLLLLLLLEE
Query NNSLNLFFEXR-LASLLQKaqnprNLDVNTCLKXVTYDGAQAXGF-KSGKIEEGWNADLV  343
ident       |                            |   |   ||   |    |  || |
Sbjct PRLWGSFTRVLgRYVREAR-----LMTLEQAVARMTALPARVFGFaERGVLQPGAWADVV  425
DSSP  LHHHHHHHHHHhHHHHHLL-----LLLHHHHHHHHLHHHHHHHLLlLLLLLLLLLLLLEE


DSSP  EEElllhhhllhhhhhhhhhHLLL------------LLLLEEEELLEEEEEllLLLLLLh
Query VIDldlpexfpvqniknhlvHAFS------------GEVFATXVAGKWIYFdgEYPTIDs  391
ident | |                                        | |         |    
Sbjct VFD----------------pDTVAdratwdeptlasVGIAGVLVNGAEVFP--QPPADG-  466
DSSP  EEL----------------lLLLLllllllllllllLLEEEEEELLEEEEL--LLLLLL-


DSSP  hhhhhhhhhhhhhhhl
Query eevkrelariekelys  407
ident                 
Sbjct -------rpgqvlrax  475
DSSP  -------lllllllll


No 20: Query=1j6pA Sbjct=2ogjA Z-score=23.6

back to top
DSSP  -LEEEEEeEEELLLLL--LLLEEEEEEEE-LLEEEEEEeLLLL----lLEELLlEEEEEL
Query -HHXIIGnCLILKDFS--SEPFWGAVEIE-NGTIKRVLqGEVK----vDLDLSgKLVXPA   52
ident               |            |   | |  |                     | 
Sbjct qAPILLT-NVKPVGFGkgASQSSTDILIGgDGKIAAVG-SALQapadtQRIDA-AFISPG   57
DSSP  lLLEEEE-EEEELLLLllLLLLLEEEEELlLLLEEEEE-LLLLlllleEELLL-LEEEEL


DSSP  EEEEEELHHHhhhllllllllhhhhhhllhhhhhllllhhHHHHhhhHHHHH-HHLLLEE
Query LFNTHTHAPXtllrgvaedlsfeewlfskvlpiedrltekXAYYgtiLAQXE-XARHGIA  111
ident     | |                                            |  |  |  
Sbjct WVDLHVHIWH------------------------------GGTD-isIRPSEcGAERGVT   86
DSSP  EEEEEELLLL------------------------------LLLL-llLLHHHlLHHHLEE


DSSP  EEE-EEEL---LHHHHHH-HHHHHLLEEEEEEEEL------------LLLLLLLLhHHHH
Query GFV-DXYF---HEEWIAK-AVRDFGXRALLTRGLV------------DSNGDDGGrLEEN  154
ident   |                       |      |                  |   |   
Sbjct TLVdAGSAgeaNFHGFREyIIEPSRERIKAFLNLGsiglvacnrvpeLRDIKDID-LDRI  145
DSSP  EEEeELLLlllLHHHHHHhLLLLLLLEEEEEEELLllllllllllllLLLHHHLL-HHHH


DSSP  HHHHHHHLLhhhlEEEEEEELLL-LLLL---HHHHHHHHHHHHHHLLLEEEEELlllLLL
Query LKLYNEWNGfegrIFVGFGPHSP-YLCS---EEYLKRVFDTAKSLNAPVTIHLYetsKEE  210
ident |  | |         ||                  |     || |  |   |        
Sbjct LECYAENSE----HIVGLXVRAShVITGswgVTPVKLGKKIAKILKVPXXVHVG---EPP  198
DSSP  HHHHHLLLL----LEEEEEEEELhHHHLlllLHHHHHHHHHHHHHLLLEEEEEL---LLL


DSSP  LLLHHHHLlLLLLlLEEEEELL-----LLLH---HHHHHHLL-LLEEEEELHHHhhhllL
Query YDLEDILNiGLKEvKTIAAHCV-----HLPE---RYFGVLKD-IPFFVSHNPASnlklgN  261
ident       |   |        ||               |                       
Sbjct ALYDEVLE-ILGP-GDVVTHCFngksgSSIXedeDLFNLAERcEGIRLDIGHGG-----A  251
DSSP  LLHHHHHH-HLLL-LLEEELLLlllllLLLLllhHHHHHHHHlLLLEEELLLLL-----L


DSSP  LLL--LHHHHH-HLLLEEEELLLLLLLLL---LLLHHHHHHHHHHHhhlllllLLLHHHH
Query GIA--PVQRXI-EHGXKVTLGTDGAASNN---SLNLFFEXRLASLLqkaqnprNLDVNTC  315
ident           |          ||            |   |                    
Sbjct SFSfkVAEAAIaRGLLPFSISTDLHGHSXnfpVWDLATTXSKLLSV-------DXPFENV  304
DSSP  LLLhhHHHHHHhLLLLLLLLLLLLLLLLLlllLLLHHHHHHHHHHL-------LLLHHHH


DSSP  HHHHLHHHHHHHLLLL-lLLLLLLLLLEEEEElLLHH-hllhhhhhhhhhHLLLLLLLEE
Query LKXVTYDGAQAXGFKS-gKIEEGWNADLVVIDlDLPE-xfpvqniknhlvHAFSGEVFAT  373
ident    ||   |             |  ||  | |                       |    
Sbjct VEAVTRNPASVIRLDXenRLDVGQRADFTVFD-LVDAdleatdsngdvsrLKRLFEPRYA  363
DSSP  HHLLLHHHHHHLLLLLllLLLLLLLLEEEEEE-EEEEeeeeellllleeeEEEEEEEEEE


DSSP  EELLEEeEELLllllllhhhhhhhhhhhhhhhhl
Query XVAGKWiYFDGeyptidseevkrelariekelys  407
ident                                   
Sbjct VIGAEA-IAAS-----------------ryipra  379
DSSP  EELLEE-EELL-----------------llllll


No 21: Query=1j6pA Sbjct=1gkpA Z-score=22.9

back to top
DSSP  lEEEEEEEEELlLLLLlLEEEEEEEELLEEEEEEElLLLL-----LEELLLEEEEELEEE
Query hHXIIGNCLILkDFSSePFWGAVEIENGTIKRVLQgEVKV-----DLDLSGKLVXPALFN   55
ident     | |  |     |         |  || |  |            |  || | |    
Sbjct -PLLIKNGEII-TADS-RYKADIYAEGETITRIGQ-NLEAppgteVIDATGKYVFPGFID   56
DSSP  -LEEEELLEEE-ELLE-EEELEEEELLLLLLEEEL-LLLLlllleEEELLLLEEEELEEE


DSSP  EEELHHHhhhllllllllhhhhhhllHHHHHllllhhhhhHHHHHHHHHHHLLLEEEEEE
Query THTHAPXtllrgvaedlsfeewlfskVLPIEdrltekxayYGTILAQXEXARHGIAGFVD  115
ident  | |                                                 |      
Sbjct PHVHIYL------------------pFMATF-------akDTHETGSKAALMGGTTTYIE   91
DSSP  EEELLLL------------------eELLEE-------llLLHHHHHHHHHHLLEEEEEE


DSSP  EEL---------LHHHHHHHHHH-HLLEEEEEEEELLllllLLLHHHHHHHHHHHHLlhh
Query XYF---------HEEWIAKAVRD-FGXRALLTRGLVDsngdDGGRLEENLKLYNEWNgfe  165
ident                                          |                  
Sbjct MCCpsrnddaleGYQLWKSKAEGnSYCDYTFHMAVSK---fDEKTEGQLREIVADGI---  145
DSSP  EELllllllhhhHHHHHHHHHLLlLLLEEEEEEELLL---lLLLHHHHHHHHHHLLL---


DSSP  hleeEEEEeLLLL-----LLLHHHHHHHHHHHHHHLLLEEEEEL----------------
Query grifVGFGpHSPY-----LCSEEYLKRVFDTAKSLNAPVTIHLY----------------  204
ident       |                        || |   || |                  
Sbjct ----SSFX-IFLSyknffGVDDGEMYQTLRLAKELGVIVTAHCEnaelvgrlqqkllseg  200
DSSP  ----LEEE-EEELlllllLLLHHHHHHHHHHHHHHLLEEEEEELlhhhhhhhhhhhhhll


DSSP  --------llLLLL---LLLHHHHlLLLL--LLLEEEEELLL--LLHHHHHHHL-LLLEE
Query --------etSKEE---YDLEDILnIGLK--EVKTIAAHCVH--LPERYFGVLK-DIPFF  248
ident             |              |          |                  |  
Sbjct ktgpewhepsRPEAveaEGTARFA-TFLEttGATGYVVHLSCkpALDAAMAAKArGVPIY  259
DSSP  lllhhhllllLLHHhhhHHHHHHH-HHHHhhLLEEEELLLLLhhHHHHHHHHHHlLLLEE


DSSP  EEELHHHHHH-------------------LLLL---LLLHHHHHHLLLEEEELLLLLL--
Query VSHNPASNLK-------------------LGNG---IAPVQRXIEHGXKVTLGTDGAA--  284
ident         |                                     |   | |||     
Sbjct IESVIPHFLLdktyaerggveamkyimspPLRDkrnQKVLWDALAQGFIDTVGTDHCPfd  319
DSSP  EEEEHHHHHLlhhhhhllhhhhhllllllLLLLlhhHHHHHHHHHLLLLLEEELLLLLll


DSSP  ----------------LLLLL-LHHHHHHHHHhhhhlllllLLLHHHHHHHHLHHHHHHH
Query ----------------SNNSL-NLFFEXRLASllqkaqnprNLDVNTCLKXVTYDGAQAX  327
ident                                           ||            |   
Sbjct teqkllgkeaftaipnGIPAIeDRVNLLYTYG-----vsrgRLDIHRFVDAASTKAAKLF  374
DSSP  hhhhhhhlllhhhlllLLLLLlLHHHHHHHHH-----llllLLLHHHHHHHHLHHHHHHL


DSSP  LL--LLLLLLLLLLLLEEEEELLLHH-------hllhhhhhhhhhHLLLlLLLEEEELLE
Query GF--KSGKIEEGWNADLVVIDLDLPE-------xfpvqniknhlvHAFSgEVFATXVAGK  378
ident |     | |  |  ||||| |                                   | ||
Sbjct GLfpRKGTIAVGSDADLVVYDPQYRGtisvktqhvnndyngfegfEIDG-RPSVVTVRGK  433
DSSP  LLllLLLLLLLLLLLLEEEEELLLLEellhhhlllllllllllllEELL-EEEEEEELLE


DSSP  EEEEL-LLLLLLlhhhhhhhhhhhhhhhhl
Query WIYFD-GEYPTIdseevkrelariekelys  407
ident     |                         
Sbjct VAVRDgQFVGEK-----gwgkllrrepmyf  458
DSSP  EEEELlEELLLL-----lllllllllllll


No 22: Query=1j6pA Sbjct=3griA Z-score=22.7

back to top
DSSP  lEEEEEEEEELlllLLLLEEEEEEEELLEEEEEEeLLLL-----lLEELLLEEEEELEEE
Query hHXIIGNCLILkdfSSEPFWGAVEIENGTIKRVLqGEVK-----vDLDLSGKLVXPALFN   55
ident     | |   |     |       |    ||                |  |  | |    
Sbjct -XKLIKNGKVL--qNGELQQADILIDGKVIKQIA-PAIEpsngvdIIDAKGHFVSPGFVD   56
DSSP  -LEEEELLEEE--eLLEEEELEEEEELLEEEEEE-LLLLllllleEEELLLLEEEELEEE


DSSP  EEELHH--hHHHLlllllllhhhhhhllhhhhhllllhhhhhhHHHHHHHHHHLLLEEEE
Query THTHAP--xTLLRgvaedlsfeewlfskvlpiedrltekxayyGTILAQXEXARHGIAGF  113
ident  | |                                                || |    
Sbjct VHVHLRepgGEYK-----------------------------eTIETGTKAAARGGFTTV   87
DSSP  EEELLLlllLLLL-----------------------------lLHHHHHHHHHHLLEEEE


DSSP  EEEEL---------LHHHHHHHHHH-HLLEEEEEEEE---LLLLllllLHHHhHHHHHHH
Query VDXYF---------HEEWIAKAVRD-FGXRALLTRGL---VDSNgddgGRLEeNLKLYNE  160
ident   |           | |   |   |    | |                        |  |
Sbjct CPXPNtrpvpdsveHFEALQKLIDDnAQVRVLPYASIttrQLGK----ELVD-FPALVKE  142
DSSP  EELLLlllllllhhHHHHHHHHHHHhLLLEELLLEELlhhHLLL----LLLL-HHHHHLL


DSSP  HLlhhhleeEEEEELLlLLLL-HHHHHHHHHHHHHHLLLEEEEEL---------------
Query WNgfegrifVGFGPHSpYLCS-EEYLKRVFDTAKSLNAPVTIHLY---------------  204
ident            |                    |   |     |                 
Sbjct GA-------FAFTDDG-VGVQtASXXYEGXIEAAKVNKAIVAHCEdnsliyggaxhegkr  194
DSSP  LL-------LLEEELL-LLLLlHHHHHHHHHHHHHHLLLEEELLLlhhhllllleellhh


DSSP  --------llLLLL-LLLHHHHLLLL-lLLLEEEEELLL--LLHHHHHHHL-LLLEEEEE
Query --------etSKEE-YDLEDILNIGL-kEVKTIAAHCVH--LPERYFGVLK-DIPFFVSH  251
ident              |                     |                 |      
Sbjct skelgipgipNICEsVQIARDVLLAEaaGCHYHVCHVSTkeSVRVIRDAKRaGIHVTAEV  254
DSSP  hhhhllleelLHHHhHHHHHHHHHHHhhLLLEEELLLLLhhHHHHHHHHHHlLLLEEEEE


DSSP  LHH--------------hhHHLLLLL-----lLHHHHHHLLLEEEELLLLLL--------
Query NPA--------------snLKLGNGI-----aPVQRXIEHGXKVTLGTDGAA--------  284
ident  |                                      |      || |         
Sbjct TPHhlllteddipgnnaiyKXNPPLRstedreALLEGLLDGTIDCIATDHAPhardekaq  314
DSSP  LHHhhhllhhhlllllhhhLLLLLLLlhhhhhHHHHHHHLLLLLEELLLLLLllhhhhll


DSSP  -------LLLLLL-HHHHHHhhhhhhhllllLLLLHHHHHHHHLHHHHHHHLLLLLLLLL
Query -------SNNSLN-LFFEXRlasllqkaqnpRNLDVNTCLKXVTYDGAQAXGFKSGKIEE  336
ident                |                           |           |   |
Sbjct pxekapfGIVGSEtAFPLLY-----thfvknGDWTLQQLVDYLTIKPCETFNLEYGTLKE  369
DSSP  lllllllLLLLLLlHHHHHH-----hhhlllLLLLHHHHHHHHLHHHHHHLLLLLLLLLL


DSSP  LLLLLEEEEELLLHH-------hllhhhhhhhhhHLLLlLLLEEEELLEEEEELllllll
Query GWNADLVVIDLDLPE-------xfpvqniknhlvHAFSgEVFATXVAGKWIYFDgeypti  389
ident    |||  ||||                               ||| |            
Sbjct NGYADLTIIDLDSEQeikgedflskadntpfigyKVYG-NPILTXVEGEVKFEG------  422
DSSP  LLLLLEEEEELLLLEellhhhlllllllllllllEELL-EEEEEEELLEEEEEL------


DSSP  lhhhhhhhhhhhhhhhhl
Query dseevkrelariekelys  407
ident                   
Sbjct ------------------  422
DSSP  ------------------


No 23: Query=1j6pA Sbjct=3e74A Z-score=22.2

back to top
DSSP  -LEEEEEEEEELLLllLLLEEEEEEEELLEEEEEEeLLLL---lLEELLLEEEEELEEEE
Query -HHXIIGNCLILKDfsSEPFWGAVEIENGTIKRVLqGEVK---vDLDLSGKLVXPALFNT   56
ident     || |         |          | |               | ||  | |     
Sbjct sFDLIIKNGTVILE--NEARVVDIAVKGGKIAAIG-QDLGdakeVXDASGLVVSPGXVDA   57
DSSP  lEEEEEELLEEELL--LLEEELEEEEELLEEEEEE-LLLLleeeEEELLLLEEEELEEEE


DSSP  EELHhhhhhllllllllhhhhhhllhhhhhllllhhhhhhHHHHHHHHHHLLLEEEEEEE
Query HTHApxtllrgvaedlsfeewlfskvlpiedrltekxayyGTILAQXEXARHGIAGFVDX  116
ident |||                                     |        |  ||     |
Sbjct HTHI------------------------------------GYETGTRAAAKGGITTXIEX   81
DSSP  EELL------------------------------------LHHHHHHHHHHLLEEEEEEL


DSSP  EL----------LHHHHHH-hhhHHLLEEEEEEEELLllllllLHHHHHHHHHHHHllhh
Query YF----------HEEWIAK-avrDFGXRALLTRGLVDsngddgGRLEENLKLYNEWngfe  165
ident               |             |    |||               |        
Sbjct PLnqlpatvdraSIELKFDaakgKLTIDAAQLGGLVS------YNIDRLHELDEVG----  131
DSSP  LLllllllllhhHHHHHHHhhllLLLLEEEELEELLL------LLLLLHHHHHHHL----


DSSP  hleEEEEEElLLLLLLHHHHHHHHHHHHHHLLLEEEEEL---------------------
Query griFVGFGPhSPYLCSEEYLKRVFDTAKSLNAPVTIHLY---------------------  204
ident     |||                      |  ||  |                       
Sbjct ---VVGFXC-FVRDVNDWQFFKGAQKLGELGQPVLVHCEnalicdelgeeakregrvtah  187
DSSP  ---LLLEEE-ELLLLLHHHHHHHHHHHHHHLLLEEEELLlhhhhhhhhhhhhhhllllhh


DSSP  ---llLLLL---LLLHHHHLLLL-lLLLEEEEELLL--LLHHHHHHHL-LLLEEEEELHH
Query ---etSKEE---YDLEDILNIGL-kEVKTIAAHCVH--LPERYFGVLK-DIPFFVSHNPA  254
ident                   |             |       |                 | 
Sbjct dyvasRPVFtevEAIRRVLYLAKvaGCRLHVCHVSSpeGVEEVTRARQeGQDITCESCPH  247
DSSP  hhhhlLLHHhhhHHHHHHHHHHHhhLLLEEELLLLLhhHHHHHHHHHHlLLLEEEEELLH


DSSP  --------------hhHHLLLLL-----lLHHHHHHLLLEEEELLLLLL-----------
Query --------------snLKLGNGI-----aPVQRXIEHGXKVTLGTDGAA-----------  284
ident                                      |    |  |              
Sbjct yfvldtdqfeeigtlaKCSPPIRdlenqkGXWEKLFNGEIDCLVSDHSPcppexkagnix  307
DSSP  hhhllhhhhhhhlhhhLLLLLLLlhhhhhHHHHHHHLLLLLEELLLLLLlllllllllll


DSSP  ----LLLLL-LHHHHHHHHHhhhhlllllLLLH-HHHHHHHLHHHHHHHLL-LLLLLLLL
Query ----SNNSL-NLFFEXRLASllqkaqnprNLDV-NTCLKXVTYDGAQAXGF-KSGKIEEG  337
ident         |      |                      |      |   |    | |  |
Sbjct kawgGIAGLqSCXDVXFDEA------vqkRGXSlPXFGKLXATNAADIFGLqQKGRIAPG  361
DSSP  llllLLLLHhHHHHHHHHHH------lllLLLLhHHHHHHHLHHHHHHLLLlLLLLLLLL


DSSP  LLLLEEEEELLLHH--------hllhhhhhhhhhHLLLllLLEEEELLEEEEELL-LLLL
Query WNADLVVIDLDLPE--------xfpvqniknhlvHAFSgeVFATXVAGKWIYFDG-EYPT  388
ident   || | |                                   |   |  ||      | 
Sbjct KDADFVFIQPNSSYvltnddleyrhkvspyvgrtIGAR--ITKTILRGDVIYDIEqGFPV  419
DSSP  LLLLEEEEELLLLEellhhhllllllllllllleELLE--EEEEEELLEEEEELLlLLLL


DSSP  Llhhhhhhhhhhhhhhhhl
Query Idseevkrelariekelys  407
ident                    
Sbjct A---------pkgqfilkh  429
DSSP  L---------lllleelll


No 24: Query=1j6pA Sbjct=4b3zD Z-score=21.2

back to top
DSSP  LEEEEEEEEELlLLLLlLEEEEEEEELLEEEEEEeLLLL-----lLEELLLEEEEELEEE
Query HHXIIGNCLILkDFSSePFWGAVEIENGTIKRVLqGEVK-----vDLDLSGKLVXPALFN   55
ident     |    |            |  | | ||                   |  | |    
Sbjct DRLLIKGGRII-NDDQ-SLYADVYLEDGLIKQIG-ENLIvpggvkTIEANGRMVIPGGID   57
DSSP  LEEEEEEEEEE-LLLL-EEEEEEEEELLEEEEEE-LLLLllllleEEELLLLEEEELEEE


DSSP  EEELHHHhHHLLllllllhhhhhhllhhhhhllllhhhhhhHHHHHHHHHHLLLEEEEEE
Query THTHAPXtLLRGvaedlsfeewlfskvlpiedrltekxayyGTILAQXEXARHGIAGFVD  115
ident   |                                                  |     |
Sbjct VNTYLQK-TAAD-----------------------------DFFQGTRAALVGGTTMIID   87
DSSP  EEELLLL-LLLL-----------------------------LHHHHHHHHHHLLEEEEEE


DSSP  EEL---------LHHHHHHHHHH-HLLEEEEEEEELLlllLLLLHHHHHHHHHHHHLlhh
Query XYF---------HEEWIAKAVRD-FGXRALLTRGLVDsngDDGGRLEENLKLYNEWNgfe  165
ident               |    |          |            |  ||   |        
Sbjct HVVpepgsslltSFEKWHEAADTkSCCDYSLHVDITS---WYDGVREELEVLVQDKG---  141
DSSP  EELllllllhhhHHHHHHHHHHLlLLLEEEEEEELLL---LLLLHHHHHHHHHHLLL---


