Results: dupa

Query: 1j5sA

MOLECULE: URONATE ISOMERASE;

Select neighbours (check boxes) for viewing as multiple structural alignment or 3D superimposition. The list of neighbours is sorted by Z-score. Similarities with a Z-score lower than 2 are spurious. Each neighbour has links to pairwise structural alignment with the query structure, and to the PDB format coordinate file where the neighbour is superimposed onto the query structure.

Expand gaps

Summary

    No:  Chain   Z    rmsd lali nres  %id PDB  Description
   1:  1j5s-A 66.8  0.0  451   451  100 PDB  MOLECULE: URONATE ISOMERASE;                                         
   2:  3iac-A 49.7  1.3  449   469   33 PDB  MOLECULE: GLUCURONATE ISOMERASE;                                     
   3:  2qpx-A 25.2  3.8  337   376   12 PDB  MOLECULE: PREDICTED METAL-DEPENDENT HYDROLASE OF THE TIM-BA          
   4:  3irs-A 14.3  3.3  233   281   11 PDB  MOLECULE: UNCHARACTERIZED PROTEIN BB4693;                            
   5:  4dlf-A 14.0  3.1  221   287   11 PDB  MOLECULE: AMIDOHYDROLASE 2;                                          
   6:  1bf6-A 14.0  3.4  238   291   12 PDB  MOLECULE: PHOSPHOTRIESTERASE HOMOLOGY PROTEIN;                       
   7:  2ob3-A 13.8  3.2  232   329   11 PDB  MOLECULE: PARATHION HYDROLASE;                                       
   8:  1gkp-A 13.7  3.8  241   458   10 PDB  MOLECULE: HYDANTOINASE;                                              
   9:  3cjp-A 13.7  2.7  209   262   13 PDB  MOLECULE: PREDICTED AMIDOHYDROLASE, DIHYDROOROTASE FAMILY;           
  10:  3k2g-B 13.7  3.9  249   358   11 PDB  MOLECULE: RESINIFERATOXIN-BINDING, PHOSPHOTRIESTERASE-               
  11:  2y1h-B 13.4  3.5  222   265   15 PDB  MOLECULE: PUTATIVE DEOXYRIBONUCLEASE TATDN3;                         
  12:  2ffi-A 13.1  3.1  213   273   17 PDB  MOLECULE: 2-PYRONE-4,6-DICARBOXYLIC ACID HYDROLASE, PUTATIV          
  13:  4mup-B 13.0  3.0  210   286   12 PDB  MOLECULE: AMIDOHYDROLASE;                                            
  14:  4b3z-D 13.0  3.7  240   477    8 PDB  MOLECULE: DIHYDROPYRIMIDINASE-RELATED PROTEIN 1;                     
  15:  2vc5-A 13.0  3.4  232   314   15 PDB  MOLECULE: ARYLDIALKYLPHOSPHATASE;                                    
  16:  2dvt-A 12.9  4.0  233   325   13 PDB  MOLECULE: THERMOPHILIC REVERSIBLE GAMMA-RESORCYLATE DECARBO          
  17:  4qrn-A 12.8  4.0  239   352    8 PDB  MOLECULE: 5-CARBOXYVANILLATE DECARBOXYLASE;                          
  18:  1itq-A 12.8  3.3  235   369   11 PDB  MOLECULE: RENAL DIPEPTIDASE;                                         
  19:  3pnu-A 12.6  3.5  221   338   14 PDB  MOLECULE: DIHYDROOROTASE;                                            
  20:  3gri-A 12.6  3.4  230   422   14 PDB  MOLECULE: DIHYDROOROTASE;                                            
  21:  1onx-A 12.5  3.3  223   390   10 PDB  MOLECULE: ISOASPARTYL DIPEPTIDASE;                                   
  22:  2vun-A 12.4  3.4  218   385   11 PDB  MOLECULE: ENAMIDASE;                                                 
  23:  3giq-A 12.1  3.3  234   475   12 PDB  MOLECULE: N-ACYL-D-GLUTAMATE DEACYLASE;                              
  24:  3gg7-A 12.1  3.5  211   243    9 PDB  MOLECULE: UNCHARACTERIZED METALLOPROTEIN;                            
  25:  4ofc-A 12.0  3.5  227   335    9 PDB  MOLECULE: 2-AMINO-3-CARBOXYMUCONATE-6-SEMIALDEHYDE DECARBOX          
  26:  4hk5-D 11.9  4.2  234   380   12 PDB  MOLECULE: URACIL-5-CARBOXYLATE DECARBOXYLASE;                        
  27:  2paj-A 11.9  3.7  224   421    9 PDB  MOLECULE: PUTATIVE CYTOSINE/GUANINE DEAMINASE;                       
  28:  3nqb-A 11.8  3.4  225   587    8 PDB  MOLECULE: ADENINE DEAMINASE 2;                                       
  29:  1k6w-A 11.8  3.9  224   423    9 PDB  MOLECULE: CYTOSINE DEAMINASE;                                        