DSSP  hleEEEEEeLLLL-----LLLHHHHHHHHHHHHHHLLLEEEEEL----------------
Query griFVGFGpHSPY-----LCSEEYLKRVFDTAKSLNAPVTIHLY----------------  204
ident       |             |   |   |   | | |    |                  
Sbjct ---VNSFQ-VYMAykdvyQMSDSQLYEAFTFLKGLGAVILVHAEngdliaqeqkrilemg  197
DSSP  ---LLEEE-EELLlllllLLLHHHHHHHHHHHHHHLLEEEEELLlhhhhhhhhhhhhhll


DSSP  --------llLLLL---LLLHHHHLLLL-lLLLEEEEELLL--LLHHHHHHHL-LLLEEE
Query --------etSKEE---YDLEDILNIGL-kEVKTIAAHCVH--LPERYFGVLK-DIPFFV  249
ident             ||           |                          |     | 
Sbjct itgpeghalsRPEEleaEAVFRAITIAGriNCPVYITKVMSksAADIIALARKkGPLVFG  257
DSSP  llllhhhhhhLLHHhhhHHHHHHHHHHHhhLLLEEEEEELLhhHHHHHHHHHHhLLLEEE


DSSP  EELHH----------------hhhHLLL--------LLLLHHHHHHLLLEEEELLLLLL-
Query SHNPA----------------snlKLGN--------GIAPVQRXIEHGXKVTLGTDGAA-  284
ident     |                                          |     |      
Sbjct EPIAAslgtdgthywsknwakaaaFVTSpplspdptTPDYLTSLLACGDLQVTGSGHCPy  317
DSSP  EELHHhhhlllhhhhlllhhhhhhLLLLllllllllHHHHHHHHHHHLLLLLLLLLLLLl


DSSP  -----------------LLLLL-LHHHHHHHHHhhhhlllLLLLLHHHHHHHHLHHHHHH
Query -----------------SNNSL-NLFFEXRLASllqkaqnPRNLDVNTCLKXVTYDGAQA  326
ident                    |                        | |          |  
Sbjct staqkavgkdnftlipeGVNGIeERMTVVWDKA-----vaTGKMDENQFVAVTSTNAAKI  372
DSSP  lhhhhhhhlllhhhlllLLLLLlLHHHHHHHHH-----llLLLLLHHHHHHHHLHHHHHH


DSSP  HLL--LLLLLLLLLLLLEEEEELLL--------hhhllhhhhhhhhhHLLLllLLEEEEL
Query XGF--KSGKIEEGWNADLVVIDLDL--------pexfpvqniknhlvHAFSgeVFATXVA  376
ident        | |  |  || |  | |                          |         
Sbjct FNLypRKGRIAVGSDADVVIWDPDKlktitakshksaveynifegmeCHGS--PLVVISQ  430
DSSP  HLLllLLLLLLLLLLLLEEEEEEEEeeelllllllllllllllllleEEEE--EEEEEEL


DSSP  LEEEEELLLLLLL----------------lhhhhhhhhhhhhhhhhl
Query GKWIYFDGEYPTI----------------dseevkrelariekelys  407
ident ||    ||                                       
Sbjct GKIVFEDGNINVNkgmgrfiprkafpehlyqrvkirnkvfglqgvsr  477
DSSP  LEEEEELLEELLLlllllllllllllhhhhhhhhhhhhhllllllll


No 25: Query=1j6pA Sbjct=1a4mA Z-score=21.1

back to top
DSSP  leeeeeeeeelllllllleeeeeeeelleeeeeeelllllleellleeeEELEEEEEELH
Query hhxiignclilkdfssepfwgaveiengtikrvlqgevkvdldlsgklvXPALFNTHTHA   60
ident                                                         | | 
Sbjct ---------------------------------------------tpafNKPKVELHVHL   15
DSSP  ---------------------------------------------llllLLLEEEEEEEH


DSSP  HHHHHL------------------------lLLLL--LLHHHHHHlLHHHHHLLLL--HH
Query PXTLLR------------------------gVAED--LSFEEWLFsKVLPIEDRLT--EK   92
ident                                   |  ||    |  |             
Sbjct DGAIKPetilyfgkkrgialpadtveelrniIGMDkpLSLPGFLA-KFDYYMPVIAgcRE   74
DSSP  HHLLLHhhhhhhhhhhllllllllhhhhhhhHLLLllLLHHHHHL-LHHHHHHHHLllHH


DSSP  HHHHHHHHHHHHHHLLLEEEEEEEEL-------------------------LHHHHHHHH
Query XAYYGTILAQXEXARHGIAGFVDXYF-------------------------HEEWIAKAV  127
ident              |  |       |                                   
Sbjct AIKRIAYEFVEMKAKEGVVYVEVRYSphllanskvdpmpwnqtegdvtpddVVDLVNQGL  134
DSSP  HHHHHHHHHHHHHHHLLEEEEEEEELlhhhllllllllhhhlllllllhhhHHHHHHHHH


DSSP  HHHL----LEEEEEEEELLLLLLL-lLHHHHHHHhhhhHLLHhhlEEEEEEEL----llL
Query RDFG----XRALLTRGLVDSNGDD-gGRLEENLKlyneWNGFegrIFVGFGPH----spY  178
ident                             ||   |     |       |            
Sbjct QEGEqafgIKVRSILCCMRHQPSWslEVLELCKK----YNQK---TVVAMDLAgdetieG  187
DSSP  HHHHhhhlLEEEEEEEEELLLHHHhhHHHHHHHH----LLLL---LEEEEEEEllllllL


DSSP  LLLHHHHHHHHHHHHHHLLLEEEEELLLllLLLL-LHHHHLLLLllllEEEEELLLLLHH
Query LCSEEYLKRVFDTAKSLNAPVTIHLYETskEEYD-LEDILNIGLkevkTIAAHCVHLPER  237
ident              |       | |  |              |          |  |  | 
Sbjct SSLFPGHVEAYEGAVKNGIHRTVHAGEV--GSPEvVREAVDILK---tERVGHGYHTIED  242
DSSP  HHHLHHHHHHHHHHHHHLLEEEEEELLL--LLHHhHHHHHHLLL---lLEEEELHHHHHL


DSSP  --HHHHHLLLLEEEEELHHHHHHLLLL----lLLHHHHHHLLLEEEELLLLLLLLLLlLH
Query --YFGVLKDIPFFVSHNPASNLKLGNG----iAPVQRXIEHGXKVTLGTDGAASNNSlNL  291
ident       |          | |    |         | |         | ||      |  |
Sbjct eaLYNRLLKENMHFEVCPWSSYLTGAWdpkttHAVVRFKNDKANYSLNTDDPLIFKS-TL  301
DSSP  hhHHHHHHHLLLEEEELHHHHHHLLLLlllllLHHHHHHHLLLLEEELLLLLLLLLL-LH


DSSP  HHHHHHHHHHHHllllllLLHHHHHHHHlHHHHHHHLL------LLLLLllllllleeee
Query FFEXRLASLLQKaqnprnLDVNTCLKXVtYDGAQAXGF------KSGKIeegwnadlvvi  345
ident                                 |                           
Sbjct DTDYQMTKKDMG------FTEEEFKRLN-INAAKSSFLpeeekkELLER-----------  343
DSSP  HHHHHHHHHLLL------LLHHHHHHHH-HHHHHLLLLlhhhhhHHHHH-----------


DSSP  elllhhhllhhhhhhhhhhllllllleeeelleeeeellllllllhhhhhhhhhhhhhhh
Query dldlpexfpvqniknhlvhafsgevfatxvagkwiyfdgeyptidseevkrelariekel  405
ident                                                             
Sbjct --------------------------------------------------------lyre  347
DSSP  --------------------------------------------------------hhhh


DSSP  hl
Query ys  407
ident   
Sbjct yq  349
DSSP  ll


No 26: Query=1j6pA Sbjct=1a5kC Z-score=18.1

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct snisrqayadmfgptvgdkvrladtelwieveddlttygeevkfgggkvirdgmgqgqml   60
DSSP  leeehhhhhhhhlllllleeelllllleeelleellllllllllllllllllllllllll


DSSP  ----LEEEEEEEEELlLLLLLlEEEEEEEELLEEEEEEE--------------lllllLE
Query ----HHXIIGNCLILkDFSSEpFWGAVEIENGTIKRVLQ--------------gevkvDL   42
ident           | ||  |              | |                          
Sbjct aadcVDLVLTNALIV-DHWGI-VKADIGVKDGRIFAIGKagnpdiqpnvtipigaateVI  118
DSSP  hhhlLLEEEEEEEEE-ELLEE-EEEEEEEELLEEEEEELeellllllllleellllleEE


DSSP  ELLLEEEEELEEEEEELHHhhhhllllllllhhhhhhllhhhhhllllhhhhhhhHHHHH
Query DLSGKLVXPALFNTHTHAPxtllrgvaedlsfeewlfskvlpiedrltekxayygTILAQ  102
ident    || |      || |                                           
Sbjct AAEGKIVTAGGIDTHIHWI------------------------------------CPQQA  142
DSSP  ELLLLEEEELEEEEEEELL------------------------------------LLLHH


DSSP  HHHHLLLEEEEEE------------EELL----HHHHHHHHHHHLLEEEEEEEELLllLL
Query XEXARHGIAGFVD------------XYFH----EEWIAKAVRDFGXRALLTRGLVDsnGD  146
ident  |    |    |                           |         |          
Sbjct EEALVSGVTTMVGggtgpaagthatTCTPgpwyISRMLQAADSLPVNIGLLGKGNV--SQ  200
DSSP  HHHHHHLEEEEEEelllllhhhhhlLLLLhhhhHHHHHHHHLLLLLEEEEEEELLL--LL


DSSP  LLLHHHHHHHHHhhhllhhhleeEEEEElLLLLL-LHHHHHHHHHHHHHHLLLEEEEEll
Query DGGRLEENLKLYnewngfegrifVGFGPhSPYLC-SEEYLKRVFDTAKSLNAPVTIHLye  205
ident      |                  |                     |      |  |   
Sbjct PDALREQVAAGV-----------IGLEI-HEDWGaTPAAIDCALTVADEMDIQVALHS--  246
DSSP  HHHHHHHHHHLL-----------LEEEE-EHHHLlLHHHHHHHHHHHHHHLLEEEEEL--


DSSP  llLLLL--LLHHHHLLLLLLlLEEEEELLL----lLHHHHHHHLLLLEEEEELhHHHH--
Query tsKEEY--DLEDILNIGLKEvKTIAAHCVH----lPERYFGVLKDIPFFVSHNpASNL--  257
ident           || |            |                       |      |  
Sbjct -dTLNEsgFVEDTLAAIGGR-TIHTFHTEGaggghAPDIITACAHPNILPSST-NPTLpy  303
DSSP  -lLLLLllLHHHHHHHHLLL-LEEELLLLLlllllLLLHHHHHHLLLEEEEEE-HHHLll


DSSP  ----------------------------------hllLLLL--LHHHHHhlllEEEELLL
Query ----------------------------------klgNGIA--PVQRXIehgxKVTLGTD  281
ident                                                            |
Sbjct tlntidehldmlmvchhldpdiaedvafaesrirretIAAEdvLHDLGA----FSLTSSD  359
DSSP  lllhhhhhhhhhhhhhllllllhhhhhlllllllhhhHHHHhhHHHLLL----LLEEELL


DSSP  LLLLLLLLLHHHHHHHHHHHHHLLLLLL---------lLHHHHHHHHLHHHHHHHLL--L
Query GAASNNSLNLFFEXRLASLLQKAQNPRN---------lDVNTCLKXVTYDGAQAXGF--K  330
ident   |                  | |               |       |   |   |    
Sbjct SQAMGRVGEVILRTWQVAHRMKVQRGALaeetgdndnfRVKRYIAKYTINPALTHGIahE  419
DSSP  LLLLLLLLLHHHHHHHHHHHHHHHHLLLllllllllhhHHHHHHHLLLHHHHHHLLLllL


DSSP  LLLLLLLLLLLEEEEELLlhhhllhhhhhhhhhhlLLLLLLEEEELLEEEEEL-------
Query SGKIEEGWNADLVVIDLDlpexfpvqniknhlvhaFSGEVFATXVAGKWIYFD-------  383
ident  | || |  |||||                     |          |             
Sbjct VGSIEVGKLADLVVWSPA----------------fFGVKPATVIKGGMIAIAPmgdinas  463
DSSP  LLLLLLLLLLLEEEELHH----------------hLLLLLLEEEELLEEEEEEellllll


DSSP  --------LLLL--LLLH------------------------------------------
Query --------GEYP--TIDS------------------------------------------  391
ident                  |                                          
Sbjct iptpqpvhYRPMfgALGSarhhcrltflsqaaaangvaerlnlrsaiavvkgcrtvqkad  523
DSSP  llllllleEEELhhHLHHhhhhhleeeelhhhhhhlhhhhllllleeeellllllllhhh


DSSP  ---------------------------hhhhhhhhhhhhhhhl
Query ---------------------------eevkrelariekelys  407
ident                                            
Sbjct mvhnslqpnitvdaqtyevrvdgelitsepadvlpmaqryflf  566
DSSP  llllllllleeelllllleeelleellllllllllllllllll


No 27: Query=1j6pA Sbjct=2y1hB Z-score=16.5

back to top
DSSP  leeeeeeeeelllllllleeeeeeeelleeeeeeelllllleellleeeEELEEEEEELH
Query hhxiignclilkdfssepfwgaveiengtikrvlqgevkvdldlsgklvXPALFNTHTHA   60
ident                                                     |   | | 
Sbjct -------------------------------------------------GVGLVDCHCHL   11
DSSP  -------------------------------------------------LLLEEEEEELL


DSSP  HHHHHllllllllhhhhhhllhhhhhllllhhhhhHHHHHHHHHHHLLLEEEEEEEE---
Query PXTLLrgvaedlsfeewlfskvlpiedrltekxayYGTILAQXEXARHGIAGFVDXY---  117
ident                                                      |      
Sbjct SAPDF-----------------------------dRDLDDVLEKAKKANVVALVAVAehs   42
DSSP  LLHHH-----------------------------lLLHHHHHHHHHHLLEEEEEELLllh


DSSP  ---LLHHHHHHHHHhhlLEEEEEEEEL---------LLLLLLLLHHHHHHHHHHHhllhh
Query ---FHEEWIAKAVRdfgXRALLTRGLV---------DSNGDDGGRLEENLKLYNEwngfe  165
ident                     |   |               |    |              
Sbjct gefEKIMQLSERYN---GFVLPCLGVHpvqgldqrsVTLKDLDVALPIIENYKDR-----   94
DSSP  hhhHHHHHHHHHLL---LLEEEEELLLleelllleeLLHHHHHHHHHHHHHHLLL-----


DSSP  hleEEEEEELLLL------------llLHHHHHHHHHHHHHHLLLEEEEELlllLLLLL-
Query griFVGFGPHSPY------------lcSEEYLKRVFDTAKSLNAPVTIHLYetsKEEYD-  212
ident        |                       | |    || || ||  |           
Sbjct ---LLAIGEVGLDfsprfagtgeqkeeQRQVLIRQIQLAKRLNLPVNVHSR---SAGRPt  148
DSSP  ---LLEEEEEEEEllllllllhhhhhhHHHHHHHHHHHHHHHLLLEEEEEE---LLHHHh


DSSP  LHHHHLLLLllLLEEEEELLlLLHHHHHHHLLLLEEEEELhHHHHhlLLLLL--LHHHHH
Query LEDILNIGLkeVKTIAAHCVhLPERYFGVLKDIPFFVSHNpASNLklGNGIA--PVQRXI  270
ident        |    |                      | |    |      |     |    
Sbjct INLLQEQGA--EKVLLHAFD-GRPSVAMEGVRAGYFFSIP-PSII--RSGQKqkLVKQLP  202
DSSP  HHHHHHLLL--LLEEEELLL-LLHHHHHHHHHLLLEEEEL-HHHH--LLHHHhhHHHHLL


DSSP  hllLEEEELLLLLLLL------LLLL-HHHHHHHHHHHHHllllllLLHHHHHHHHLHHH
Query ehgXKVTLGTDGAASN------NSLN-LFFEXRLASLLQKaqnprnLDVNTCLKXVTYDG  323
ident        | ||  |        |                         |       |   
Sbjct --lTSICLETDSPALGpekqvrNEPWnISISAEYIAQVKG------ISVEEVIEVTTQNA  254
DSSP  --hHHEEELLLLLLLLllllllLLHHhHHHHHHHHHHHHL------LLHHHHHHHHHHHH


DSSP  HHH-HLLLllllllllllleeeeelllhhhllhhhhhhhhhhllllllleeeelleeeee
Query AQA-XGFKsgkieegwnadlvvidldlpexfpvqniknhlvhafsgevfatxvagkwiyf  382
ident                                                             
Sbjct LKLfPKLR----------------------------------------------------  262
DSSP  HHHlLLHH----------------------------------------------------


DSSP  llllllllhhhhhhhhhhhhhhhhl
Query dgeyptidseevkrelariekelys  407
ident                          
Sbjct ----------------------hll  265
DSSP  ----------------------hhl


No 28: Query=1j6pA Sbjct=3k2gB Z-score=15.7

back to top
DSSP  leeeeeeeeelllllllleeeeeeeelleeeeeeelllllleellleeeeeLEEEEEELH
Query hhxiignclilkdfssepfwgaveiengtikrvlqgevkvdldlsgklvxpALFNTHTHA   60
ident                                                         | | 
Sbjct ------------------------slselspchvrsgrixtvdgpipssalGHTLXHEHL   36
DSSP  ------------------------llllllllllllleeeelleeeehhhlLLEELLLLL


DSSP  HH----------------------hhhllllLLLLhhhHHHLLhHHHHllllhhHHHHHH
Query PX----------------------tllrgvaEDLSfeeWLFSKvLPIEdrltekXAYYGT   98
ident                                           |   |             
Sbjct QNdcrcwwnppqeperqylaeapisieilseLRQD---PFVNK-HNIA-----lDDLDLA   87
DSSP  LEelhhhllllllhhhhhhhhllllhhhhhhHHLL---HHHLL-LLLE-----eLLHHHH


DSSP  HHHHHHHHLLLEEEEEEEE-----LLHHHHHHHHHHHLLEEEEEEEEL-------lLLLL
Query ILAQXEXARHGIAGFVDXY-----FHEEWIAKAVRDFGXRALLTRGLV-------dSNGD  146
ident |      |  |    ||                    |       |              
Sbjct IAEVKQFAAVGGRSIVDPTcrgigRDPVKLRRISAETGVQVVXGAGYYlassxpetAARL  147
DSSP  HHHHHHHHHLLLLEEEELLlllllLLHHHHHHHHHHHLLEEEELLLLLlhhhllhhHHLL


DSSP  -lllhHHHHHHHHH------HHLLhhhleeEEEEELLLL----llLHHHHHHHHHHHHHH
Query -dggrLEENLKLYN------EWNGfegrifVGFGPHSPY----lcSEEYLKRVFDTAKSL  195
ident        |                         |            |  |          
Sbjct saddiADEIVAEALegtdgtDARI------GLIGEIGVSsdftaeEEKSLRGAARAQVRT  201
DSSP  lhhhhHHHHHHHHHllllllLLLL------LLEEEELLLllllhhHHHHHHHHHHHHHHH


DSSP  LLLEEEEELLLlllLLLLHHHHLL-----LLLLlLEEEEELLLL--LHHHHHHHLLLLEE
Query NAPVTIHLYETskeEYDLEDILNI-----GLKEvKTIAAHCVHL--PERYFGVLKDIPFF  248
ident   |   ||             |             |   |         |   |     |
Sbjct GLPLXVHLPGW---FRLAHRVLDLveeegADLR-HTVLCHXNPShxDPVYQATLAQRGAF  257
DSSP  LLLEEELLLLL---LLLHHHHHHHhhhllLLHH-HEEELLLHHHllLHHHHHHHHHHLLE


DSSP  EEELHHHHHHL------LLLL-----lLHHHHHHLLL--EEEELLLLLL-------llLL
Query VSHNPASNLKL------GNGI-----aPVQRXIEHGX--KVTLGTDGAA-------snNS  288
ident                                   ||      |  |            | 
Sbjct LEFDXIGXDFFyadqgvQCPSddevarAILGLADHGYldRILLSHDVFVkxxltryggNG  317
DSSP  EEELLLLLLLEelllleELLLhhhhhhHHHHHHHLLLhhHEEELLLLLLhhhlhhhllLL


DSSP  LL-HHHHHHHHHHHHhlllllLLLHHHHHHHHLHHHHHHHLllllllllllllleeeeel
Query LN-LFFEXRLASLLQkaqnprNLDVNTCLKXVTYDGAQAXGfksgkieegwnadlvvidl  347
ident                       ||                                    
Sbjct YAfVTKHFLPRLRRH------GLDDAALETLXVTNPRRVFD-------------------  352
DSSP  LLhHHHLHHHHHHHL------LLLHHHHHHHHLHHHHHHHL-------------------


DSSP  llhhhllhhhhhhhhhhllllllleeeelleeeeellllllllhhhhhhhhhhhhhhhhl
Query dlpexfpvqniknhlvhafsgevfatxvagkwiyfdgeyptidseevkrelariekelys  407
ident                                                             
Sbjct ------------------------------------------------------asiegh  358
DSSP  ------------------------------------------------------llllll


No 29: Query=1j6pA Sbjct=3cjpA Z-score=15.3

back to top
DSSP  leeeeeeeeelllllllleeeeeeeelleeeeeeelllllleellleeeeeLEEEEEELH
Query hhxiignclilkdfssepfwgaveiengtikrvlqgevkvdldlsgklvxpALFNTHTHA   60
ident                                                         ||| 
Sbjct ---------------------------------------------------LIIDGHTHV    9
DSSP  ---------------------------------------------------LLEEEEEEL


DSSP  HhhhhllllllllhhhhhhllhhhhhllllhhhhhHHHHHHHHHHHLLLEEEEEEEEL--
Query PxtllrgvaedlsfeewlfskvlpiedrltekxayYGTILAQXEXARHGIAGFVDXYF--  118
ident                                                 |           
Sbjct I----------------------------------LPVEKHIKIMDEAGVDKTILFSTsi   35
DSSP  L----------------------------------LLHHHHHHHHHHHLLLEEEEELLll


DSSP  -----------------------------------LHHHHHHHHHHH-LLEEeEEEEELL
Query -----------------------------------HEEWIAKAVRDF-GXRAlLTRGLVD  142
ident                                                             
Sbjct hpetavnlrdvkkemkklndvvngktnsmidvrrnSIKELTNVIQAYpSRYV-GFGNVPV   94
DSSP  lhhhlllhhhhhhhhhhhhhhhlllllllhhhhhhHHHHHHHHHHHLlLLEE-EEELLLL


DSSP  llLLLL-LHHHHHHHHHHHHLlhhhleEEEEEELLLLllLHHHHHHHHHHHHHH-LLLEE
Query snGDDG-GRLEENLKLYNEWNgfegriFVGFGPHSPYlcSEEYLKRVFDTAKSL-NAPVT  200
ident   |                         || |   |       ||  |         |  
Sbjct --GLSEnDTNSYIEENIVNNK------LVGIGELTPAsgQIKSLKPIFKYSMDSgSLPIW  146
DSSP  --LLLHhHHHHHHHHHLLLLL------LLEEEEELLLllLHHHHHHHHHHHHHLlLLLEE


DSSP  EEELLLllLLLL-LHHHHlLLLL---LLLEEEEEL-LLLLHHHHHHHLL-LLEEEEELHh
Query IHLYETskEEYD-LEDILnIGLK---EVKTIAAHC-VHLPERYFGVLKD-IPFFVSHNPa  254
ident ||              |     |    |  |  |             |            
Sbjct IHAFNP--LVLQdIKEIA-ELCKafpKVPVILGHMgGSNWMTAVELAKEiQNLYLDTSA-  202
DSSP  ELLLLL--LLHHhHHHHH-HHHHhllLLLEEEHHHhHHHHHHHHHHHHHlLLEEEELLL-


DSSP  hhhhllLLLLLHHHHHHLL-lEEEELLLLLllLLLLLhhHHHHHHHHHHhllllllLLHH
Query snlklgNGIAPVQRXIEHG-xKVTLGTDGAasNNSLNlfFEXRLASLLQkaqnprnLDVN  313
ident                |     |   |||       |                     |  
Sbjct -----yFSTFVLKIVINELplKCIFGTDMP--FGDLQ--LSIEAIKKMS-------NDSY  246
DSSP  -----lLLHHHHHHHHHHLllLEELLLLLL--LLLHH--HHHHHHHHHL-------LLHH


DSSP  HHHHHHLHHHHHHHLLlllllllllllleeeeelllhhhllhhhhhhhhhhlllllllee
Query TCLKXVTYDGAQAXGFksgkieegwnadlvvidldlpexfpvqniknhlvhafsgevfat  373
ident                                                             
Sbjct VANAVLGDNISRLLNI--------------------------------------------  262
DSSP  HHHHHHLHHHHHHHLL--------------------------------------------


DSSP  eelleeeeellllllllhhhhhhhhhhhhhhhhl
Query xvagkwiyfdgeyptidseevkrelariekelys  407
ident                                   
Sbjct ----------------------------------  262
DSSP  ----------------------------------


No 30: Query=1j6pA Sbjct=3gg7A Z-score=15.3

back to top
DSSP  leeeeeeeeelllllllleeeeeeeelleeeeeeelllllleellleeeeeLEEEEEELH
Query hhxiignclilkdfssepfwgaveiengtikrvlqgevkvdldlsgklvxpALFNTHTHA   60
ident                                                     |   | | 
Sbjct ---------------------------------------------------SLIDFHVHL    9
DSSP  ---------------------------------------------------LLEEEEELH


DSSP  HHHHhllllllllhhhhhhllhhhhhllllhhhhhhHHHHHHHHHHLLLEeEEEEEEL--
Query PXTLlrgvaedlsfeewlfskvlpiedrltekxayyGTILAQXEXARHGIaGFVDXYF--  118
ident                                                             
Sbjct DLYP--------------------------------DPVAVARACEERQL-TVLSVTTtp   36
DSSP  HHLL--------------------------------LHHHHHHHHHHLLL-EEEELLLlh


DSSP  -LHHHHHHHHHhHLLEEEEEEEE---LLLLlLLLLHhHHHHHHHHHhllhhhleEEEEEe
Query -HEEWIAKAVRdFGXRALLTRGL---VDSNgDDGGRlEENLKLYNEwngfegriFVGFGp  174
ident                      |    | |                |            | 
Sbjct aAWRGTLALAA-GRPHVWTALGFhpeVVSE-RAADL-PWFDRYLPE--------TRFVGe   85
DSSP  hHHHHHHHHHL-LLLLEEELLLLlhhHLLL-LHHHL-HHHHHHHHH--------LLEEEe


DSSP  LLLL---------llLHHHHHHHHHHHHHH-LLLEEEEELllllLLLLL-HHHHLLLLlL
Query HSPY---------lcSEEYLKRVFDTAKSL-NAPVTIHLYetskEEYDL-EDILNIGLkE  223
ident                                     ||               |      
Sbjct VGLDgspslrgtwtqQFAVFQHILRRCEDHgGRILSIHSR----RAESEvLNCLEANPrS  141
DSSP  EELLllhhhhhhhhhHHHHHHHHHHHHHHLlLEEEEEELL----LLHHHhHHHHHHLHhH


DSSP  LLEEEEELlLLLHHHHHHHLLLLEEEEELhHHHHhllLLLL--LHHHHHhlllEEEELLL
Query VKTIAAHCvHLPERYFGVLKDIPFFVSHNpASNLklgNGIA--PVQRXIehgxKVTLGTD  281
ident    |                      |                           |   ||
Sbjct GTPILHWY-SGSVTELRRAISLGCWFSVG-PTMV--rTQKGaaLIRSMP--rdRVLTETD  195
DSSP  EEEEEELL-LLLHHHHHHHHHLLLEEEEL-HHHH--lLHHHhhHHHHLL--hhHEEELLL


DSSP  LLLLL-----LLLL-HHHHHHHHHHHHHllllllLLHHHHHHHHLHHHHHHHLlllllll
Query GAASN-----NSLN-LFFEXRLASLLQKaqnprnLDVNTCLKXVTYDGAQAXGfksgkie  335
ident |                      |                   |        |       
Sbjct GPFLEldgqaALPWdVKSVVEGLSKIWQ------IPASEVERIVKENVSRLLG-------  242
DSSP  LLLLEelleeLLHHhHHHHHHHHHHHHL------LLHHHHHHHHHHHHHHHHH-------


DSSP  lllllleeeeelllhhhllhhhhhhhhhhllllllleeeelleeeeellllllllhhhhh
Query egwnadlvvidldlpexfpvqniknhlvhafsgevfatxvagkwiyfdgeyptidseevk  395
ident                                                             
Sbjct ------------------------------------------------------------  242
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhhhhhl
Query relariekelys  407
ident             
Sbjct -----------t  243
DSSP  -----------l


No 31: Query=1j6pA Sbjct=2ob3A Z-score=15.2

back to top
DSSP  leeeeeeeeelllllllleeeeeeeelleeeeeeelllllleellleeeeeLEEEEEELH
Query hhxiignclilkdfssepfwgaveiengtikrvlqgevkvdldlsgklvxpALFNTHTHA   60
ident                                                        || | 
Sbjct ------------------------------------drintvrgpitiseaGFTLTHEHI   24
DSSP  ------------------------------------lleeelleeelhhhhLLEEEEELL


DSSP  HHhhhllllllllhhhhhhllhhhHHLLLL--------HHHHHHHHHHHHHHHHLLLEEE
Query PXtllrgvaedlsfeewlfskvlpIEDRLT--------EKXAYYGTILAQXEXARHGIAG  112
ident                             |          |                |   
Sbjct CG---------------------sSAGFLRawpeffgsRKALAEKAVRGLRRARAAGVRT   63
DSSP  EE---------------------lLLLHHHhlhhhhllHHHHHHHHHHHHHHHHHLLLLE


DSSP  EEEEE-----LLHHHHHHHHHHHLLEEEEEEEEL------LLLLL---llLHHHHH-HHH
Query FVDXY-----FHEEWIAKAVRDFGXRALLTRGLV------DSNGD---dgGRLEEN-LKL  157
ident  ||             |   |          ||                           
Sbjct IVDVStfdigRDVSLLAEVSRAADVHIVAATGLWfdpplsMRLRSveeltQFFLREiQYG  123
DSSP  EEELLlhhhlLLHHHHHHHHHHHLLEEELEEELLllllhhHHLLLhhhhhHHHHHHhHLL


DSSP  H--HHHLlhhhleEEEEEeLLLL----llLHHHHHHHHHHHHHHLLLEEEEELLllllLL
Query Y--NEWNgfegriFVGFGpHSPY----lcSEEYLKRVFDTAKSLNAPVTIHLYEtskeEY  211
ident                               |  ||           ||| |         
Sbjct IedTGIR------AGIIX-VATTgkatpfQELVLKAAARASLATGVPVTTHTAA----SQ  172
DSSP  LllLLLL------LLEEE-EELLllllhhHHHHHHHHHHHHHHHLLLEEEELLH----HH


DSSP  LL-HHHHLL-----LLLLlLEEEEELLLL-LHHHHHHHLLLLEEEEEL-HHHH-------
Query DL-EDILNI-----GLKEvKTIAAHCVHL-PERYFGVLKDIPFFVSHN-PASN-------  256
ident    |    |               |        |   |                      
Sbjct RDgEQQAAIfesegLSPS-RVCIGHSDDTdDLSYLTALAARGYLIGLDhIPYSaigledn  231
DSSP  LHhHHHHHHhhhllLLHH-HEEELLHHHLlLHHHHHHHHHLLLEEEELlLLLLlllllll


DSSP  -----hHLLL---LLLL-HHHHHHLLL--EEEELLLLL----------------lllLLL
Query -----lKLGN---GIAP-VQRXIEHGX--KVTLGTDGA----------------asnNSL  289
ident                |      |  |         |                        
Sbjct asasalLGIRswqTRALlIKALIDQGYmkQILVSNDWTfgfssyvtnimdvmdrvnpDGM  291
DSSP  hhhhhhHLLLlhhHHHHhHHHHHHLLLhhHEEELLLLLleellllllhhhhhhhhllLHH


DSSP  LhhHHHHHHHHHHHlllLLLLLHHHHHHHHLHHHHHHHLllllllllllllleeeeelll
Query NlfFEXRLASLLQKaqnPRNLDVNTCLKXVTYDGAQAXGfksgkieegwnadlvvidldl  349
ident    |                    |         |                         
Sbjct A--FIPLRVIPFLR---EKGVPQETLAGITVTNPARFLS---------------------  325
DSSP  H--HHHHLHHHHHH---HLLLLHHHHHHHHLHHHHHHHL---------------------


DSSP  hhhllhhhhhhhhhhllllllleeeelleeeeellllllllhhhhhhhhhhhhhhhhl
Query pexfpvqniknhlvhafsgevfatxvagkwiyfdgeyptidseevkrelariekelys  407
ident                                                           
Sbjct ------------------------------------------------------ptlr  329
DSSP  ------------------------------------------------------llll


No 32: Query=1j6pA Sbjct=1bf6A Z-score=15.1

back to top
DSSP  leeeeeeeeelllllllleeeeeeeelleeeeeeelllllleellleeeeELEEEEEELH
Query hhxiignclilkdfssepfwgaveiengtikrvlqgevkvdldlsgklvxPALFNTHTHA   60
ident                                                         | | 
Sbjct ----------------------------------------------sfdpTGYTLAHEHL   14
DSSP  ----------------------------------------------llllLLEEEEEELL


DSSP  HHhhhllllllllhhhhhhllHHHHHLL-llhhHHHHHHHHHHHHHHLLLEEEEEEEE--
Query PXtllrgvaedlsfeewlfskVLPIEDR-ltekXAYYGTILAQXEXARHGIAGFVDXY--  117
ident                                    |             |          
Sbjct HI------------------dLSGFKNNvdcrlDQYAFICQEMNDLMTRGVRNVIEMTnr   56
DSSP  LE------------------eLHHHHLLhhheeLLHHHHHHHHHHHHHLLEEEEEELLlh


DSSP  ---LLHHHHHHHHHHHLLEEEEEEEEL----LLLLL----lllhHHHHHHHH------HH
Query ---FHEEWIAKAVRDFGXRALLTRGLV----DSNGD----dggrLEENLKLY------NE  160
ident              |  |       |                     |            |
Sbjct ymgRNAQFMLDVMRETGINVVACTGYYqdafFPEHVatrsvqelAQEMVDEIeqgidgTE  116
DSSP  hhlLLHHHHHHHHHHHLLEEEEEELLLlhhhLLLHHhhllhhhhHHHHHHHHhlllllLL


DSSP  HLlhhhleEEEEEELLLL-----llLHHHHHHHHHHHHHHLLLEEEEELLlllllLLLHH
Query WNgfegriFVGFGPHSPY-----lcSEEYLKRVFDTAKSLNAPVTIHLYEtskeeYDLED  215
ident                           |               |   |             
Sbjct LK------AGIIAEIGTSegkitplEEKVFIAAALAHNQTGRPISTHTSF----sTMGLE  166
DSSP  LL------EEEEEEEELLlllllhhHHHHHHHHHHHHHHHLLLEEEELHH----hLLHHH


DSSP  HHLLLL----LLLLEEEEELL-LLLHHHHHHHLLLLEEEEELHHHHHhLLLLL----lLH
Query ILNIGL----KEVKTIAAHCV-HLPERYFGVLKDIPFFVSHNPASNLkLGNGI----aPV  266
ident  |                ||             |    |                     
Sbjct QLALLQahgvDLSRVTVGHCDlKDNLDNILKMIDLGAYVQFDTIGKN-SYYPDekriaML  225
DSSP  HHHHHHhlllLHHHEEELLLLlLLLHHHHHHHHHLLLEEEELLLLLL-LLLLHhhhhhHH


DSSP  HHHHHLLL--EEEELLLLLL-------llLLLL-HHHHHHHHHHhhhlllLLLLLHHHHH
Query QRXIEHGX--KVTLGTDGAA-------snNSLN-LFFEXRLASLlqkaqnPRNLDVNTCL  316
ident       |    | |  |                 |                         
Sbjct HALRDRGLlnRVMLSMDITRrshlkanggYGYDyLLTTFIPQLR------QSGFSQADVD  279
DSSP  HHHHHLLLhhHEEELLLLLLhhhlhhhllLLLLhHHHLHHHHHH------HLLLLHHHHH


DSSP  HHHLHHHHHHHLllllllllllllleeeeelllhhhllhhhhhhhhhhllllllleeeel
Query KXVTYDGAQAXGfksgkieegwnadlvvidldlpexfpvqniknhlvhafsgevfatxva  376
ident         |                                                   
Sbjct VMLRENPSQFFQ------------------------------------------------  291
DSSP  HHHLHHHHHHLL------------------------------------------------


DSSP  leeeeellllllllhhhhhhhhhhhhhhhhl
Query gkwiyfdgeyptidseevkrelariekelys  407
ident                                
Sbjct -------------------------------  291
DSSP  -------------------------------


No 33: Query=1j6pA Sbjct=3irsA Z-score=14.8

back to top
DSSP  leeeeeeeeelllllllleeeeeeeelleeeeeeelllllleellleeeeELEEEEEELH
Query hhxiignclilkdfssepfwgaveiengtikrvlqgevkvdldlsgklvxPALFNTHTHA   60
ident                                                             
Sbjct --------------------------------------------------LKIIDFRLRP   10
DSSP  --------------------------------------------------LLLEELLLLL


DSSP  H------hhhHLLLLL-LLLHhhhhhllhhhhhllllhhhhhhhhHHHHHHHHLLLEEEE
Query P------xtlLRGVAE-DLSFeewlfskvlpiedrltekxayygtILAQXEXARHGIAGF  113
ident |                                             |   | |  ||   
Sbjct PamgflnariYTRPDIrNRFT--------rqlgfepapsaeekslELMFEEMAAAGIEQG   62
DSSP  LlhhhhhlhhHHLHHHhHHHH--------hhhlllllhhhhhllhHHHHHHHHHLLLLEE


DSSP  EEEE--------LLHHHHHHHHHHHLLEEEEEEEELLLllLLLLHHHHHHHHHHHHLlhh
Query VDXY--------FHEEWIAKAVRDFGXRALLTRGLVDSngDDGGRLEENLKLYNEWNgfe  165
ident |                 |                                         
Sbjct VCVGrnssvlgsVSNADVAAVAKAYPDKFHPVGSIEAA--TRKEAMAQMQEILDLGI---  117
DSSP  EEELleellleeLLHHHHHHHHHHLLLLEEEEEELLLL--LHHHHHHHHHHHHHLLL---


DSSP  hleeEEEEElLLLLL------lHHHHHHHHHHHHHHLLLEEEEELLL--lLLLL-LLHHH
Query grifVGFGPhSPYLC------sEEYLKRVFDTAKSLNAPVTIHLYET--sKEEY-DLEDI  216
ident            |             |            ||             |   | |
Sbjct ----RIVNL-EPGVWatpmhvdDRRLYPLYAFCEDNGIPVIMMTGGNagpDITYtNPEHI  172
DSSP  ----LLEEE-LHHHLlllllllLHHHHHHHHHHHHLLLLEEEELLLLlllLHHHhLHHHH


DSSP  HLLL--LLLLLEEEEE-LLLLLHHHHHHHLL-LLEEEEELhhHHHHlllLLLL--HHHHH
Query LNIG--LKEVKTIAAH-CVHLPERYFGVLKD-IPFFVSHNpaSNLKlgnGIAP--VQRXI  270
ident                |           |         |      |               
Sbjct DRVLgdFPDLTVVSSHgNWPWVQEIIHVAFRrPNLYLSPD--MYLY--nLPGHadFIQAA  228
DSSP  HHHHhhLLLLLEEEEHhHLLLHHHHHHHHHHlLLEEEELH--HHHL--lLLLHhhHHHHH


DSSP  HLLL--EEEELLLLLllLLLL--LHHHhHHHHhhhhhlllllLLLHHHHHHHHLHHHHHH
Query EHGX--KVTLGTDGAasNNSL--NLFFeXRLAsllqkaqnprNLDVNTCLKXVTYDGAQA  326
ident           ||        |                             |         
Sbjct NSFLadRMLFGTAYP--MCPLkeYTEW-FLTL----------PIKPDAMEKILHGNAERL  275
DSSP  LLHHhhLLLLLLLLL--LLLHhhHHHH-HHLL----------LLLHHHHHHHHLHHHHHH


DSSP  HLllllllllllllleeeeelllhhhllhhhhhhhhhhllllllleeeelleeeeellll
Query XGfksgkieegwnadlvvidldlpexfpvqniknhlvhafsgevfatxvagkwiyfdgey  386
ident                                                             
Sbjct LA----------------------------------------------------------  277
DSSP  HH----------------------------------------------------------


DSSP  llllhhhhhhhhhhhhhhhhl
Query ptidseevkrelariekelys  407
ident                      
Sbjct -----------------qagr  281
DSSP  -----------------hlll


No 34: Query=1j6pA Sbjct=4dlfA Z-score=14.6

back to top
DSSP  leeeeeeeeelllllllleeeeeeeelleeeeeeelllllleellleeeeELEEEEEELH
Query hhxiignclilkdfssepfwgaveiengtikrvlqgevkvdldlsgklvxPALFNTHTHA   60
ident                                                         | | 
Sbjct --------------------------------------------------ALRIDSHQHF   10
DSSP  --------------------------------------------------LLLEEEEELL


DSSP  HhhhhllllllllhhhHHHLLHhHHHLLLlhhhhhhHHHHHHHHHHLLLEEEEE-EEEL-
Query PxtllrgvaedlsfeeWLFSKVlPIEDRLtekxayyGTILAQXEXARHGIAGFV-DXYF-  118
ident                 |          |                                
Sbjct W-------ryraadypWIGAGM-GVLARD------yLPDALHPLMHAQALGASIaVQARa   56
DSSP  L-------lllhhhllLLLLLL-HHHLLL------lLHHHHHHHHHHLLLLEEEeELLLl


DSSP  ---LHHHHHHHHHHHLL-EEEEEEeellllllllLHHH-hhhhhHHHHLLHhhlEEEEEE
Query ---HEEWIAKAVRDFGX-RALLTRglvdsngddgGRLE-enlklYNEWNGFegrIFVGFG  173
ident              |     |                          || |       || 
Sbjct grdETAFLLELACDEARiAAVVGW---------eDLRApqlaerVAEWRGT---KLRGFR  104
DSSP  lhhHHHHHHHHHLLLLLeEEEEEL---------lLLLLllhhhhHHLLLLL---LEEEEE


DSSP  ELLLLL----lLHHH--HHHHHHHHHHHLLLEEEEEllLLLLlLLLHHHHLLLlLLLLEE
Query PHSPYL----cSEEY--LKRVFDTAKSLNAPVTIHLyeTSKEeYDLEDILNIGlKEVKTI  227
ident                    |                        |               
Sbjct HQLQDEadvraFVDDadFARGVAWLQANDYVYDVLV--FERQlPDVQAFCARH-DAHWLV  161
DSSP  ELHHHLllhhhHHHLhhHHHHHHHHHHLLLEEEELL--LHHHhHHHHHHHHHL-LLLLEE


DSSP  EE-ELLL-------------lLHHHHHH-HLLLLEEEEELhhHHHHLL------------
Query AA-HCVH-------------lPERYFGV-LKDIPFFVSHNpaSNLKLG------------  260
ident                                                             
Sbjct LDhAGKPalaefdrddtalarWRAALRElAALPHVVCKLS--GLVTEAdwrrglrasdlr  219
DSSP  EHhHHLLlhhhllllllhhhhHHHHHHHhHLLLLEEEEEL--LLLLLLlllllllhhhhh


DSSP  lLLLLHHHHHHLLL--EEEELLLLLLLL--LLLLhhHHHHHHHHHHHLllllLLLHHHHH
Query nGIAPVQRXIEHGX--KVTLGTDGAASN--NSLNlfFEXRLASLLQKAqnprNLDVNTCL  316
ident                     | |        |        |            |      
Sbjct hIEQCLDAALDAFGpqRLMFGSDWPVCLlaASYD--EVASLVERWAES----RLSAAERS  273
DSSP  hHHHHHHHHHHHHLhhHEEELLLLLHHHhlLLHH--HHHHHHHHHHHH----HLLHHHHH