  30:  2gwg-A 11.7  3.1  214   329   11 PDB  MOLECULE: 4-OXALOMESACONATE HYDRATASE;                               
  31:  1j6p-A 11.6  3.7  221   407   10 PDB  MOLECULE: METAL-DEPENDENT HYDROLASE OF                               
  32:  4cqb-A 11.4  4.1  223   402   11 PDB  MOLECULE: N-ISOPROPYLAMMELIDE ISOPROPYL AMIDOHYDROLASE;              
  33:  3ls9-A 11.4  3.8  228   453    7 PDB  MOLECULE: TRIAZINE HYDROLASE;                                        
  34:  1yrr-B 11.2  3.1  202   334   10 PDB  MOLECULE: N-ACETYLGLUCOSAMINE-6-PHOSPHATE DEACETYLASE;               
  35:  2ogj-A 11.2  3.7  224   379   12 PDB  MOLECULE: DIHYDROOROTASE;                                            
  36:  2imr-A 11.0  3.4  218   380   11 PDB  MOLECULE: HYPOTHETICAL PROTEIN DR_0824;                              
  37:  1a4m-A 10.8  3.8  222   349   13 PDB  MOLECULE: ADENOSINE DEAMINASE;                                       
  38:  3mkv-A 10.6  4.1  225   414    6 PDB  MOLECULE: PUTATIVE AMIDOHYDROLASE;                                   
  39:  4dzi-C 10.5  4.6  229   388   11 PDB  MOLECULE: PUTATIVE TIM-BARREL METAL-DEPENDENT HYDROLASE;             
  40:  1a5k-C 10.4  3.5  221   566   11 PDB  MOLECULE: UREASE (GAMMA SUBUNIT);                                    
  41:  4c5y-A 10.3  3.7  226   436    6 PDB  MOLECULE: OCHRATOXINASE;                                             
  42:  3e74-A 10.2  4.0  223   429    9 PDB  MOLECULE: ALLANTOINASE;                                              
  43:  2oof-A 10.2  4.7  230   403   12 PDB  MOLECULE: 4-IMIDAZOLONE-5-PROPANOATE AMIDOHYDROLASE;                 
  44:  3mtw-A 10.0  3.4  201   404    8 PDB  MOLECULE: L-ARGININE CARBOXYPEPTIDASE CC2672;                        
  45:  3icj-A  9.7  3.8  216   468   14 PDB  MOLECULE: UNCHARACTERIZED METAL-DEPENDENT HYDROLASE;                 
  46:  3qy6-A  9.3  3.2  180   247   10 PDB  MOLECULE: TYROSINE-PROTEIN PHOSPHATASE YWQE;                         
  47:  2uz9-A  9.1  4.0  230   444   12 PDB  MOLECULE: GUANINE DEAMINASE;                                         
  48:  4rdv-B  8.7  4.1  233   451    9 PDB  MOLECULE: N-FORMIMINO-L-GLUTAMATE IMINOHYDROLASE;                    
  49:  3au2-A  8.0  3.9  196   575   10 PDB  MOLECULE: DNA POLYMERASE BETA FAMILY (X FAMILY);                     
  50:  3ooq-A  7.6  3.7  178   384   12 PDB  MOLECULE: AMIDOHYDROLASE;                                            
  51:  2a3l-A  7.3  4.5  257   616    8 PDB  MOLECULE: AMP DEAMINASE;                                             
  52:  1v77-A  7.1  3.3  169   202    5 PDB  MOLECULE: HYPOTHETICAL PROTEIN PH1877;                               
  53:  3dcp-A  6.1  3.6  168   277    8 PDB  MOLECULE: HISTIDINOL-PHOSPHATASE;                                    
  54:  1m65-A  6.1  3.8  172   234   12 PDB  MOLECULE: HYPOTHETICAL PROTEIN YCDX;                                 
  55:  3f2b-A  5.1  3.8  151   994   11 PDB  MOLECULE: DNA-DIRECTED DNA POLYMERASE III ALPHA CHAIN;               
  56:  1bks-A  4.7  3.1  141   255    7 PDB  MOLECULE: TRYPTOPHAN SYNTHASE;                                       
  57:  2anu-A  4.3  3.8  136   224   13 PDB  MOLECULE: HYPOTHETICAL PROTEIN TM0559;                               
  58:  2yb1-A  3.8  4.4  140   284   12 PDB  MOLECULE: AMIDOHYDROLASE;                                            
  59:  3e38-A  2.3  5.3  128   342    6 PDB  MOLECULE: TWO-DOMAIN PROTEIN CONTAINING PREDICTED PHP-LIKE           


Pairwise Structural Alignments

Notation: three-state secondary structure definitions by DSSP (reduced to H=helix, E=sheet, L=coil) are shown above the amino acid sequence. Structurally equivalent residues are in uppercase, structurally non-equivalent residues (e.g. in loops) are in lowercase. Amino acid identities are marked by vertical bars.