DSSP  HHHLHHHHHHHLLLllllllllllleeeeelllhhhllhhhhhhhhhhllllllleeeel
Query KXVTYDGAQAXGFKsgkieegwnadlvvidldlpexfpvqniknhlvhafsgevfatxva  376
ident        |                                                    
Sbjct ALWGGTAARCYALP----------------------------------------------  287
DSSP  HHLLHHHHHHLLLL----------------------------------------------


DSSP  leeeeellllllllhhhhhhhhhhhhhhhhl
Query gkwiyfdgeyptidseevkrelariekelys  407
ident                                
Sbjct -------------------------------  287
DSSP  -------------------------------


No 35: Query=1j6pA Sbjct=4mupB Z-score=14.5

back to top
DSSP  leeeeeeeeelllllllleeeeeeeelleeeeeeelllllleellleeeEELEEEEEELH
Query hhxiignclilkdfssepfwgaveiengtikrvlqgevkvdldlsgklvXPALFNTHTHA   60
ident                                                        |  | 
Sbjct -----------------------------------lvrklsgtapnpafPRGAVDTQMHM   25
DSSP  -----------------------------------llllllllllllllLLLLEELLLLL


DSSP  HhhhhllllllllhhhhhhllhHHHHllllhhhhhhHHHHHHHHHHLLLEEEEEEEEL--
Query PxtllrgvaedlsfeewlfskvLPIEdrltekxayyGTILAQXEXARHGIAGFVDXYF--  118
ident                        |            |           ||          
Sbjct Y------------lpgypalpgGPGL----ppgalpGPEDYRRLMQWLGIDRVIITQGna   69
DSSP  L------------lllllllllLLLL----llllllLHHHHHHHHHHHLLLEEEEELLhh


DSSP  ------LHHHHHHHHHhhlLEEEEEEEEllllllLLLHHHhhHHHHHHHllhhhlEEEEE
Query ------HEEWIAKAVRdfgXRALLTRGLvdsngdDGGRLEenLKLYNEWngfegrIFVGF  172
ident                      |            |    |                 || 
Sbjct hqrdngNTLACVAEMG---EAAHAVVII------DATTTEkdMEKLTAA------GTVGA  114
DSSP  hllllhHHHHHHHHHH---HHEEEEELL------LLLLLHhhHHHHHHL------LEEEE


DSSP  EeLLLL----LLLHhHHHHHHHHHHHHLLLEEEEELLlLLLLLLLHHHHLLLlllLLEEE
Query GpHSPY----LCSEeYLKRVFDTAKSLNAPVTIHLYEtSKEEYDLEDILNIGlkeVKTIA  228
ident                 |  |   |      |             |     |         
Sbjct R-IMDLpggaVNLS-ELDAVDERAHAADWMVAVQFDG-NGLLDHLPRLQKIR---SRWVF  168
DSSP  E-EELLllllLLHH-HHHHHHHHHHHLLLEEEEELLH-HHHHHHHHHHHLLL---LEEEE


DSSP  E-ELLL--------lLHHHHHH-HLLLLEEEEELhhHHHHLL------lLLLL-HHHHHH
Query A-HCVH--------lPERYFGV-LKDIPFFVSHNpaSNLKLG------nGIAP-VQRXIE  271
ident   |                                                |        
Sbjct DhHGKFfkgirtdgpEMAALLKlIDRGNLWFKFA--GVYESSrkswpyaDVAAfSRVIAA  226
DSSP  LhHHHLllllllllhHHHHHHHhHHHLLEEEEEL--LHHHLLllllllhHHHHhHHHHHH


DSSP  LL-lEEEELLLLLLL-------lLLLLhhHHHHHHHHHhhllllllLLHHHHHHHHLHHH
Query HG-xKVTLGTDGAAS-------nNSLNlfFEXRLASLLqkaqnprnLDVNTCLKXVTYDG  323
ident |       ||                       |             |            
Sbjct HApeRIVWGTNWPHNsvretaayPDDA--RLAELTLGW-------lPDEAARHRALVENP  277
DSSP  HLhhHEEELLLLLLLllllhhhlLLHH--HHHHHHHLL-------lLLHHHHHHHHLHHH


DSSP  HHHHLLLLLllllllllleeeeelllhhhllhhhhhhhhhhllllllleeeelleeeeel
Query AQAXGFKSGkieegwnadlvvidldlpexfpvqniknhlvhafsgevfatxvagkwiyfd  383
ident                                                             
Sbjct EALFKLSPV---------------------------------------------------  286
DSSP  HHHHLLLLL---------------------------------------------------


DSSP  lllllllhhhhhhhhhhhhhhhhl
Query geyptidseevkrelariekelys  407
ident                         
Sbjct ------------------------  286
DSSP  ------------------------


No 36: Query=1j6pA Sbjct=2ffiA Z-score=14.4

back to top
DSSP  leeeeeeeeelllllllleeeeeeeelleeeeeeelllllleellleeeEELEEEEEELH
Query hhxiignclilkdfssepfwgaveiengtikrvlqgevkvdldlsgklvXPALFNTHTHA   60
ident                                                         | | 
Sbjct ------------------------------------------------lHLTAIDSHAHV   12
DSSP  ------------------------------------------------lLLLLEELLLLL


DSSP  HhhhhllllllllhhhhhHLLHHHHhllllhhhhhhHHHHHHHHHHLLLEEEEEEEE---
Query PxtllrgvaedlsfeewlFSKVLPIedrltekxayyGTILAQXEXARHGIAGFVDXY---  117
ident                                                ||    |      
Sbjct F--------srglnlasqRRYAPNY---------daPLGDYLGQLRAHGFSHGVLVQpsf   55
DSSP  L--------lhhhhhhllLLLLLLL---------llLHHHHHHHHHHLLLLEELLLLlhh


DSSP  --LLHHHHHHHHHHHL-LEEEEEEeelllllllllHHHHhHHHHHHHLLHhhlEEEEEEE
Query --FHEEWIAKAVRDFG-XRALLTRglvdsngddggRLEEnLKLYNEWNGFegrIFVGFGP  174
ident           |                                  |          |   
Sbjct lgTDNRYLLSALQTVPgQLRGVVX----------lERDVeQATLAEXARL---GVRGVRL  102
DSSP  hlLLLHHHHHHHHHLLlLLLLLLL----------lLLLLlHHHHHHHHLL---LLLEEEL


DSSP  LLLLLLLHHH----hHHHHHHHHHHLLLEEEEELllllllLLLHHHHLLLLL-LLLEEEE
Query HSPYLCSEEY----lKRVFDTAKSLNAPVTIHLYetskeeYDLEDILNIGLK-EVKTIAA  229
ident                             |  |         |                  
Sbjct NLXGQDXPDLtgaqwRPLLERIGEQGWHVELHRQ-----vADIPVLVRALQPyGLDIVID  157
DSSP  LLLLLLLLLLlllllHHHHHHHHHHLLEEEELLL-----lLLHHHHHHHHLLlLLLEEEL


DSSP  -ELLL---------lLHHHHHHHLLLLEEEEELhhHHHHLL-----LLLL---LHHHHHH
Query -HCVH---------lPERYFGVLKDIPFFVSHNpaSNLKLG-----NGIA---PVQRXIE  271
ident                              |         |      |             
Sbjct hFGRPdarrglgqpgFAELLTLSGRGKVWVKVS--GIYRLQgspeeNLAFarqALCALEA  215
DSSP  hHHLLllllllllllHHHHLLLLLLLLEEEEEE--LHHHLLllhhhHHHHhhhHHHHHHH


DSSP  LLL--EEEELLLLLLL----lLLLL-hHHHHHHHHhhhhllllllLLHHHHHHHHLHHHH
Query HGX--KVTLGTDGAAS----nNSLN-lFFEXRLASllqkaqnprnLDVNTCLKXVTYDGA  324
ident |        | |          |                                     
Sbjct HYGaeRLXWGSDWPHTqheseVSFGsaVEQFEALG----------CSAQLRQALLLDTAR  265
DSSP  HLLhhHEEEELLLLLLlllllLLHHhhHHHHHHHL----------LLHHHHHHHHLHHHH


DSSP  HHHLLLLlllllllllleeeeelllhhhllhhhhhhhhhhllllllleeeelleeeeell
Query QAXGFKSgkieegwnadlvvidldlpexfpvqniknhlvhafsgevfatxvagkwiyfdg  384
ident    ||                                                       
Sbjct ALFGFEL-----------------------------------------------------  272
DSSP  HHLLLLL-----------------------------------------------------


DSSP  llllllhhhhhhhhhhhhhhhhl
Query eyptidseevkrelariekelys  407
ident                        
Sbjct ----------------------e  273
DSSP  ----------------------l


No 37: Query=1j6pA Sbjct=2vc5A Z-score=14.3

back to top
DSSP  leeeeeeeeelllllllleeeeeeeelleeeeeeelllllleellleeeeeLEEEEEELH
Query hhxiignclilkdfssepfwgaveiengtikrvlqgevkvdldlsgklvxpALFNTHTHA   60
ident                                                         | | 
Sbjct -----------------------------------mriplvgkdsieskdiGFTLIHEHL   25
DSSP  -----------------------------------llllllllllllhhhlLLEELLLLL


DSSP  HHhhhllllllllhhhhhhllHHHHHL----LLLHHHHHHHHHHHHHHHHLLLEEEEEEE
Query PXtllrgvaedlsfeewlfskVLPIED----RLTEKXAYYGTILAQXEXARHGIAGFVDX  116
ident                                   |                 |    || 
Sbjct RV------------------fSEAVRQqwphLYNEDEEFRNAVNEVKRAMQFGVKTIVDP   67
DSSP  LL------------------lLHHHHHhlhhHLLHHHHHHHHHHHHHHHHHLLLLEEEEL


DSSP  E-----LLHHHHHHHHHHHLLEEEEEEEELL-LLLL----------lllHHHHH-HHHH-
Query Y-----FHEEWIAKAVRDFGXRALLTRGLVD-SNGD----------dggRLEEN-LKLY-  158
ident              | |   |       |                                
Sbjct TvmglgRDIRFMEKVVKATGINLVAGTGIYIyIDLPfyflnrsideiadLFIHDiKEGIq  127
DSSP  LlllllLLHHHHHHHHHLLLLEEEELEELLLlLLLLhhhllllhhhhhhHHHHHhHLLLl


DSSP  -HHHLlhhhleeEEEEeLLLL-----llLHHHHHHHHHHHHHHLLLEEEEELLllLLLL-
Query -NEWNgfegrifVGFGpHSPY-----lcSEEYLKRVFDTAKSLNAPVTIHLYEtsKEEY-  211
ident                              |          |    |   |          
Sbjct gTLNK------aGFVX-IAADepgitkdVEKVIRAAAIANKETKVPIITHSNA--HNNTg  178
DSSP  lLLLL------lLLEE-EELLlllllhhHHHHHHHHHHHHHHHLLLEEEELLL--LLLHh


DSSP  --llHHHHL-LLLLllLEEEEELL-LLLHHHHHHHLLLLEEEEELHHHhhHLLLL-----
Query --dlEDILN-IGLKevKTIAAHCV-HLPERYFGVLKDIPFFVSHNPASnlKLGNG-----  262
ident                 |    |        |     |   |                   
Sbjct leqqRILTEeGVDP-gKILIGHLGdTDNIDYIKKIADKGSFIGLDRYG--LDLFLpvdkr  235
DSSP  hhhhHHHHHlLLLH-hHEEELLHHhLLLHHHHHHHHHLLLEEEELLLL--LLLLLlhhhh


DSSP  llLHHHHHHLLL--EEEELLLLL----------------lllLLLLhhHHHHHHHHHHHl
Query iaPVQRXIEHGX--KVTLGTDGA----------------asnNSLNlfFEXRLASLLQKa  304
ident      | |  |   |     |                      |              | 
Sbjct neTTLRLIKDGYsdKIMISHDYCctidwgtakpeykpklaprWSIT--LIFEDTIPFLK-  292
DSSP  hhHHHHHHHLLLllLEEELLLLLlllllllllhhhhhhhlllLLLL--HHHHLHHHHHH-


DSSP  llLLLLLHHHHHHHHLHHHHHHHLllllllllllllleeeeelllhhhllhhhhhhhhhh
Query qnPRNLDVNTCLKXVTYDGAQAXGfksgkieegwnadlvvidldlpexfpvqniknhlvh  364
ident                                                             
Sbjct --RNGVNEEVIATIFKENPKKFFS------------------------------------  314
DSSP  --LLLLLHHHHHHHHLHHHHHHLL------------------------------------


DSSP  llllllleeeelleeeeellllllllhhhhhhhhhhhhhhhhl
Query afsgevfatxvagkwiyfdgeyptidseevkrelariekelys  407
ident                                            
Sbjct -------------------------------------------  314
DSSP  -------------------------------------------


No 38: Query=1j6pA Sbjct=4hk5D Z-score=14.0

back to top
DSSP  leeeeeeeeelllllllleeeeeeeelleeeeeeelllllleellleeeEELEEEEEELH
Query hhxiignclilkdfssepfwgaveiengtikrvlqgevkvdldlsgklvXPALFNTHTHA   60
ident                                                   |     ||| 
Sbjct -------------------------------------------------TPVVVDIHTHM   11
DSSP  -------------------------------------------------LLLLEEEEEEE


DSSP  H-------------hhhhllllllllhhHHHH-------------------LLHHhhhll
Query P-------------xtllrgvaedlsfeEWLF-------------------SKVLpiedr   88
ident                               |                       |     
Sbjct YppsyiamlekrqtiplvrtfpqadeprLILLsselaaldaaladpaaklpGRPL-----   66
DSSP  LlhhhhhhhhlllllleeeeelleeeeeEELLhhhhhhhhhhhhlllllllLEEL-----


DSSP  llhhhhhHHHHHHHHHHHLLLEEEEEEEE------------------lLHHHHHHHHHHH
Query ltekxayYGTILAQXEXARHGIAGFVDXY------------------fHEEWIAKAVRDF  130
ident                     ||   |                                  
Sbjct ---sthfASLAQKMHFMDTNGIRVSVISLanpwfdflapdeapgiadaVNAEFSDMCAQH  123
DSSP  ---lhhhLLHHHHHHHHHHLLLLEEEEEEllllllllllllhhhhhhhHHHHHHHHHHLL


DSSP  LLEEEEEEEELLLlLLLLLHHHHHHHHHHHHllhhhlEEEEEEElLLLLLL----HHHHH
Query GXRALLTRGLVDSnGDDGGRLEENLKLYNEWngfegrIFVGFGPhSPYLCS----EEYLK  186
ident   |      |  |               |           |                 | 
Sbjct VGRLFFFAALPLS-APVDAVKASIERVKNLK------YCRGIIL-GTSGLGkgldDPHLL  175
DSSP  LLLEEEEEELLLL-LLHHHHHHHHHHHHLLL------LEEEEEE-LLLLLLllllLHHHH


DSSP  HHHHHHHHHLLLEEEEE------------------------lLLLL-LLLLLHH----HH
Query RVFDTAKSLNAPVTIHL------------------------yETSK-EEYDLED----IL  217
ident  ||         |  |                                            
Sbjct PVFEAVADAKLLVFLHPhyglpnevygprseeyghvlplalgFPMEtTIAVARMymagVF  235
DSSP  HHHHHHHHLLLEEEELLlllllhhhhlllhhhlllhhhhhlhHHHHhHHHHHHHhhllHH


DSSP  LLLlLLLLEEEEE-LLLLLHHH-------------------------HHHHLLLLEEEEE
Query NIGlKEVKTIAAH-CVHLPERY-------------------------FGVLKDIPFFVSH  251
ident            ||    ||                                         
Sbjct DHV-RNLQMLLAHsGGTLPFLAgriescivhdghlvktgkvpkdrrtIWTVLKEQIYLDA  294
DSSP  HHL-LLLLEEEHHhHLLHHHHHhhhhhhhhllhhhhhllllllllllHHHHHHHLEEEEL


DSSP  LHHhhhhllllllLHHHHHHLLL--EEEELLLLLLLL--------llllHHHHHHHHHHh
Query NPAsnlklgngiaPVQRXIEHGX--KVTLGTDGAASN--------nslnLFFEXRLASLl  301
ident                |  |          |||                            
Sbjct VIY-------sevGLQAAIASSGadRLMFGTDHPFFPpieedvqgpwdsSRLNAQAVIK-  346
DSSP  LLL-------lhhHHHHHHHHHLhhHEELLLLLLLLLllllllllllhhHHHHHHHHHH-


DSSP  hhlllllLLLH--HHHHHHHLHHHHHHHLLLlllllllLLLLeeeeelllhhhllhhhhh
Query qkaqnprNLDV--NTCLKXVTYDGAQAXGFKsgkieegWNADlvvidldlpexfpvqnik  359
ident                               |                             
Sbjct -------AVGEgsSDAAAVMGLNAVRVLSLK-----aeLEHH------------------  376
DSSP  -------HHLLllHHHHHHHLHHHHHHLLLH-----hhHHHH------------------


DSSP  hhhhhllllllleeeeLLEEeeellllllllhhhhhhhhhhhhhhhhl
Query nhlvhafsgevfatxvAGKWiyfdgeyptidseevkrelariekelys  407
ident                                                 
Sbjct ----------------HHHH----------------------------  380
DSSP  ----------------HHHL----------------------------


No 39: Query=1j6pA Sbjct=2dvtA Z-score=14.0

back to top
DSSP  leeeeeeeeelllllllleeeeeeeelleeeeeeelllllleellleeeeELEEEEEELH
Query hhxiignclilkdfssepfwgaveiengtikrvlqgevkvdldlsgklvxPALFNTHTHA   60
ident                                                           | 
Sbjct -------------------------------------------------mQGKVALEEHF   11
DSSP  -------------------------------------------------lLLEEEEEEEE


DSSP  HhhhhllllllllhhHHHHLLhhhhhllllhhhhhHHHHH-HHHHHHLLLEEEEEEEE--
Query PxtllrgvaedlsfeEWLFSKvlpiedrltekxayYGTIL-AQXEXARHGIAGFVDXY--  117
ident                                                 |||         
Sbjct A---------ipetlQDSAGF-vpgdywkelqhrlLDIQDtRLKLMDAHGIETMILSLna   61
DSSP  L---------lhhhhHHHLLL-llllhhhhhhhhhHLLLLhHHHHHHHLLEEEEEEEEll


DSSP  -----------------lLHHHHHHHHHHH-LLEEeEEEEELLLllLLLLHHHHHHHHHH
Query -----------------fHEEWIAKAVRDF-GXRAlLTRGLVDSngDDGGRLEENLKLYN  159
ident                        |                |     |     ||     |
Sbjct pavqaipdrrkaieiarrANDVLAEECAKRpDRFL-AFAALPLQ--DPDAATEELQRCVN  118
DSSP  lhhhhlllhhhhhhhhhhHHHHHHHHHHHLlLLEE-EEELLLLL--LHHHHHHHHHHHHH


DSSP  HHLlhhhleEEEEEeLLLLL---------LLHH-HHHHHHHHHHHHLLLEEEEE------
Query EWNgfegriFVGFGpHSPYL---------CSEE-YLKRVFDTAKSLNAPVTIHL------  203
ident          |||                                 |  |   |       
Sbjct DLG------FVGAL-VNGFSqegdgqtplYYDLpQYRPFWGEVEKLDVPFYLHPrnplpq  171
DSSP  LLL------LLEEE-EELLLlllllllllLLLLhHHHHHHHHHHHHLLLEEEELllllhh


DSSP  ---------------llLLLL-lLLLHHHH-LLLL---LLLLEEEEE-LLLLLHHH----
Query ---------------yeTSKE-eYDLEDIL-NIGL---KEVKTIAAH-CVHLPERY----  238
ident                     |                      |  |    ||       
Sbjct dsriydghpwllgptwaFAQEtaVHALRLMaSGLFdehPRLNIILGHmGEGLPYMMwrid  231
DSSP  hlhhhlllhhhlhhhlhHHHHhhHHHHHHHhLLHHhhlLLLLEEELHhHLLHHHHHhhhh


DSSP  -----------------hHHHLLLLEEEEELHHhhhhllllllLHHHHHHLLL--EEEEL
Query -----------------fGVLKDIPFFVSHNPAsnlklgngiaPVQRXIEHGX--KVTLG  279
ident                          |                      |           
Sbjct hrnawvklpprypakrrfMDYFNENFHITTSGN------frtqTLIDAILEIGadRILFS  285
DSSP  hllllllllllllllllhHHHHHHHEEEELLLL------llhhHHHHHHLLLLhhHEELL


DSSP  LLLLlLLLLllhHHHHHHHHHHhhlllllLLLHHHHHHHHLHHHHHHHLLLlllllllll
Query TDGAaSNNSlnlFFEXRLASLLqkaqnprNLDVNTCLKXVTYDGAQAXGFKsgkieegwn  339
ident ||     |                             |                      
Sbjct TDWP-FENI---DHASDWFNAT-------SIAEADRVKIGRTNARRLFKLD---------  325
DSSP  LLLL-LLLH---HHHHHHHHHL-------LLLHHHHHHHHLHHHHHHLLLL---------


DSSP  lleeeeelllhhhllhhhhhhhhhhllllllleeeelleeeeellllllllhhhhhhhhh
Query adlvvidldlpexfpvqniknhlvhafsgevfatxvagkwiyfdgeyptidseevkrela  399
ident                                                             
Sbjct ------------------------------------------------------------  325
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhl
Query riekelys  407
ident         
Sbjct --------  325
DSSP  --------


No 40: Query=1j6pA Sbjct=4ofcA Z-score=13.9

back to top
DSSP  leeeeeeeeelllllllleeeeeeeelleeeeeeelllllleellleeeeelEEEEEELH
Query hhxiignclilkdfssepfwgaveiengtikrvlqgevkvdldlsgklvxpaLFNTHTHA   60
ident                                                         | | 
Sbjct ---------------------------------------------------mKIDIHSHI    9
DSSP  ---------------------------------------------------lLEEEEEEL


DSSP  H----------------hhhhllllllllhhhhhhLLHHhhhllllhhhhhHHHHHHHHH
Query P----------------xtllrgvaedlsfeewlfSKVLpiedrltekxayYGTILAQXE  104
ident                                                            |
Sbjct LpkewpdlkkrfgyggwvqlqhhskgeakllkdgkVFRV-------vrencWDPEVRIRE   62
DSSP  LllllllhhhhhllllleeeeeeelleeeeeelleEEEE-------eehhhLLHHHHHHH


DSSP  HHLLLEEEEEEEE-------------------lLHHHHHHHHHHH-LLEEeEEEEELLll
Query XARHGIAGFVDXY-------------------fHEEWIAKAVRDF-GXRAlLTRGLVDsn  144
ident     |                                 |  |             |    
Sbjct MDQKGVTVQALSTvpvmfsywakpedtlnlcqlLNNDLASTVVSYpRRFV-GLGTLPM--  119
DSSP  HHHHLLLEEEEELlhhhhlllllhhhhhhhhhhHHHHHHHHHHHLlLLEE-EEELLLL--


DSSP  LLLLLHHHHHHHHHHHHLlhhhleEEEEEElLLLL----llHHHHHHHHHHHHHHLLLEE
Query GDDGGRLEENLKLYNEWNgfegriFVGFGPhSPYL----csEEYLKRVFDTAKSLNAPVT  200
ident         |      |        | |                 |  |   |  |     
Sbjct QAPELAVKEMERCVKELG------FPGVQI-GTHVnewdlnAQELFPVYAAAERLKCSLF  172
DSSP  LLHHHHHHHHHHHHHLLL------LLEEEE-ELEElleellLHHHHHHHHHHHHHLLEEE


DSSP  EEE--------------llLLLL----lLLLHHHH-LLLL---LLLLEEEEE-LLLLLHH
Query IHL--------------yeTSKE----eYDLEDIL-NIGL---KEVKTIAAH-CVHLPER  237
ident  |                                            |   ||     |  
Sbjct VHPwdmqmdgrmakywlpwLVGMpaettIAICSMImGGVFekfPKLKVCFAHgGGAFPFT  232
DSSP  EELllllllhhhhlllhhhHLHHhhhhhHHHHHHHlLLHHhhlLLLLEEELHhHLLHHHH


DSSP  H---------------------hHHHLLLlEEEEELHHhhhhllllllLHHHHHHLLL--
Query Y---------------------fGVLKDIpFFVSHNPAsnlklgngiaPVQRXIEHGX--  274
ident                               |                             
Sbjct VgrishgfsmrpdlcaqdnpmnpKKYLGS-FYTDALVH-------dplSLKLLTDVIGkd  284
DSSP  HhhhhhhhhhlhhhhlllllllhHHHLLL-LEEELLLL-------lhhHHHHHHHHHLll


DSSP  EEEELLLLLL-LLLLllhhHHHHHHHHHhhllllLLLLHHHHHHHHLHHHHHHHLLLlll
Query KVTLGTDGAA-SNNSlnlfFEXRLASLLqkaqnpRNLDVNTCLKXVTYDGAQAXGFKsgk  333
ident || ||||                |             |  |  |          |     
Sbjct KVILGTDYPFpLGEL----EPGKLIESM------EEFDEETKNKLKAGNALAFLGLE---  331
DSSP  LEELLLLLLLlLLLL----LLLHHHHHL------LLLLHHHHHHHHLHHHHHHHLLL---


DSSP  lllllLLLEeeeelllhhhllhhhhhhhhhhllllllleeeelleeeeellllllllhhh
Query ieegwNADLvvidldlpexfpvqniknhlvhafsgevfatxvagkwiyfdgeyptidsee  393
ident                                                             
Sbjct -----RKQF---------------------------------------------------  335
DSSP  -----HHHL---------------------------------------------------


DSSP  hhhhhhhhhhhhhl
Query vkrelariekelys  407
ident               
Sbjct --------------  335
DSSP  --------------


No 41: Query=1j6pA Sbjct=2qpxA Z-score=13.7

back to top
DSSP  leeeeeeeeelllllllleeeeeeeelleeeeeeelllllleellleeeEELEEEEEELh
Query hhxiignclilkdfssepfwgaveiengtikrvlqgevkvdldlsgklvXPALFNTHTHa   60
ident                                                     |   | | 
Sbjct ---------------------------------------gxddlsefvdQVPLLDHHCH-   20
DSSP  ---------------------------------------lllllhhhhhHLLEEEEEEL-


DSSP  HHHH-----hllLLLL-lLHHH-------------------hhhllhhhhhllllhhhhh
Query PXTL-----lrgVAED-lSFEE-------------------wlfskvlpiedrltekxay   95
ident                                                             
Sbjct FLIDgkvpnrddRLAQvsTEADkdypladtknrlayhgflalakefaldannplaaxndp   80
DSSP  LLLLlllllhhhHHHHhlLLLLllllhhhhlllhhhhhhhhhhhhhllllllllllllhh


DSSP  hhhhHHHHHHHLLLEEEEEEEEL-----lhhHHHHHHHHHLLEEEEEEEELLlllLLLL-
Query ygtiLAQXEXARHGIAGFVDXYF-----heeWIAKAVRDFGXRALLTRGLVDsngDDGG-  149
ident                                         |        |          
Sbjct gyatYNHRIFGHFHFKELLIDTGfvpddpilDLDQTAELVGIPVKAIYRLET--hAEDFx  138
DSSP  hhhhHHHHHHHHLLEEEEEEELLllllllllLHHHHHHHHLLLEEEEEEHHH--hHHHHh


DSSP  ------------hHHHHHHHHHHHllhhhleEEEEEELLLLL------------------
Query ------------rLEENLKLYNEWngfegriFVGFGPHSPYL------------------  179
ident                                ||||     |                   
Sbjct lehdnfaawwqafSNDVKQAKAHG-------FVGFXSIAAYRvglhlepvnvieaaagfd  191
DSSP  lllllhhhhhhhhHHHHHLLLLLL-------LLLEEELHHHHlllllllllhhhhhhhhh


DSSP  --------------lLHHHHHHHHHHHHHHLLLEEEEELLL---LLLLL----LLHHHHL
Query --------------cSEEYLKRVFDTAKSLNAPVTIHLYET---SKEEY----DLEDILN  218
ident                    |  |         |   |                   | | 
Sbjct twkhsgekrltskplIDYXLYHVAPFIIAQDXPLQFHVGYGdadTDXYLgnplLXRDYLK  251
DSSP  hhhhhlllllllhhhHHHHHHHHHHHHHHHLLLEEEEELLLlllLLHHHllhhHHHHHHH


DSSP  LLLL-LLLEEEEELLLLlhhhHHHHLL-LLEEEEEL--HHHHHhllllllLHHHHHHLLL
Query IGLK-EVKTIAAHCVHLperyFGVLKD-IPFFVSHN--PASNLklgngiaPVQRXIEHGX  274
ident    |   |    ||                                          |   
Sbjct AFTKkGLKVVLLHCYPYhreaGYLASVfPNLYFDISllDNLGP--sgasrVFNEAVELAP  309
DSSP  HHHHhLLLEEEEELLLLhhhhHHHHHHlLLEEEELLlhHHHLH--hhhhhHHHHHLLLLL


DSSP  --EEEELLLLLLllLLLL-HHHHHHHHHHHHHlLLLL----llLHHHHHHHHLHHHHHHH
Query --KVTLGTDGAAsnNSLN-LFFEXRLASLLQKaQNPR----nlDVNTCLKXVTYDGAQAX  327
ident         |                 |                             |   
Sbjct ytRILFASDASTypEXYGlAARQFKQALVAHF-NQLPfvdlaqKKAWINAICWQTSAKLY  368
DSSP  hhHEELLLLLLLlhHHHHhHHHHHHHHHHHHH-HLLLlllhhhHHHHHHHHHLHHHHHHL


DSSP  LLL-LLLLllllllleeeeelllhhhllhhhhhhhhhhllllllleeeelleeeeellll
Query GFK-SGKIeegwnadlvvidldlpexfpvqniknhlvhafsgevfatxvagkwiyfdgey  386
ident                                                             
Sbjct HQErELRV----------------------------------------------------  376
DSSP  LLHhHHLL----------------------------------------------------


DSSP  llllhhhhhhhhhhhhhhhhl
Query ptidseevkrelariekelys  407
ident                      
Sbjct ---------------------  376
DSSP  ---------------------


No 42: Query=1j6pA Sbjct=1v77A Z-score=13.7

back to top
DSSP  leeeeeeeeelllllllleeeeeeeelleeeeeeelllllleellleeeeELEEEEEELH
Query hhxiignclilkdfssepfwgaveiengtikrvlqgevkvdldlsgklvxPALFNTHTHA   60
ident                                                             
Sbjct --------------------------------------------------VKFIEMDIRD   10
DSSP  --------------------------------------------------LLLEEEEELL


DSSP  HhhhhllllllllhhhhhhllhhhhhllllhhhhhhhhhHHHHHHHLLlEEEEEEEellh
Query PxtllrgvaedlsfeewlfskvlpiedrltekxayygtiLAQXEXARHgIAGFVDXyfhe  120
ident                                         |            |      
Sbjct K--------------------------------------EAYELAKEW-FDEVVVS----   27
DSSP  H--------------------------------------HHHHHHHHH-LLEEEEE----


DSSP  hhhhhhhhhhlleeeeeEEELLlllllllHHHHhhHHHHHHLLHhhlEEEEEEELLlllL
Query ewiakavrdfgxralltRGLVDsngddggRLEEnlKLYNEWNGFegrIFVGFGPHSpylC  180
ident                                        |         |          
Sbjct -----------------IKFNE-------EVDK--EKLREARKE--yGKVAILLSN---P   56
DSSP  -----------------EEELL-------LLLH--HHHHHHHHH--hLLEEEEEEL---L


DSSP  LHHHHHHHHHHHHhhLLLEEEEElllllLLLL-LHHHHLLLLllllEEEEELL-----LL
Query SEEYLKRVFDTAKslNAPVTIHLyetskEEYD-LEDILNIGLkevkTIAAHCV-----HL  234
ident             |                           |                   
Sbjct KPSLVRDTVQKFK--SYLIYVES-----NDLRvIRYSIEKGV----DAIISPWvnrkdPG  105
DSSP  LHHHHHHHHHHLL--LLEEEEEL-----LLHHhHHHHHHLLL----LEEELLLlllllLL


DSSP  LH-HHHHHHLLLLEEEEELhHHHHHLL-------LLLL---LHHHHHHLLLEEEELLLLL
Query PE-RYFGVLKDIPFFVSHNpASNLKLG-------NGIA---PVQRXIEHGXKVTLGTDGA  283
ident                        |                              |     
Sbjct IDhVLAKLMVKKNVALGFS-LRPLLYSnpyeranLLRFmmkAWKLVEKYKVRRFLTSSAQ  164
DSSP  LLhHHHHHHHHHLLEEEEE-LHHHHHLlhhhhhhHHHHhhhHHHHHHHHLLLEEEELLLL


DSSP  LllLLLLHH-HHHHHHHHHHhllllllLLHHHHHHHHLHHHHHHHLllllllllllllle
Query AsnNSLNLF-FEXRLASLLQkaqnprnLDVNTCLKXVTYDGAQAXGfksgkieegwnadl  342
ident               |                                             
Sbjct E-kWDVRYPrDLISLGVVIG-------MEIPQAKASISMYPEIILK--------------  202
DSSP  L-hHHLLLHhHHHHHHHHLL-------LLHHHHHHLLLHHHHHHHL--------------


DSSP  eeeelllhhhllhhhhhhhhhhllllllleeeelleeeeellllllllhhhhhhhhhhhh
Query vvidldlpexfpvqniknhlvhafsgevfatxvagkwiyfdgeyptidseevkrelarie  402
ident                                                             
Sbjct ------------------------------------------------------------  202
DSSP  ------------------------------------------------------------


DSSP  hhhhl
Query kelys  407
ident      
Sbjct -----  202
DSSP  -----


No 43: Query=1j6pA Sbjct=4qrnA Z-score=13.7

back to top
DSSP  leeeeeeeeelllllllleeeeeeeelleeeeeeelllllleellleEEEELEEEEEELH
Query hhxiignclilkdfssepfwgaveiengtikrvlqgevkvdldlsgkLVXPALFNTHTHA   60
ident                                                        |    
Sbjct -------------------------------------smtqdlktggEQGYLRIATEEAF   23
DSSP  -------------------------------------llllllllllLLLLLLEEEEEEE


DSSP  H----hhhhllllllllhHHHHhLLHHHHHLL------llhhhhhHHHH-HHHHHHHLLL
Query P----xtllrgvaedlsfEEWLfSKVLPIEDR------ltekxayYGTI-LAQXEXARHG  109
ident                                                            |
Sbjct AtreiidvylrmirdgtaDKGM-VSLWGFYAQspseratqilerlLDLGeRRIADMDATG   82
DSSP  LlhhhhhhhhhhhhhlllLHHH-HHHHHHHHHlllhhhhhhhhhhHLLLhHHHHHHHHLL


DSSP  EEEEEEEE-------------------lLHHHHHHHHHHHLLEEEEEEEELLLllLLLLH
Query IAGFVDXY-------------------fHEEWIAKAVRDFGXRALLTRGLVDSngDDGGR  150
ident |                                | |      |            |    
Sbjct IDKAILALtspgvqplhdldeartlatrANDTLADACQKYPDRFIGMGTVAPQ--DPEWS  140
DSSP  LLEEEEEEllllllllllhhhhhhhhhhHHHHHHHHHHHLLLLEEELLLLLLL--LHHHH


DSSP  HHHHHHHHHHHLlhhhleEEEEEElLLLL-----lLHHHhHHHHHHHHHHLLLEEEEE--
Query LEENLKLYNEWNgfegriFVGFGPhSPYL-----cSEEYlKRVFDTAKSLNAPVTIHL--  203
ident   |      |        | |               |      |        |  ||   
Sbjct AREIHRGARELG------FKGIQI-NSHTqgryldEEFF-DPIFRALVEVDQPLYIHPat  192
DSSP  HHHHHHHHHLLL------LLLEEE-LLLLllllllLHHH-HHHHHHHHHHLLLEEELLll


DSSP  ------------------llLLLL-lLLLHHHH-LLLL---LLLLEEEEE-LLLLLHHH-
Query ------------------yeTSKE-eYDLEDIL-NIGL---KEVKTIAAH-CVHLPERY-  238
ident                        |    |                    |    ||    
Sbjct spdsmidpmleagldgaifgFGVEtgMHLLRLItIGIFdkyPSLQIMVGHmGEALPYWLy  252
DSSP  llllllhhhhhhlllllllhHHHHhhHHHHHHHhHLHHhhlLLLLEEELHhHHLHHHHHh


DSSP  ------------------------hHHHLLLLEEEEELHHhhhhllllllLHHHHHHLLL
Query ------------------------fGVLKDIPFFVSHNPAsnlklgngiaPVQRXIEHGX  274
ident                                   |                         
Sbjct rldymhqagvrsqryermkplkktiEGYLKSNVLVTNSGV------awepAIKFCQQVMG  306
DSSP  hhhhhhhhhhhlllllllllllllhHHHHHHLEEEELLLL------llhhHHHHHHHHHL


DSSP  --EEEELLLLLlLLLLllhHHHHHHHHHHhhlllllLLLHHHHHHHHLHHHHHHHLLlll
Query --KVTLGTDGAaSNNSlnlFFEXRLASLLqkaqnprNLDVNTCLKXVTYDGAQAXGFksg  332
ident    |    |            | |                 |  |               
Sbjct edRVMYAMDYP-YQYV---ADEVRAMDAM-------DMSAQTKKKFFQTNAEKWFKL---  352
DSSP  hhHEELLLLLL-LLLL---HHHHHHHHLL-------LLLHHHHHHHHLHHHHHHLLL---


DSSP  llllllllleeeeelllhhhllhhhhhhhhhhllllllleeeelleeeeellllllllhh
Query kieegwnadlvvidldlpexfpvqniknhlvhafsgevfatxvagkwiyfdgeyptidse  392
ident                                                             
Sbjct ------------------------------------------------------------  352
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhhhhhhhhl
Query evkrelariekelys  407
ident                
Sbjct ---------------  352
DSSP  ---------------


No 44: Query=1j6pA Sbjct=2gwgA Z-score=13.6

back to top
DSSP  leeeeeeeeelllllllleeeeeeeelleeeeeeelllllleellleeeeeLEEEEEELh
Query hhxiignclilkdfssepfwgaveiengtikrvlqgevkvdldlsgklvxpALFNTHTHa   60
ident                                                         | | 
Sbjct ---------------------------------------------------XIIDIHGH-    8
DSSP  ---------------------------------------------------LLEEEEEE-


DSSP  HHHHhllllllllhhhhhhllhhHHHL----------------------LLLHHHHHHHH
Query PXTLlrgvaedlsfeewlfskvlPIED----------------------RLTEKXAYYGT   98
ident   |                                                         
Sbjct YTTA------------------pKALEdwrnrqiagikdpsvxpkvselKISDDELQASI   50
DSSP  LLLL------------------lHHHHhhhhhhhhhhhlhhhlllhhhlLLLHHHHHHHH


DSSP  H-HHHHHHHLLLEEEEEEEE-------------lLHHHHHHHHHHHLLEEEEEEEE-LLL
Query I-LAQXEXARHGIAGFVDXY-------------fHEEWIAKAVRDFGXRALLTRGL-VDS  143
ident |      |   |    |                   |        |         |    
Sbjct IeNQLKKXQERGSDLTVFSPragdfnvsstwaaiCNELCYRVSQLFPDNFIGAAXLpQSP  110
DSSP  HlLHHHHHHHHLLLEEEEELllllhhhhhhhhhhHHHHHHHHHHHLLLLEEEEEELlLLL


DSSP  LLLLLLHHHHHHHHHHHHLlhhhleEEEEEElLLLL---------llHHHHHHHHHHHHH
Query NGDDGGRLEENLKLYNEWNgfegriFVGFGPhSPYL---------csEEYLKRVFDTAKS  194
ident   |      |  |   |        ||      |                          
Sbjct GVDPKTCIPELEKCVKEYG------FVAINL-NPDPsgghwtsppltDRIWYPIYEKXVE  163
DSSP  LLLHHHHHHHHHHHHHLLL------LLEEEE-LLLLlllllllllllLHHHHHHHHHHHH


DSSP  HLLLEEEE-----eLLLL---llLLLL-HHHHLLLlLLLLEEEEE-LLLL----------
Query LNAPVTIH-----lYETS---keEYDL-EDILNIGlKEVKTIAAH-CVHL----------  234
ident |  |  ||      |              |       | |    |               
Sbjct LEIPAXIHvstgahYLNAdttafXQCVaGDLFKDF-PELKFVIPHgGGAVpyhwgrfrgl  222
DSSP  HLLLEEELlllllhHHHHhhhhhHHHHhLLHHHHL-LLLLEEELHhHLLLhhhhhhhhhh


DSSP  -----lhHHHHHHLlLLEEEEELHHhhhhllllllLHHHHHhllLEEEELLLLLLLLL--
Query -----peRYFGVLKdIPFFVSHNPAsnlklgngiaPVQRXIehgXKVTLGTDGAASNN--  287
ident                   |                           |             
Sbjct aqexkkpLLEDHVL-NNIFFDTCVY---hqpgidlLNTVIP--vDNVLFASEXIGAVRgi  276
DSSP  hhhllllLHHHHLL-LLEEEELLLL---lhhhhhhHHHHLL--hHHEELLLLLLLLLLle


DSSP  ----lllhhHHHHHHHHHhhllllLLLLHHHHHHHHLHHHHHHH--LLLLLlllllLLLL
Query ----slnlfFEXRLASLLqkaqnpRNLDVNTCLKXVTYDGAQAX--GFKSGkieegWNAD  341
ident             |             |                                 
Sbjct dprtgfyydDTKRYIEAS------TILTPEEKQQIYEGNARRVYprLDAAL-----KAKG  325
DSSP  elllleellLLHHHHHHL------LLLLHHHHHHHHLHHHHHHLhhHHHHH-----HHHH


DSSP  eeeeelllhhhllhhhhhhhhhhllllllleeeelleeeeellllllllhhhhhhhhhhh
Query lvvidldlpexfpvqniknhlvhafsgevfatxvagkwiyfdgeyptidseevkrelari  401
ident                                                             
Sbjct ------------------------------------------------------------  325
DSSP  ------------------------------------------------------------


DSSP  hhhhhl
Query ekelys  407
ident       
Sbjct --kleh  329
DSSP  --hhll


No 45: Query=1j6pA Sbjct=2a3lA Z-score=13.1

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct qpdpiaadilrkepeqetfvrlnvplevptsdeveaykclqeclelrkryvfqetvapwe   60
DSSP  llllllllllllllllllllllllllllllllllllhhhhhhhhhhhhllllllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct keepfahypqgksdhcfemqdgvvhvfankdakedlfpvadatafftdlhhvlkviaagn  120
DSSP  lllllllllllllllllllllllllllllllllllllllllhhhhhhhhhhhhhhlllhh


DSSP  --------------------------leeeeeEEEELLlllllleeeeeeeelleeeeee
Query --------------------------hhxiigNCLILKdfssepfwgaveiengtikrvl   34
ident                                                             
Sbjct irtlchrrlvlleqkfnlhlmlnadkeflaqkSAPHRD----------------------  158
DSSP  hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhHLLLLL----------------------


DSSP  elllllleellleeeEELEEEEEELHHHHHHLL---------------------------
Query qgevkvdldlsgklvXPALFNTHTHAPXTLLRG---------------------------   67
ident                      || |                                   
Sbjct -------------fyNVRKVDTHVHHSACMNQKhllrfiksklrkepdevvifrdgtylt  205
DSSP  -------------llLLLEEEEEEELLLLLLHHhhhhhhhhhhhllllllleeelleeel


DSSP  ---------------LLLL---------llhHHHHHL-----lhhHHHL-LLLH------
Query ---------------VAED---------lsfEEWLFS-----kvlPIED-RLTE------   91
ident                                                    |        
Sbjct lrevfesldltgydlNVDLldvhadkstfhrFDKFNLkynpcgqsRLREiFLKQdnliqg  265
DSSP  hhhhhhhhlllllllLLLLllllllllllllLLLLHHhhllllllHHHHhHLLLllllll


DSSP  HHHHHHHHHHHHHHH-LLLEeEEEEEEL-------------lhhhhhHHHHhhLLEEeEE
Query KXAYYGTILAQXEXA-RHGIaGFVDXYF-------------heewiaKAVRdfGXRAlLT  137
ident       |                                                     
Sbjct RFLGEITKQVFSDLEaSKYQ-MAEYRISiygrkmsewdqlaswivnnDLYS--ENVV-WL  321
DSSP  LLHHHHHHHHHHHHLlLLLE-EEEEEEElllllllhhhhhhhhhhllLLLL--LLEE-EE


DSSP  EEE-LLLL----------LLLL--LHHH---------hhhhhhHHHLLhhhlEEEEEEEL
Query RGL-VDSN----------GDDG--GRLE---------enlklyNEWNGfegrIFVGFGPH  175
ident   |    |                                              |||   
Sbjct IQLpRLYNiykdmgivtsFQNIldNIFIplfeatvdpdshpqlHVFLK----QVVGFDLV  377
DSSP  EEEeLLHHhhllllllllLHHHhhHHLLhhhhhhhlhhhllllHHHHL----LEEEEEEE


DSSP  L----------------------llllLHHHHHHHHHHHHHHL----------LLEEEEE
Query S----------------------pylcSEEYLKRVFDTAKSLN----------APVTIHL  203
ident                               |          ||               | 
Sbjct DdeskperrptkhmptpaqwtnafnpaFSYYVYYCYANLYVLNklreskgmttITLRPHS  437
DSSP  LllllllllllllllllllllllllllHHHHHHHHHHHHHHHHhhhlllllllLEELLLL


DSSP  LLLllLLLL-LHHHHLLllllllEEEEELLLLLHH--HHHHHLLLLEEEEELHHHHHhLL
Query YETskEEYD-LEDILNIglkevkTIAAHCVHLPER--YFGVLKDIPFFVSHNPASNLkLG  260
ident  |      | |               ||   |                    | ||    
Sbjct GEA--GDIDhLAATFLT-----cHSIAHGINLRKSpvLQYLYYLAQIGLAMSPLSNN-SL  489
DSSP  LLL--LLLHhHHHHHHH-----lLLLLLLHHHHHLhhHHHHHHHHLLLEEELHHHHL-LL


DSSP  LL---LLLHHHHHHLLLEEEELLLLLLLLL--llLHHHHHHHHHHHHHllllllLLHHHH
Query NG---IAPVQRXIEHGXKVTLGTDGAASNN--slNLFFEXRLASLLQKaqnprnLDVNTC  315
ident        |       |  | | ||           |  |   |    |      |     
Sbjct FLdyhRNPFPVFFLRGLNVSLSTDDPLQIHltkePLVEEYSIAASVWK------LSACDL  543
DSSP  LLlllLLLHHHHHHLLLLEEELLLLHHHHLllllHHHHHHHHHHHHHL------LLHHHH


DSSP  HHHHlHHHHHHHLLL-----lLLLLlllllleeeeelllhhhllhhhhhhhhhhllllll
Query LKXVtYDGAQAXGFK-----sGKIEegwnadlvvidldlpexfpvqniknhlvhafsgev  370
ident             ||                                              
Sbjct CEIA-RNSVYQSGFShalkshWIGK-----------------------dyykrgpdgndi  579
DSSP  HHHH-HHHHHHLLLLhhhhhhHLLL-----------------------llllllhhhllh


DSSP  leeeelleeeeellllllllhhhhhhhhhhhhhhhhl
Query fatxvagkwiyfdgeyptidseevkrelariekelys  407
ident                                      
Sbjct hktnvphirvefrdtiwkeemqqvylgkavisdevvp  616
DSSP  hhhlllhhhhhhhhhhhhhhhhhhlllllllllllll


No 46: Query=1j6pA Sbjct=3pnuA Z-score=13.0

back to top
DSSP  leeeeeeeeelllllllleeeeeeeelleeeeeeelllllleELLL-EEEEELEEEEEEL
Query hhxiignclilkdfssepfwgaveiengtikrvlqgevkvdlDLSG-KLVXPALFNTHTH   59
ident                                                          | |
Sbjct ---------------------------------------enlYFQSnAMKLKNPLDMHLH   21
DSSP  ---------------------------------------lllLLLLlLEEEELLEEEEEL


DSSP  HHhhhhllllllllhhhhhhllhhhhhllllhhhHHHHHHHHHHHHHLLlEEEEEEEEL-
Query APxtllrgvaedlsfeewlfskvlpiedrltekxAYYGTILAQXEXARHgIAGFVDXYF-  118
ident                                         |     ||      |     
Sbjct LR--------------------------------DNQMLELIAPLSARD-FCAAVIMPNl   48
DSSP  LL--------------------------------LHHHHHHHHHHHHLL-LLEEEELLLl


DSSP  --------LHHHHHHHHHHHL----LEEEEEEEELLlllllllhhHHHHHhHHHHllhhh
Query --------HEEWIAKAVRDFG----XRALLTRGLVDsngddggrlEENLKlYNEWngfeg  166
ident                             | |                             
Sbjct ipplcnleDLKAYKMRILKACkdenFTPLMTLFFKN------ydeKFLYS-AKDE-----   96
DSSP  llllllhhHHHHHHHHHHHHHllllLEEEEEEELLL------llhHHHHH-HLLL-----


DSSP  leEEEEEeLLLL--------LLLH---HHHHHHHHHHHHHLLLEEEEEL----llLLLLL
Query riFVGFGpHSPY--------LCSE---EYLKRVFDTAKSLNAPVTIHLY----etSKEEY  211
ident     |     |           |    ||||        || |   |          |  
Sbjct --IFGIX-LYPAgittnsngGVSSfdiEYLKPTLEAMSDLNIPLLVHGEtndfvmDRESN  153
DSSP  --LLEEE-ELLLllllllllLLLLllhHHHHHHHHHHHHLLLLEEELLLllllhhHLLHH


DSSP  ---LLHHHHLLLlLLLLEEEEELLLLL-HHHHHHHllLLEEEEELHHHHHH---------
Query ---DLEDILNIGlKEVKTIAAHCVHLP-ERYFGVLkdIPFFVSHNPASNLK---------  258
ident      |          |    |                                      
Sbjct fakIYEKLAKHF-PRLKIVMEHITTKTlCELLKDY--ENLYATITLHHLIItlddviggk  210
DSSP  hhhHHHHHHHHL-LLLLEEELLLLLHHhHHHHHHL--LLEEEEELLHHHLLlhhhhhlll


DSSP  --------LLLL----LLLHHHHH-hlLLEEEELLLLLL-------LLLLL-LHHHHHHH
Query --------LGNG----IAPVQRXI-ehGXKVTLGTDGAA-------SNNSL-NLFFEXRL  297
ident                              ||  | | |           |          
Sbjct mnphlfckPIAKryedKEALCELAfsgYEKVMFGSDSAPhpkgcaaGVFSApVILPVLAE  270
DSSP  llhhhlllLLLLlhhhHHHHHHHHhllLLLEEELLLLLLlllllllLLLLHhHHHHHHHH


DSSP  HHHhhhlllllLLLHHHHHHHHLHHHHHHHLLLLllllllLLLLEEEEElLLHHhllhhh
Query ASLlqkaqnprNLDVNTCLKXVTYDGAQAXGFKSgkieegWNADLVVIDlDLPExfpvqn  357
ident            |       |            |                           
Sbjct LFK-------qNSSEENLQKFLSDNTCKIYDLKF------KEDKILTLE-EKEW------  310
DSSP  HHH-------hHLLHHHHHHHHLHHHHHHHLLLL------LLLLEEEEE-LLLE------


DSSP  hhhhhhhllllllleeeelleeeeellllllllhhhHHHHHH--------hhhhhhhl
Query iknhlvhafsgevfatxvagkwiyfdgeyptidseeVKRELA--------riekelys  407
ident                                                           
Sbjct ------------------------------qvpnvyEDKYNQvvpymageilkfqlkh  338
DSSP  ------------------------------elllleELLLLEellllllleelleell


No 47: Query=1j6pA Sbjct=4dziC Z-score=12.3

back to top
DSSP  leeeeeeeeelllllllleeeeeeeelleeeeeeelllllleellleeeEELEEEEEELH
Query hhxiignclilkdfssepfwgaveiengtikrvlqgevkvdldlsgklvXPALFNTHTHA   60
ident                                                           | 
Sbjct -----------------------------------------------alNYRVIDVDNHY   13
DSSP  -----------------------------------------------llLLLEEEEEEEL


DSSP  H------------------hhhhllllllllhhhhhhLLHHHHhLLLL------------
Query P------------------xtllrgvaedlsfeewlfSKVLPIeDRLT------------   90
ident                                          |                  
Sbjct YepldsftrhldkkfkrrgvqmlsdgkrtwavigdrvNHFIPN-PTFDpiivpgcldllf   72
DSSP  LlllllllllllhhhlllleeeeelllleeeeelleeLLLLLL-LLLLleelllllhhhh


DSSP  --------------------hhhhhHHHHHHHHHHHLLLEEEEEEEE-------------
Query --------------------ekxayYGTILAQXEXARHGIAGFVDXY-------------  117
ident                                        |                    
Sbjct rgeipdgvdpaslmkverladhpeyQNRDARIAVMDEQDIETAFMLPtfgcgveealkhd  132
DSSP  hllllllllhhhllleelhhhlhhhLLHHHHHHHHHHHLEEEEEEELlhhhhhhhhllll


DSSP  ------------lLHHHHHHhHHHHlLEEEEEEEELLllLLLLLHHHHHHHHHHHHLlhh
Query ------------fHEEWIAKaVRDFgXRALLTRGLVDsnGDDGGRLEENLKLYNEWNgfe  165
ident                       |    |            |     ||            
Sbjct ieatmasvhafnlWLDEDWGfDRPD-HRIIAAPIVSL--ADPTRAVEEVDFVLARGA---  186
DSSP  hhhhhhhhhhhhhHHHHHLLlLLLL-LLEEELLLLLL--LLHHHHHHHHHHHHHLLL---


DSSP  hleeEEEEELLLLL------lLHHH--hHHHHHHHHHHLLLEEEEE--------------
Query grifVGFGPHSPYL------cSEEY--lKRVFDTAKSLNAPVTIHL--------------  203
ident                      |        |         ||  ||              
Sbjct ----KLVLVRPAPVpglvkprSLGDrshDPVWARLAEAGVPVGFHLsdsgylhiaaawgg  242
DSSP  ----LLEELLLLLLlllllllLLLLhhhHHHHHHHHHHLLLEEEELlllllhhhhhhlll


DSSP  ------lllLLLLL---lLHHHH-LLLL---LLLLEEEEE-LLLLLHHHH----------
Query ------yetSKEEY---dLEDIL-NIGL---KEVKTIAAH-CVHLPERYF----------  239
ident                                   |            |            
Sbjct akdpldqvlLDDRAihdtMASMIvHGVFtrhPKLKAVSIEnGSYFVHRLIkrlkkaantq  302
DSSP  lllhhhhhhHLLHHhhhhHHHHHhLLHHhhlLLLLEEEELlLLLHHHHHHhhhhhhhhhl


DSSP  ---------HHHLlLLEEEEELHhhhhhllllLLLHHHHHHLLL--EEEELLLLLL-LLL
Query ---------GVLKdIPFFVSHNPasnlklgngIAPVQRXIEHGX--KVTLGTDGAA-SNN  287
ident            |                                  |   | |       
Sbjct pqyfpedpvEQLR-NNVWIAPYY---------EDDLPELARVIGvdKILFGSDWPHgEGL  352
DSSP  hhhllllhhHHHH-HHEEELLLL---------LLLHHHHHHHHLhhHLLLLLLLLLlLLL


DSSP  LlLHHHHhHHHHHhhhlllllLLLHHHHHHHHLHHHHHHHLllllllllllllleeeeel
Query SlNLFFExRLASLlqkaqnprNLDVNTCLKXVTYDGAQAXGfksgkieegwnadlvvidl  347
ident                              |          |                   
Sbjct A-SPVSF-TAELK--------GFSESDIRKIMRDNALDLLG-------------------  383
DSSP  L-LHHHH-HHHHL--------LLLHHHHHHHHLHHHHHHHL-------------------


DSSP  llhhhllhhhhhhhhhhllllllleeeelleeeeellllllllhhhhhhhhhhhhhhhhl
Query dlpexfpvqniknhlvhafsgevfatxvagkwiyfdgeyptidseevkrelariekelys  407
ident                                                             
Sbjct -------------------------------------------------------vqvgs  388
DSSP  -------------------------------------------------------lllll


No 48: Query=1j6pA Sbjct=1j5sA Z-score=11.6

back to top
DSSP  leeeeeeeeelllllllleeeeeeeelleeeeeeelllllleellleeeEELEEEEEELH
Query hhxiignclilkdfssepfwgaveiengtikrvlqgevkvdldlsgklvXPALFNTHTHA   60
ident                                                         | | 
Sbjct --------------------------hmflgedylltnraavrlfnevkDLPIVDPHNHL   34
DSSP  --------------------------llllllllllllhhhhhhhhhhlLLLEEELLLLL


DSSP  H---------------hhhhLLLLLLL---------------------------------
Query P---------------xtllRGVAEDL---------------------------------   72
ident                                                             
Sbjct DakdivenkpwndiwevegaTDHYVWElmrrcgvseeyitgsrsnkekwlalakvfprfv   94
DSSP  LhhhhhhllllllhhhhhllLLHHHHHhhhhllllhhhllllllhhhhhhhhhhhhhhhl


DSSP  --------------lhhhhhhllhhhhhllllhhhhhhhhhhhHHHHHLLLEEEEEEEEL
Query --------------sfeewlfskvlpiedrltekxayygtilaQXEXARHGIAGFVDXYF  118
ident                                            |                
Sbjct gnptyewihldlwrrfnikkviseetaeeiweetkkklpemtpQKLLRDMKVEILCTTDD  154
DSSP  llhhhhhhhhhhhhhllllllllhhhhhhhhhhhhhhlllllhHHHHHHLLEEEEELLLL


DSSP  ---LHHHHHHHHHHHL-LEEEEEEEE--LLLL------------------------lLLL
Query ---HEEWIAKAVRDFG-XRALLTRGL--VDSN------------------------gDDG  148
ident      |   ||         | |                                     
Sbjct pvsTLEHHRKAKEAVEgVTILPTWRPdrAMNVdkegwreyvekmgerygedtstldgFLN  214
DSSP  lllLLHHHHHHHHHLLlLEEELLLLLhhHHLLllllhhhhhhhhhhhhllllllhhhHHH


DSSP  LHHHHHHHHHHHHllhhhleEEEEEeLLLL------------------------------
Query GRLEENLKLYNEWngfegriFVGFGpHSPY------------------------------  178
ident                      |    |                                 
Sbjct ALWKSHEHFKEHG-------CVASD-HALLepsvyyvdenraravhekafsgekltqdei  266
DSSP  HHHHHHHHHHLLL-------LLEEE-EEELllllllllhhhhhhhhhhhlllllllhhhh


DSSP  -llLHHHHHHHHHHHHHHLLLEEEEELL---------------------LLLLLL--LLH
Query -lcSEEYLKRVFDTAKSLNAPVTIHLYE---------------------TSKEEY--DLE  214
ident                   |     |                        |        | 
Sbjct ndyKAFMMVQFGKMNQETNWVTQLHIGAlrdyrdslfktlgpdsggdisTNFLRIaeGLR  326
DSSP  hhhHHHHHHHHHHHHHHHLLEEEEEELEellllhhhhhhlllllllleeLLLLLHhhHHH


DSSP  HHHLLLLLLLLEEEeELLL--LLHHHHHHHLL-LLEEEEELhhHHHH--llllllLHHHH
Query DILNIGLKEVKTIAaHCVH--LPERYFGVLKD-IPFFVSHNpaSNLK--lgngiaPVQRX  269
ident   ||      |                          |                      
Sbjct YFLNEFDGKLKIVL-YVLDptHLPTISTIARAfPNVYVGAP--WWFNdspfgmemHLKYL  383
DSSP  HHHHHLLLLLLEEE-EELLhhHHHHHHHHHHHlLLEEELLL--LLLLllhhhhhhHHHHH


DSSP  HHLLL---EEEELLLLLLllLLLL--HHHHHHHHHHHHHLLLL-----lllLHHHHHHHH
Query IEHGX---KVTLGTDGAAsnNSLN--LFFEXRLASLLQKAQNP-----rnlDVNTCLKXV  319
ident              ||      |         |  |                         
Sbjct ASVDLlynLAGMVTDSRK-lLSFGsrTEMFRRVLSNVVGEMVEkgqipikeARELVKHVS  442
DSSP  HLLLLhhhLLLLLLLLLL-lLHHHhhHHHHHHHHHHHHHHHHHlllllhhhHHHHHHHHH


DSSP  LHHHHHHHLllllllllllllleeeeelllhhhllhhhhhhhhhhllllllleeeellee
Query TYDGAQAXGfksgkieegwnadlvvidldlpexfpvqniknhlvhafsgevfatxvagkw  379
ident                                                             
Sbjct YDGPKALFF---------------------------------------------------  451
DSSP  LHHHHHHHL---------------------------------------------------


DSSP  eeellllllllhhhhhhhhhhhhhhhhl
Query iyfdgeyptidseevkrelariekelys  407
ident                             
Sbjct ----------------------------  451
DSSP  ----------------------------


No 49: Query=1j6pA Sbjct=3qy6A Z-score=11.4

back to top
DSSP  leeeeeeeeelllllllleeeeeeeelleeeeeeelllllleellleeeeelEEEEEELH
Query hhxiignclilkdfssepfwgaveiengtikrvlqgevkvdldlsgklvxpaLFNTHTHA   60
ident                                                         | | 
Sbjct ----------------------------------------------------MIDIHCHI    8
DSSP  ----------------------------------------------------LEELLLLL


DSSP  H-----HHHHllllllllhhhhhhllhhhhhllllhhhhHHHHHHHHHHHHLLLEEEEEE
Query P-----XTLLrgvaedlsfeewlfskvlpiedrltekxaYYGTILAQXEXARHGIAGFVD  115
ident                                            |       | ||     
Sbjct LpamddGAGD-----------------------------SADSIEMARAAVRQGIRTIIA   39
DSSP  LlllllLLLL-----------------------------HHHHHHHHHHHHHLLLLEEEL


DSSP  EE------------lLHHHHHHHHHHH-----LLEEEEEEeelllllllllhhhhhhhhh
Query XY------------fHEEWIAKAVRDF-----GXRALLTRglvdsngddggrleenlkly  158
ident                  |                  |                       
Sbjct TPhhnngvyknepaaVREAADQLNKRLikediPLHVLPGQ--------------------   79
DSSP  LLeellllllllhhhHHHHHHHHHHHHhhlllLLEEELLL--------------------


DSSP  hhhllhhhleeeeeEELLlllllhhhHHHHHHHHHHH-------lLLEEEEElllllLLL
Query newngfegrifvgfGPHSpylcseeyLKRVFDTAKSL-------nAPVTIHLyetskEEY  211
ident                              |                   |          
Sbjct --------------EIRI--------YGEVEQDLAKRqllslndtKYILIEF----pFDH  113
DSSP  --------------EEEL--------LLLHHHHHHLLllllhhhlLEEEEEL----lLLL


DSSP  LLHHHHLlLLLL-----LLEEEEELLLL-----LHHHHHH-HLLLlEEEEELHHH-hHHL
Query DLEDILNiGLKE-----VKTIAAHCVHL-----PERYFGV-LKDIpFFVSHNPAS-nLKL  259
ident                       ||                              |     
Sbjct VPRYAEQ-LFYDlqlkgYIPVIAHPERNreireNPSLLYHlVEKG-AASQITSGSlaGIF  171
DSSP  LLLLHHH-HHHHhhhllLEEEEELHHHLhhhhhLLHHHHHhHHLL-LEEEEEHHHhlLLL


DSSP  L---LLLL--LHHHHhhllLEEEELLLLLL-llLLLLHHHHHHHHHHhhhlllllLLLHH
Query G---NGIA--PVQRXiehgXKVTLGTDGAA-snNSLNLFFEXRLASLlqkaqnprNLDVN  313
ident |          |              |                                 
Sbjct GkqlKAFSlrLVEAN----LIHFVASDAHNvktRNFHTQEALYVLEK--------EFGSE  219
DSSP  LhhhHHHHhhHHHLL----LLLEEELLLLLlllLLLLHHHHHHHHHH--------HHLLH


DSSP  HHHHHHlHHHHHHHLLLllllllllllleeeeelllhhhllhhhhhhhhhhlllllllee
Query TCLKXVtYDGAQAXGFKsgkieegwnadlvvidldlpexfpvqniknhlvhafsgevfat  373
ident                                                             
Sbjct LPYMLT-ENAELLLRNQ-------------------------------------------  235
DSSP  HHHHHH-HHHHHHHLLL-------------------------------------------


DSSP  eelleeeeellllllllhhhhhhhhhhhhhhhhl
Query xvagkwiyfdgeyptidseevkrelariekelys  407
ident                                   
Sbjct ----------------------tifrqppqpvkr  247
DSSP  ----------------------llllllllllll


No 50: Query=1j6pA Sbjct=1itqA Z-score=11.3

back to top
DSSP  leeeeeeeeelllllllleeeeeeeelleeeeeeelllllleellleeeEELEEEEEELH
Query hhxiignclilkdfssepfwgaveiengtikrvlqgevkvdldlsgklvXPALFNTHTHA   60
ident                                                         |   
Sbjct -------------------------------------dffrdeaerimrDSPVIDGHNDL   23
DSSP  -------------------------------------lhhhhhhhhhhlLLLEEEEEELH


DSSP  HHhhhllllllllhhhhhhllhhhhHLLLLHHH--------hhhhhhHHHHHHHLLLEEE
Query PXtllrgvaedlsfeewlfskvlpiEDRLTEKX--------ayygtiLAQXEXARHGIAG  112
ident |                         |                                |
Sbjct PW---------------------qlLDMFNNRLqderanlttlagthTNIPKLRAGFVGG   62
DSSP  HH---------------------hhHHHHLLLLllhhhlllllllllLLHHHHHHLLEEE


DSSP  EEEEEL----------------LHHHHHHHHH---HHLL-----------------EEEE
Query FVDXYF----------------HEEWIAKAVR---DFGX-----------------RALL  136
ident                                |                          | 
Sbjct QFWSVYtpcdtqnkdavrrtleQMDVVHRMCRmypETFLyvtssagirqafregkvASLI  122
DSSP  EEEEELllhhhllllhhhhhhhHHHHHHHHHHhllLLEEelllhhhhhhhhhllleEEEE


DSSP  EEEELlllllllLHHH----HHHHHHHHHllhhhleeEEEEELLLLLLL-----------
Query TRGLVdsngddgGRLE----ENLKLYNEWngfegrifVGFGPHSPYLCS-----------  181
ident                         ||                                  
Sbjct GVEGG-------HSIDsslgVLRALYQLG--------MRYLTLTHSCNTpwadnwlvdtg  167
DSSP  EEELH-------HHLLllhhHHHHHHHLL--------EEEEELLLLLLLlllllhhhlll


DSSP  ---------HHHHHHHHHHHHHHLLLEEEEEllllllllLLHHHHlLLLL--LLLEEE-E
Query ---------EEYLKRVFDTAKSLNAPVTIHLyetskeeyDLEDILnIGLK--EVKTIA-A  229
ident               ||      |                         |       |   
Sbjct dsepqsqglSPFGQRVVKELNRLGVLIDLAH-------vSVATMK-ATLQlsRAPVIFsH  219
DSSP  lllllllllLHHHHHHHHHHHHHLLEEELLL-------lLHHHHH-HHHHhlLLLLEElL


DSSP  ELLL--------LLHHHHHHHLLLLEEEEELhhHHHHLLLL---------llLHHHHHHL
Query HCVH--------LPERYFGVLKDIPFFVSHNpaSNLKLGNG---------iaPVQRXIEH  272
ident              |       |     |  |                           | 
Sbjct SSAYsvcasrrnVPDDVLRLVKQTDSLVMVN--FYNNYISCtnkanlsqvadHLDHIKEV  277
DSSP  LLLLllllllllLLHHHHHHHHHHLLEEEEL--LLHHHHLLlllllhhhhhhHHHHHHHH


DSSP  LL--EEEELLLLLLL------LLLL-LHHHHHHHHHHhhhllllLLLLHHHHHHHHLHHH
Query GX--KVTLGTDGAAS------NNSL-NLFFEXRLASLlqkaqnpRNLDVNTCLKXVTYDG  323
ident      |  | |                                 ||              
Sbjct AGarAVGFGGDFDGVprvpegLEDVsKYPDLIAELLR-------RNWTEAEVKGALADNL  330
DSSP  LLhhHEEELLLLLLLllllllLLLLlLHHHHHHHHHH-------LLLLHHHHHHHHLHHH


DSSP  HHHHLllllllllllllleeeeelllhhhllhhhhhhhhhhllllllleeeelleeeeel
Query AQAXGfksgkieegwnadlvvidldlpexfpvqniknhlvhafsgevfatxvagkwiyfd  383
ident                                                             
Sbjct LRVFE---------------------------------------------aveqasnltq  345
DSSP  HHHHH---------------------------------------------hhhhllllll


DSSP  lllllllhhhhhhhhhhhhhhhhl
Query geyptidseevkrelariekelys  407
ident                         
Sbjct apeeepipldqlggscrthygyss  369
DSSP  llllllllhhhlllllllllllll


No 51: Query=1j6pA Sbjct=3iacA Z-score=11.1

back to top
DSSP  ---------leeeeeeeeeLLLLlllleeeeeeeelleeeeeeelllllleellleeeEE
Query ---------hhxiigncliLKDFssepfwgaveiengtikrvlqgevkvdldlsgklvXP   51
ident                     |                                       
Sbjct atfxtedfllkndiartlyHKYA----------------------------------aPX   26
DSSP  llllllllllllhhhhhhhHHLL----------------------------------lLL


DSSP  LEEEEEELHHhhhhllllllllhhhhhhllhhhhhllllhhhhHHHHH------------
Query ALFNTHTHAPxtllrgvaedlsfeewlfskvlpiedrltekxaYYGTI------------   99
ident      | |                                                    
Sbjct PIYDFHCHLS---------------------------------PQEIAddrrfdnlgqiw   53
DSSP  LEEELLLLLL---------------------------------HHHHHhllllllhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------   99
ident                                                             
Sbjct legdhykwralrsagvdeslitgketsdyekyxawantvpktlgnplyhwthlelrrpfg  113
DSSP  hllllhhhhhhhhllllhhhlllllllhhhhhhhhhhhhhhllllhhhhhhhhhhhllll


DSSP  ---------------------------hHHHHHHLLLEEEEEEEEL--LHHHHHHHHHH-
Query ---------------------------lAQXEXARHGIAGFVDXYF--HEEWIAKAVRD-  129
ident                             |   |                           
Sbjct itgtlfgpdtaesiwtqcneklatpafsARGIXQQXNVRXVGTTDDpiDSLEYHRQIAAd  173
DSSP  lllllllhhhhhhhhhhhhhhhllhhhlHHHHHHHLLEEEEELLLLllLLLHHHHHHHHl


DSSP  --HLLEEEEEEEEL--LLLL------------------------llllHHHHHHHHHHHH
Query --FGXRALLTRGLV--DSNG------------------------ddggRLEENLKLYNEW  161
ident                                                             
Sbjct dsIDIEVAPSWRPDkvFKIEldgfvdylrkleaaadvsitrfddlrqaLTRRLDHFAACG  233
DSSP  llLLLEEELLLLLHhhHLLLlllhhhhhhhhhhhhllllllhhhhhhhHHHHHHHHHHLL


DSSP  llhhhleEEEEEeLLLL--------------------------------llLHHHHHHHH
Query ngfegriFVGFGpHSPY--------------------------------lcSEEYLKRVF  189
ident              |                                         |    
Sbjct -------CRASD-HGIEtlrfapvpddaqldailgkrlagetlseleiaqfTTAVLVWLG  285
DSSP  -------LLEEE-EEELlllllllllhhhhhhhhhhhhllllllhhhhhhhHHHHHHHHH


DSSP  HHHHHHLLLEEEEELL--------------------lLLLLLL--LHHHHLLL---llLL
Query DTAKSLNAPVTIHLYE--------------------tSKEEYD--LEDILNIG---lkEV  224
ident             |                                |   |          
Sbjct RQYAARGWVXQLHIGAirnnntrxfrllgpdtgfdsiGDNNISwaLSRLLDSXdvtneLP  345
DSSP  HHHHHHLLEEEEEELEellllhhhhhhhllllllleeLLLLLHhhHHHHHHHHhllllLL


DSSP  LEEEEeLLLL-LHHH-HHHHLLL-------LEEEEElhhHHHHlllLLLL--HHHHHHLL
Query KTIAAhCVHL-PERY-FGVLKDI-------PFFVSHnpaSNLKlgnGIAP--VQRXIEHG  273
ident |||   |                                                    |
Sbjct KTILY-CLNPrDNEVlATXIGNFqgpgiagKVQFGS--gWWFNdqkDGXLrqLEQLSQXG  402
DSSP  EEEEE-ELLHhHHHHhHHHHHHLlllllllLEEELL--lLHHHllhHHHHhhHHHHHHHL


DSSP  L---EEEELLLLLlllLLLLHhHHHHHHHHHHHLLLLL-----------lllHHHHHHHH
Query X---KVTLGTDGAasnNSLNLfFEXRLASLLQKAQNPR-----------nldVNTCLKXV  319
ident      |   ||       |                                         
Sbjct LlsqFVGXLTDSR---SFLSY-TRHEYFRRILCNLLGQwaqdgeipddeaxlSRXVQDIC  458
DSSP  LhhhLLLLLLLLL---LLLLL-HHHHHHHHHHHHHHHHhhhlllllllhhhhHHHHHHHH


DSSP  LHHHHHHHLllllllllllllleeeeelllhhhllhhhhhhhhhhllllllleeeellee
Query TYDGAQAXGfksgkieegwnadlvvidldlpexfpvqniknhlvhafsgevfatxvagkw  379
ident                                                             
Sbjct FNNAQRYFT---------------------------------------------------  467
DSSP  LHHHHHHLL---------------------------------------------------


DSSP  eeellllllllhhhhhhhhhhhhhhhhl
Query iyfdgeyptidseevkrelariekelys  407
ident                             
Sbjct --------------------------ik  469
DSSP  --------------------------ll


No 52: Query=1j6pA Sbjct=3dcpA Z-score=9.4

back to top
DSSP  leeeeeeeeelllllllleeeeeeeelleeeeeeelllllleellleeeeeLEEEEEELH
Query hhxiignclilkdfssepfwgaveiengtikrvlqgevkvdldlsgklvxpALFNTHTHA   60
ident                                                         ||| 
Sbjct ---------------------------------------------------XKRDGHTHT    9
DSSP  ---------------------------------------------------LLEEEEELL


DSSP  H----HHHHllllllllhhhhhhllhhhhhllllhhhhhhHHHHHHHHHHLLLEEEEEEE
Query P----XTLLrgvaedlsfeewlfskvlpiedrltekxayyGTILAQXEXARHGIAGFVDX  116
ident       |                                                     
Sbjct EfcphGTHD-------------------------------DVEEXVLKAIELDFDEYSIV   38
DSSP  LllllLLLL-------------------------------LHHHHHHHHHHLLLLEEEEE


DSSP  E------------------------------lLHHHHHHHHHHHL--LEEEEEeeellll
Query Y------------------------------fHEEWIAKAVRDFG--XRALLTrglvdsn  144
ident                                                             
Sbjct EhaplssefxkntagdkeavttasxaxsdlpyYFKKXNHIKKKYAsdLLIHIG-------   91
DSSP  EellllhhhhhllllllhhhhlllllhhhhhhHHHHHHHHHHHLLllLEEEEE-------


DSSP  lllllhhhhhhhhhhhhllhhhleeeeEEELLLLllLHHHHHHHHHHHHHhllLEEEEEL
Query gddggrleenlklynewngfegrifvgFGPHSPYlcSEEYLKRVFDTAKSlnaPVTIHLY  204
ident                            |         |                    | 
Sbjct ---------------------------FEVDYLI-gYEDFTRDFLNEYGPqtdDGVLSLH  123
DSSP  ---------------------------EEEELLL-lLHHHHHHHHHHHHHhllEEEEELL


DSSP  -------------------------------lllLLLLLLHHH-HLLLlllLLEEEEELL
Query -------------------------------etsKEEYDLEDI-LNIGlkeVKTIAAHCV  232
ident                                                          |  
Sbjct flegqggfrsidfsaedynegivqfyggfeqaqlAYLEGVKQSiEADLglfKPRRXGHIS  183
DSSP  eeeelleeeellllhhhhhhhlhhhhllhhhhhhHHHHHHHHHhHLLLlllLLLEELLLL


DSSP  L---------------------lLHHHHHHHLLLLEEEEELHhHHHHL--LLLLL----L
Query H---------------------lPERYFGVLKDIPFFVSHNPaSNLKL--GNGIA----P  265
ident                                |        |    |              
Sbjct LcqkfqqffgedtsdfseevxekFRVILALVKKRDYELDFNT-AGLFKplCGETYppkkI  242
DSSP  HhhllhhhhlllhhhllhhhhhhHHHHHHHHHHHLLEEEEEL-HHHHLllLLLLLllhhH


DSSP  HHHHHHLLLEEEELLLLLLllLLLLhhHHHHHHHHHHHllllllllhhhhhhhhlhhhhh
Query VQRXIEHGXKVTLGTDGAAsnNSLNlfFEXRLASLLQKaqnprnldvntclkxvtydgaq  325
ident |    |       | |                                            
Sbjct VTLASELQIPFVYGSDSHG-vQDIG--RGYSTYCQKLE----------------------  277
DSSP  HHHHHHLLLLEEEELLLLL-hHHLL--LLHHHHHHHLL----------------------


DSSP  hhlllllllllllllleeeeelllhhhllhhhhhhhhhhllllllleeeelleeeeelll
Query axgfksgkieegwnadlvvidldlpexfpvqniknhlvhafsgevfatxvagkwiyfdge  385
ident                                                             
Sbjct ------------------------------------------------------------  277
DSSP  ------------------------------------------------------------


DSSP  lllllhhhhhhhhhhhhhhhhl
Query yptidseevkrelariekelys  407
ident                       
Sbjct ----------------------  277
DSSP  ----------------------


No 53: Query=1j6pA Sbjct=3f2bA Z-score=8.9

back to top
DSSP  ---------------------------------------------------------lee
Query ---------------------------------------------------------hhx    3
ident                                                             
Sbjct vrrletiveeerrvvvqgyvfdaevselksgrtlltmkitdytnsilvkmfsrdkedael   60
DSSP  lllhhhlllleeeeeeeeeeeeeeeeellllleeeeeeeelllleeeeeeelllhhhhhh


DSSP  eeeeeeelllllllleeeeeeeelleeeeeeelllllleellleeEEELEEEEEELHH--
Query iignclilkdfssepfwgaveiengtikrvlqgevkvdldlsgklVXPALFNTHTHAP--   61
ident                                                      | | |  
Sbjct msgvkkgmwvkvrgsvqndtfvrdlviiandlneiaanerqdtapEGEKRVELHLHTPms  120
DSSP  hhlllllleeeeeeeeeeelllleeeeeeeeeeeellllllllllLLLLLLLLLLLLLll


DSSP  --HHHHllllllllhhhhhhllhhhhhllllhhhhhhHHHHHHHHHHLLLEEEEEEEE--
Query --XTLLrgvaedlsfeewlfskvlpiedrltekxayyGTILAQXEXARHGIAGFVDXY--  117
ident                                                  |          
Sbjct qmDAVT-------------------------------SVTKLIEQAKKWGHPAIAVTDha  149
DSSP  llLLLL-------------------------------LHHHHHHHHHHLLLLLEEELLll


DSSP  --LLHHHHHHHHHHHLLEEEEEEEelllllllllhhhhhhhhhhhhllhhhleeeeeeeL
Query --FHEEWIAKAVRDFGXRALLTRGlvdsngddggrleenlklynewngfegrifvgfgpH  175
ident           |    |                                            
Sbjct vvQSFPEAYSAAKKHGMKVIYGLE-----------------------------------A  174
DSSP  llLLHHHHHHHHHHHLLLEEEEEE-----------------------------------E


DSSP  LLL----------------------------------LLLHhhHHHHHHHHHhhLLLEee
Query SPY----------------------------------LCSEeyLKRVFDTAKslNAPVti  201
ident                                                          |  
Sbjct NIVddpfhvtllaqnetglknlfklvslshiqyfhrvPRIP--RSVLVKHRD--GLLV--  228
DSSP  EEEllleeeeeeellhhhhhhhhhhhhhhhlllllllLLEE--HHHHHHLLL--LEEE--


DSSP  eellllllllllhhhhlllllllleEEEEL---lLLLHhhhHHHLLLLEEEEELHHHHHH
Query hlyetskeeydledilniglkevktIAAHC---vHLPEryfGVLKDIPFFVSHNPASNLK  258
ident                                                  |    |    |
Sbjct -------------------------GSGCDkgelFDNV---EDIARFYDFLEVHPPDVYK  260
DSSP  -------------------------ELLLLllllLLLL---LLLHHHLLLEEELLHHHHL


DSSP  LL------lLLLLHHHHHHLL----LEEEELLLLLL------------------------
Query LG------nGIAPVQRXIEHG----XKVTLGTDGAA------------------------  284
ident                     |      |                                
Sbjct PLyvkdeemIKNIIRSIVALGekldIPVVATGNVHYlnpedkiyrkilihsqgganplnr  320
DSSP  LLllllhhhHHHHHHHHHHHHhhllLLEEELLLLLLllhhhhhhhhhhhhllhhhlllll


DSSP  ---LLLLLLHH-HHHHHHHHhhhllllllLLHHHHHHHHLHHHHHHHLL-----------
Query ---SNNSLNLF-FEXRLASLlqkaqnprnLDVNTCLKXVTYDGAQAXGF-----------  329
ident                   |          |        |                     
Sbjct helPDVYFRTTnEMLDCFSF---------LGPEKAKEIVVDNTQKIASLigdvkpikdel  371
DSSP  lllLLLLLLLHhHHHHHHHH---------HHHHHHHHHHLHHHHHHHHLlllllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  329
ident                                                             
Sbjct ytpriegadeeiremsyrrakeiygdplpklveerlekelksiighgfaviylishklvk  431
DSSP  lllllllhhhhhhhhhhhhhhhhhlllllhhhhhhhhhhhhhhhhlllhhhhhhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  329
ident                                                             
Sbjct kslddgylvgsrgsvgssfvatmteitevnplpphyvcpnckhseffndgsvgsgfdlpd  491
DSSP  hhhhllllleelhhhhhlhhhhhllllllllllleeelllllleeellllllllhhhlll


DSSP  --------------------------lllllllllllleeeeelllhhhllhhhhhhhhh
Query --------------------------ksgkieegwnadlvvidldlpexfpvqniknhlv  363
ident                                                             
Sbjct kncprcgtkykkdghdipfetflgfkgdkvpdidlnfsgeyqprahnytkvlfgednvyr  551
DSSP  lllllllllleeellllllhhhhllllllllleeeeeelllhhhhhhhhhhhhlllleee


DSSP  hllllllleeeelleeeeellllllllhhhhhhhhHHHHH--------------------
Query hafsgevfatxvagkwiyfdgeyptidseevkrelARIEK--------------------  403
ident                                    |                        
Sbjct agtigtvadktaygfvkayasdhnlelrgaeidrlAAGCTgvkrttgqhpggiivvpdym  611
DSSP  eeeeeellhhhhhhhhhhhhhhllllllhhhhhhhHHHHLlleeeeeeeeeeeeelllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  403
ident                                                             
Sbjct eiydftpiqypaddtssewrtthfdfhsihdnllkldilghddptvirmlqdlsgidpkt  671
DSSP  lhhhllleelhhhllllllleeeeehhhhllllleeeeeeehhhhhhhhhhhhhlllhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  403
ident                                                             
Sbjct iptddpdvmgifssteplgvtpeqimcnvgtigipefgtrfvrqmleetrpktfselvqi  731
DSSP  lllllhhhhhlllllhhhlllhhhhllllllllllllllhhhhhhhhhhllllhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  403
ident                                                             
Sbjct sglshgtdvwlgnaqeliqngtctlsevigcrddimvyliyrglepslafkimesvrkgk  791
DSSP  hhhllllllllllhhhhhhlllllhhhllllhhhhhhhhhhllllhhhhhhhhhhhllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  403
ident                                                             
Sbjct gltpefeaemrkhdvpewyidsckkikymfpkahaaayvlmavriayfkvhhpllyyasy  851
DSSP  lllhhhhhhhhhllllhhhhhhhhhllllllhhhhhhhhhhhhhhhhhhhhlhhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  403
ident                                                             
Sbjct ftvraedfdldamikgsaairkrieeinakgiqatakekslltvlevalemcergfsfkn  911
DSSP  hhhllllllhhhhhhlhhhhhhhhhhhhhlhhhllhhhhhhhhhhhhhhhhhhllleell


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  403
ident                                                             
Sbjct idlyrsqatefvidgnslippfnaipglgtnvaqaivrareegeflskedlqqrgklskt  971
DSSP  llllllllllleeelleeellhhhlllllhhhhhhhhhhhhllllllhhhhhhhhlllhh


DSSP  -------------------hhhl
Query -------------------elys  407
ident                        
Sbjct lleylesrgcldslpdhnqlslf  994
DSSP  hhhhhhhllllllllllllllll


No 54: Query=1j6pA Sbjct=3au2A Z-score=8.8

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct mrnqelarifeeiglmseflgdnpfrvrayhqaartlydldtpieeiaekgkealmelpg   60
DSSP  llhhhhhhhhhhhhhhhhhllllhhhhhhhhhhhhhhhhllllhhhhhlllhhhhlllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct vgpdlaekileflrtgkvrkheelsrkvprgvlevmevpgvgpktarllyeglgidslek  120
DSSP  llhhhhhhhhhhhhhlllhhhhhhhhhllhhhhhhhllllllhhhhhhhhhhhllllhhh


DSSP  -----------------------leeeeeeeeelllllllleeeeeeeelleeeeeeeLL
Query -----------------------hhxiignclilkdfssepfwgaveiengtikrvlqGE   37
ident                                                           | 
Sbjct lkaaldrgdltrlkgfgpkraerireglalaqaagkrrplgavlslarslleairalpGV  180
DSSP  hhhhhhhlhhhhlllllhhhhhhhhhhhhhhhhlllleehhhhhhhhhhhhhhhhlllLL


DSSP  LL----------------------------------------------------------
Query VK----------------------------------------------------------   39
ident                                                             
Sbjct ERaelcgsarrykdtvgdldflvasregeravegfvrlpqvkevyakgkeratvflkngl  240
DSSP  LEeeelhhhhlllleelleeeeeelllhhhhhhhhhlllleeeeeeellleeeeeellll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------   39
ident                                                             
Sbjct qvdlrvvppesygaglqyltgskahsirlralaqekglklseygvfrgekriageteeev  300
DSSP  eeeeeeelhhhhhhhhhhhhllhhhhhhhhhhhhhllleeelleeeelleeeelllhhhh


DSSP  ------------------------lleellleeeEELEEEEEELHH--HHHHllllllll
Query ------------------------vdldlsgklvXPALFNTHTHAP--XTLLrgvaedls   73
ident                                            |                
Sbjct yaalglpwippplredqgeveaalegrlpkllelPQVKGDLQVHSTysDGQN--------  352
DSSP  hhhlllllllhhhlllllhhhhhhlllllllllhHHLLEEEEELLLllLLLL--------


DSSP  hhhhhhllhhhhhllllhhhhhhHHHHHHHHHHLLLEEEEEEEE----------------
Query feewlfskvlpiedrltekxayyGTILAQXEXARHGIAGFVDXY----------------  117
ident                                    |                        
Sbjct -----------------------TLEELWEAAKTMGYRYLAVTDhspavrvaggpspeea  389
DSSP  -----------------------LHHHHHHHHHHHLLLEEEEEEelhhhhllllllhhhh


DSSP  -lLHHHHHHHHHHHLL-EEEEEeeelllllllllhhhhhhhhhhhhllhhhleeeeeeeL
Query -fHEEWIAKAVRDFGX-RALLTrglvdsngddggrleenlklynewngfegrifvgfgpH  175
ident       |       |    |                                        
Sbjct lkRVGEIRRFNETHGPpYLLAG-----------------------------------aeV  414
DSSP  hhHHHHHHHHHHHHLLlEEEEE-----------------------------------eeE


DSSP  LLLlllhhhHHHHhHHHHhhllLEEEEEllllLLLL----LLHHHHLllLLLLLEEEEEL
Query SPYlcseeyLKRVfDTAKslnaPVTIHLyetsKEEY----DLEDILNigLKEVKTIAAHC  231
ident                        |                     |           || 
Sbjct DIH-pdgtlDYPD-WVLR-eldLVLVSV--hsRFNLpkadQTKRLLKalENPFVHVLAHP  469
DSSP  ELL-lllllLLLH-HHHL-lllEEEEEL--llLLLLlhhhHHHHHHHhhLLLLLLEELLL


DSSP  LL-----------lLHHHHHHHLLLLEEEEELhHHHHhllLLLL---LHHHHHHLLLEEE
Query VH-----------lPERYFGVLKDIPFFVSHNpASNLklgNGIA---PVQRXIEHGXKVT  277
ident                |  |   |     |                          |    
Sbjct TArllgrrapieadWEAVFQKAKEKGVAVEID-GYYD---RMDLpddLARMAYGMGLWIS  525
DSSP  LLllllllllllllHHHHHHHHHHHLLEEEEE-LLLL---LLLLlhhHHHHHHHLLLLEE


DSSP  ELLLLLLllLLLLhHHHHHHHHHHHhlllllLLLHHHhhHHHLHhhhhhhlLLLLlllll
Query LGTDGAAsnNSLNlFFEXRLASLLQkaqnprNLDVNTclKXVTYdgaqaxgFKSGkieeg  337
ident | ||       |                              |                 
Sbjct LSTDAHQ-tDHLRfMELAVGTAQRA------WIGPER--VLNTL------dYEDL-----  565
DSSP  EELLLLL-hHHHHhHHHHHHHHHHL------LLLLLL--LHHHL------lHHHH-----


DSSP  lllleeeeelllhhhllhhhhhhhhhhllllllleeeelleeeeellllllllhhhhhhh
Query wnadlvvidldlpexfpvqniknhlvhafsgevfatxvagkwiyfdgeyptidseevkre  397
ident                                                             
Sbjct ------------------------------------------------------------  565
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhhhl
Query lariekelys  407
ident           
Sbjct lswlkarrgv  575
DSSP  hhhhhlllll


No 55: Query=1j6pA Sbjct=1m65A Z-score=7.9

back to top
DSSP  leeeeeeeeelllllllleeeeeeeelleeeeeeelllllleellleeeeeLEEEEEEL-
Query hhxiignclilkdfssepfwgaveiengtikrvlqgevkvdldlsgklvxpALFNTHTH-   59
ident                                                         | | 
Sbjct ---------------------------------------------------YPVDLHMHt    9
DSSP  ---------------------------------------------------LLEELLLLl


DSSP  ---hHHHHhllllllllhhhhhhllhhhhhllllhhhHHHHHHHHHHHHHlllEEEEEEE
Query ---aPXTLlrgvaedlsfeewlfskvlpiedrltekxAYYGTILAQXEXArhgIAGFVDX  116
ident                                           |          |  |   
Sbjct vastHAYS-----------------------------TLSDYIAQAKQKG---IKLFAIT   37
DSSP  llllLLLL-----------------------------LHHHHHHHHHHHL---LLEEEEE


DSSP  EllhhhhhhhhhhhlleeeeeeEELLlllllllHHHHHHHhHHHHlLHHH---LEEEEEE
Query YfheewiakavrdfgxralltrGLVDsngddggRLEENLKlYNEWnGFEG---RIFVGFG  173
ident                          |                  |         |  |  
Sbjct D---------------------HGPD--medapHHWHFIN-MRIW-PRVVdgvGILRGIE   72
DSSP  E---------------------ELLL--lllllLLHHHHH-HHHL-LLEElleEEEEEEE


DSSP  ELLLLlllhhhHHHHHHHHHHHlLLEEEEE---lllLLLL-LLLHHHHLllLLLLLEEEE
Query PHSPYlcseeyLKRVFDTAKSLnAPVTIHL---yetSKEE-YDLEDILNigLKEVKTIAA  229
ident                                                          |  
Sbjct ANIKN---vdgEIDCSGKMFDSlDLIIAGFhepvfaPHDKaTNTQAMIAtiASGNVHIIS  129
DSSP  EELLL---lllLLLLLHHHHHHlLEEEEELllllllLLLHhHHHHHHHHhhHLLLLLEEL


DSSP  ELLL----LLHHH-HHHHLLLLEEEEELHHHhhhlllLLLL-HHHHHHLLLEEEELLLLL
Query HCVH----LPERY-FGVLKDIPFFVSHNPASnlklgnGIAP-VQRXIEHGXKVTLGTDGA  283
ident |                          |  |                  |  | || |  
Sbjct HPGNpkyeIDVKAvAEAAAKHQVALEINNSS------NCREvAAAVRDAGGWVALGSDSH  183
DSSP  LLLLllllLLHHHhHHHHHHHLLEEEEELLL------LHHHhHHHHHHHLLLEEEELLLL


DSSP  LllLLLLHHHHHHHHHHHHhlllllLLLHHHhhHHHLH--HHHHHHLlllllllllLLLL
Query AsnNSLNLFFEXRLASLLQkaqnprNLDVNTclKXVTY--DGAQAXGfksgkieegWNAD  341
ident         | |                                                 
Sbjct T-aFTMGEFEECLKILDAV------DFPPER--ILNVSprRLLNFLEsrgmapiaeFADL  234
DSSP  L-hHHLLLLHHHHHHHHHL------LLLHHH--LHHHLhhHHHHHHHhllllllhhHLLL


DSSP  eeeeelllhhhllhhhhhhhhhhllllllleeeelleeeeellllllllhhhhhhhhhhh
Query lvvidldlpexfpvqniknhlvhafsgevfatxvagkwiyfdgeyptidseevkrelari  401
ident                                                             
Sbjct ------------------------------------------------------------  234
DSSP  ------------------------------------------------------------


DSSP  hhhhhl
Query ekelys  407
ident       
Sbjct ------  234
DSSP  ------


No 56: Query=1j6pA Sbjct=1bksA Z-score=6.9

back to top
DSSP  leeeeeeeeelllllllleeeeeeeelleeeeeeelllllleellleeeeeleEEEEELH
Query hhxiignclilkdfssepfwgaveiengtikrvlqgevkvdldlsgklvxpalFNTHTHA   60
ident                                                             
Sbjct ------------------------------------meryenlfaqlndrregAFVPFVT   24
DSSP  ------------------------------------lhhhhhhhhhhhhllllEEEEEEE


DSSP  HHHHhllllllllhhhhhhllhhhhhllllhhhhHHHHHHHHHHHHLLLEeEEEEEEL--
Query PXTLlrgvaedlsfeewlfskvlpiedrltekxaYYGTILAQXEXARHGIaGFVDXYF--  118
ident                                                 |           
Sbjct LGDP-----------------------------gIEQSLKIIDTLIDAGA-DALELGVpf   54
DSSP  LLLL-----------------------------lHHHHHHHHHHHHHLLL-LLEEEELll


DSSP  -------------------------LHHHHHHHHHHHL-LEEEEEEEELLllllLLLHH-
Query -------------------------HEEWIAKAVRDFG-XRALLTRGLVDsngdDGGRL-  151
ident                                   |                         
Sbjct sdpladgptiqnanlrafaagvtpaQCFEMLALIREKHpTIPIGLLMYAN--lvFNNGId  112
DSSP  lllllllhhhhhhhhhhhhhlllhhHHHHHHHHHHHHLlLLLEEEEELHH--hhHLLLHh


DSSP  HHHHHhHHHHLlhhhleEEEEEELlllLLLHHHHHHHHHHHHHHLLLEEEEELllllLLL
Query EENLKlYNEWNgfegriFVGFGPHspyLCSEEYLKRVFDTAKSLNAPVTIHLYetskEEY  211
ident                                |        |   |               
Sbjct AFYAR-CEQVG------VDSVLVA---DVPVEESAPFRQAALRHNIAPIFICP----PNA  158
DSSP  HHHHH-HHHHL------LLEEEEL---LLLHHHLHHHHHHHHHLLLEEEEEEL----LLL


DSSP  LlHHHHLLlLLLLLEEEEELlllLHHHHHHHL-LLLEEEEELhHHHHhlllllLLHHHHh
Query DlEDILNIgLKEVKTIAAHCvhlPERYFGVLK-DIPFFVSHNpASNLklgngiAPVQRXi  270
ident |  | |                        ||                     | |    
Sbjct D-DDLLRQvASYGRGYTYLLalpLHHLIEKLKeYHAAPALQGfGISS-peqvsAAVRAG-  215
DSSP  L-HHHHHHhHHHLLLLEEELlllHHHHHHHHHhHLLLLEEELlLLLL-hhhhhHHHHHL-


DSSP  hllleEEELLLL-LLLLL--------------llLHHHHHHHHHhhhhllllllllhhhh
Query ehgxkVTLGTDG-AASNN--------------slNLFFEXRLASllqkaqnprnldvntc  315
ident                                                             
Sbjct ----aAGAISGSaIVKIIeknlaspkqmlaelrsFVSAMKAASR----------------  255
DSSP  ----lLEEEELLhHHHHHhhllllhhhhhhhhhhHHHHHHHLLL----------------


DSSP  hhhhlhhhhhhhlllllllllllllleeeeelllhhhllhhhhhhhhhhllllllleeee
Query lkxvtydgaqaxgfksgkieegwnadlvvidldlpexfpvqniknhlvhafsgevfatxv  375
ident                                                             
Sbjct ------------------------------------------------------------  255
DSSP  ------------------------------------------------------------


DSSP  lleeeeellllllllhhhhhhhhhhhhhhhhl
Query agkwiyfdgeyptidseevkrelariekelys  407
ident                                 
Sbjct --------------------------------  255
DSSP  --------------------------------


No 57: Query=1j6pA Sbjct=2yb1A Z-score=5.6

back to top
DSSP  leeeeeeeeelllllllleeeeeeeelleeeeeeelllllleellleeeeelEEEEEELh
Query hhxiignclilkdfssepfwgaveiengtikrvlqgevkvdldlsgklvxpaLFNTHTHa   60
ident                                                         | | 
Sbjct ---------------------------------------------------aNIDLHFH-    8
DSSP  ---------------------------------------------------lLEELLLL-


DSSP  hhhhhllllllllhhhhhhllhhhhhllllhhHHHHHHHHHHHHHhlllEEEEEEEE---
Query pxtllrgvaedlsfeewlfskvlpiedrltekXAYYGTILAQXEXarhgIAGFVDXY---  117
ident                                         |         |         
Sbjct ------------------------srtsdgalTPTEVIDRAAARA----PALLALTDhdc   40
DSSP  ------------------------llllllllLHHHHHHHHHLLL----LLEEEELLlll


DSSP  -LLHHHHHHHHHHHLLEEEEEeeelllllllllhhhhhhhhhhhhllhhhleeeeeEELL
Query -FHEEWIAKAVRDFGXRALLTrglvdsngddggrleenlklynewngfegrifvgfGPHS  176
ident        | |    |   |                                        |
Sbjct tGGLAEAAAAAARRGIPFLNG-----------------------------------VEVS   65
DSSP  lLLHHHHHHHHHHLLLLEEEE-----------------------------------EEEE


DSSP  LL----------------------------------------------------------
Query PY----------------------------------------------------------  178
ident                                                             
Sbjct VSwgrhtvhivglgidpaepalaaglksiregrlerarqmgasleaagiagcfdgamrwc  125
DSSP  EEelleeeeeeeellllllhhhhhhhhhhhllhhhhhhhhhhhhhhlllllhhhhhhlll


DSSP  ------------------------------------------LLLHhhHHHHHHHHHhHL
Query ------------------------------------------LCSEeyLKRVFDTAKsLN  196
ident                                                 |           
Sbjct dnpemisrthfarhlvdsgavkdmrtvfrkyltpgkpgyvshQWAS--LEDAVGWIV-GA  182
DSSP  llhhhllhhhhhhhhhhllllllhhhhhhhllllllllllllLLLL--HHHHHHHHH-HL


DSSP  LLeeeeellllllllllhhhhlllllllLEEEEELLL--LLHH-HHHHHL----llLEEE
Query APvtihlyetskeeydledilniglkevKTIAAHCVH--LPER-YFGVLK----diPFFV  249
ident                                 ||                          
Sbjct GG--------------------------MAVIAHPGRydMGRTlIERLILdfqaagGQGI  216
DSSP  LL--------------------------EEEELLHHHllLLHHhHHHHHHhhhhllLLEE


DSSP  EELhHHHHhlllllLLHHHHHHLLLE-EEELLLLLLllLLLLHhhHHHHHhhhhhlllll
Query SHNpASNLklgngiAPVQRXIEHGXK-VTLGTDGAAsnNSLNLffEXRLAsllqkaqnpr  308
ident      |                        | |  |            |           
Sbjct EVAsGSHS--lddmHKFALHADRHGLyASSGSDFHApgEDVGH--TEDLP----------  262
DSSP  EEEeLLLL--hhhhHHHHHHHHHHLLeEEEELLLLLllLLLLL--LLLLL----------


DSSP  lllhhhhhhhhlhHHHHhHLLLllllllllllleeeeelllhhhllhhhhhhhhhhllll
Query nldvntclkxvtyDGAQaXGFKsgkieegwnadlvvidldlpexfpvqniknhlvhafsg  368
ident                                                             
Sbjct ---------picrPIWR-ELEA--------------------------------------  274
DSSP  ---------llllLHHH-HLHH--------------------------------------


DSSP  llleeeELLEeeeellllllllhhhhhhhhhhhhhhhhl
Query evfatxVAGKwiyfdgeyptidseevkrelariekelys  407
ident        |                               
Sbjct --rilrPADA---------------------------en  284
DSSP  --hlllLLHH---------------------------hl


No 58: Query=1j6pA Sbjct=3e38A Z-score=5.2

back to top
DSSP  leeeeeeeeelLLLLLlleeeeeeeelleeeeeeelllllleellleeeEELEEEEEELH
Query hhxiignclilKDFSSepfwgaveiengtikrvlqgevkvdldlsgklvXPALFNTHTHA   60
ident             |                                           | | 
Sbjct --aqrrneiqvPDLDG--------------------------------yTTLKCDFHXHS   26
DSSP  --lllllllllLLLLL--------------------------------lEEEEEELLLLL


DSSP  ---HHHHhllllllllhhhhhhllhhhhhllllhhhhhhHHHHHHHHHHLLLEEEEEEEE
Query ---PXTLlrgvaedlsfeewlfskvlpiedrltekxayyGTILAQXEXARHGIAGFVDXY  117
ident                                               |  | |        
Sbjct vfsDGLV--------------------------------WPTVRVDEAYRDGLDAISLTE   54
DSSP  lllLLLL--------------------------------LHHHHHHHHHHLLLLEELLEE


DSSP  L------------LHHHHHHHHHHHL----LEEEEEEEELLL---llllllhhhHHHHhh
Query F------------HEEWIAKAVRDFG----XRALLTRGLVDS---ngddggrleENLKly  158
ident                       |                                     
Sbjct HieyrphkqdvvsDHNRSFDLCREQAeklgILLIKGSEITRAxapghfnaiflsDSNP--  112
DSSP  EllllllllllllLLLHHHHHHHHHHhhhlLEELLEEEEELLlllleeeeelllLLHH--


DSSP  hhhllhhhleeeeeeelllllllhHHHHHHHHHHHHHLLLEEEE-ELLL---LLLLLLLH
Query newngfegrifvgfgphspylcseEYLKRVFDTAKSLNAPVTIH-LYET---SKEEYDLE  214
ident                            |  |  ||   |                     
Sbjct ---------------------leqKDYKDAFREAKKQGAFXFWNhPGWDsqqPDTTKWWP  151
DSSP  ---------------------hllLLHHHHHHHHHHLLLEEEELlLLLLlllLLLLLLLH


DSSP  HHHlLLLL-LLLEEEEE----lLLLL-hHHHHHHLlllEEEEElhhhhhhlllllllhhh
Query DILnIGLK-EVKTIAAH----cVHLP-eRYFGVLKdipFFVSHnpasnlklgngiapvqr  268
ident                                                             
Sbjct EHT-ALYQeGCXHGIEVanghlYXPEaiQWCLDKN---LTXIG-----------------  190
DSSP  HHH-HHHHlLLLLEEEEeelleELLHhhHHHHHHL---LEEEE-----------------


DSSP  hhhllleeeeLLLLLL--LLLLllhhhhhhhhhhhhhllllllllhhhhhhhHLHHhhhh
Query xiehgxkvtlGTDGAA--SNNSlnlffexrlasllqkaqnprnldvntclkxVTYDgaqa  326
ident             |                                               
Sbjct ----------TSDIHQpiQTDY-------------------dfekgehrtxtFVFA-ker  220
DSSP  ----------ELLLLLlhHHHL-------------------lhhhllllleeEEEE-lll


DSSP  hLLLL----------lllllllllleeeeelllhhHLLH--------------HHHHhhH
Query xGFKS----------gkieegwnadlvvidldlpeXFPV--------------QNIKnhL  362
ident                                                       |     
Sbjct sLQGIrealdnrrtaayfhelligredllrpffekCVKIeevsrneqgvtlsiTNVT--D  278
DSSP  lHHHHhhhhhllleeeeelleeellhhhhhhhhhhHEEEeeeeeelleeeeeeEELL--L


DSSP  HHL-------------------lllllleeeelleeeeellllllllhhhhhhhhhhhhh
Query VHA-------------------fsgevfatxvagkwiyfdgeyptidseevkrelariek  403
ident                                                             
Sbjct LVLklkktahdtllvyfrdxtlkphtrytvrigfkqgikggdvnfevtnfivapdkglky  338
DSSP  LLEeeeelllllleellleeeellleeeeeeeeellllllleeeeeeeeeeeelleeeee


DSSP  hhhl
Query elys  407
ident     
Sbjct tisl  342
DSSP  eeel


No 59: Query=1j6pA Sbjct=2anuA Z-score=5.2

back to top
DSSP  leeeeeeeeelllllllleeeeeeeelleeeeeeelllllleellleeEEELEEEEEELH
Query hhxiignclilkdfssepfwgaveiengtikrvlqgevkvdldlsgklVXPALFNTHTHA   60
ident                                                     |   | | 
Sbjct ------------------------------------------------TEWLLCDFHVHT   12
DSSP  ------------------------------------------------LEEEEEEEEELL


DSSP  ---HHHHhllllllllhhhhhhllhhhhhllllhhhhhhHHHHHHHHHHLLLEEEEEEEE
Query ---PXTLlrgvaedlsfeewlfskvlpiedrltekxayyGTILAQXEXARHGIAGFVDXY  117
ident       |                                           ||        
Sbjct nxsDGHL--------------------------------PLGEVVDLFGKHGVDVVSITD   40
DSSP  lllLLLL--------------------------------LHHHHHHHHHHLLLLEEEEEE


DSSP  ---------------------------lLHHHHHHHHHHHL----LEEEEEEEellllll
Query ---------------------------fHEEWIAKAVRDFG----XRALLTRGlvdsngd  146
ident                                              |              
Sbjct hivdrrtleqrkrngeplgaitedkfqdYLKRLWREQKRAWeeygXILIPGVE-------   93
DSSP  eeelhhhhhhhhhllllllllllllhhhHHHHHHHHHHHHHhhhlLEEEEEEE-------


DSSP  lllhhhhhhhhhhhhllhhhleeeeeeeLLLL---------------LLLHhHHHHHhhh
Query dggrleenlklynewngfegrifvgfgpHSPY---------------LCSEeYLKRVfdt  191
ident                                                  |          
Sbjct ----------------------------ITNNtdlyhivavdvkeyvDPSL-PVEEI-ve  123
DSSP  ----------------------------EEELllleeeeeellllllLLLL-LHHHH-hh


DSSP  hhhHLLLEeeeellllllllllhhhhllllllllEEEEEL-------lLLLHhhHHHHLL
Query aksLNAPVtihlyetskeeydledilniglkevkTIAAHC-------vHLPEryFGVLKD  244
ident                                    ||||                   ||
Sbjct klkEQNAL--------------------------VIAAHPdrkklswyLWAN--XERFKD  155
DSSP  hhhHLLLE--------------------------EEELLLlllllllhHHHL--LLLLLL


DSSP  LLEEEE-ELHHhhhhlllllllHHHHHHLLLEEEELLLLLLllLLLLHhhhhhhhhhhhh
Query IPFFVS-HNPAsnlklgngiapVQRXIEHGXKVTLGTDGAAsnNSLNLffexrlasllqk  303
ident         |                            |                      
Sbjct TFDAWEiANRD---------dlFNSVGVKKYRYVANSDFHE-lWHVYS------------  193
DSSP  LLLEEEeEELL---------eeLHHHHHLLLLEEEELLLLL-hHHHLL------------


DSSP  llllllllhhhhhhhHLHHhhhhhLLLLlllllllllleeeeelllhhhllhhhhhhhhh
Query aqnprnldvntclkxVTYDgaqaxGFKSgkieegwnadlvvidldlpexfpvqniknhlv  363
ident                                                             
Sbjct -------------wkTLVK-seknIEAI--------------------------------  207
DSSP  -------------eeEEEE-elllHHHH--------------------------------


DSSP  hllllllleeeelleeeeellllllllhhhhhhhhhhhhhhhhl
Query hafsgevfatxvagkwiyfdgeyptidseevkrelariekelys  407
ident                                             
Sbjct ---------------------------keairkntdvaiylxrk  224
DSSP  ---------------------------hhhhhhllleeeeelll