No 1: Query=1j5sA Sbjct=1j5sA Z-score=66.8

back to top
DSSP  LLLLLLLLLLLLHHHHHHHHHHLLLLEEELLLLLLHHHHHHLLLLLLHHHHHLLLLHHHH
Query HMFLGEDYLLTNRAAVRLFNEVKDLPIVDPHNHLDAKDIVENKPWNDIWEVEGATDHYVW   60
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct HMFLGEDYLLTNRAAVRLFNEVKDLPIVDPHNHLDAKDIVENKPWNDIWEVEGATDHYVW   60
DSSP  LLLLLLLLLLLLHHHHHHHHHHLLLLEEELLLLLLHHHHHHLLLLLLHHHHHLLLLHHHH


DSSP  HHHHHLLLLHHHLLLLLLHHHHHHHHHHHHHHHLLLHHHHHHHHHHHHHLLLLLLLLHHH
Query ELMRRCGVSEEYITGSRSNKEKWLALAKVFPRFVGNPTYEWIHLDLWRRFNIKKVISEET  120
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct ELMRRCGVSEEYITGSRSNKEKWLALAKVFPRFVGNPTYEWIHLDLWRRFNIKKVISEET  120
DSSP  HHHHHLLLLHHHLLLLLLHHHHHHHHHHHHHHHLLLHHHHHHHHHHHHHLLLLLLLLHHH


DSSP  HHHHHHHHHHHLLLLLHHHHHHHLLEEEEELLLLLLLLLHHHHHHHHHLLLLEEELLLLL
Query AEEIWEETKKKLPEMTPQKLLRDMKVEILCTTDDPVSTLEHHRKAKEAVEGVTILPTWRP  180
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct AEEIWEETKKKLPEMTPQKLLRDMKVEILCTTDDPVSTLEHHRKAKEAVEGVTILPTWRP  180
DSSP  HHHHHHHHHHHLLLLLHHHHHHHLLEEEEELLLLLLLLLHHHHHHHHHLLLLEEELLLLL


DSSP  HHHHLLLLLLHHHHHHHHHHHHLLLLLLHHHHHHHHHHHHHHHHLLLLLEEEEEELLLLL
Query DRAMNVDKEGWREYVEKMGERYGEDTSTLDGFLNALWKSHEHFKEHGCVASDHALLEPSV  240
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct DRAMNVDKEGWREYVEKMGERYGEDTSTLDGFLNALWKSHEHFKEHGCVASDHALLEPSV  240
DSSP  HHHHLLLLLLHHHHHHHHHHHHLLLLLLHHHHHHHHHHHHHHHHLLLLLEEEEEELLLLL


DSSP  LLLLHHHHHHHHHHHLLLLLLLHHHHHHHHHHHHHHHHHHHHHHLLEEEEEELEELLLLH
Query YYVDENRARAVHEKAFSGEKLTQDEINDYKAFMMVQFGKMNQETNWVTQLHIGALRDYRD  300
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct YYVDENRARAVHEKAFSGEKLTQDEINDYKAFMMVQFGKMNQETNWVTQLHIGALRDYRD  300
DSSP  LLLLHHHHHHHHHHHLLLLLLLHHHHHHHHHHHHHHHHHHHHHHLLEEEEEELEELLLLH


DSSP  HHHHHLLLLLLLLEELLLLLHHHHHHHHHHHLLLLLLEEEEELLHHHHHHHHHHHHHLLL
Query SLFKTLGPDSGGDISTNFLRIAEGLRYFLNEFDGKLKIVLYVLDPTHLPTISTIARAFPN  360
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct SLFKTLGPDSGGDISTNFLRIAEGLRYFLNEFDGKLKIVLYVLDPTHLPTISTIARAFPN  360
DSSP  HHHHHLLLLLLLLEELLLLLHHHHHHHHHHHLLLLLLEEEEELLHHHHHHHHHHHHHLLL


DSSP  EEELLLLLLLLLHHHHHHHHHHHHLLLLHHHLLLLLLLLLLLLHHHHHHHHHHHHHHHHH
Query VYVGAPWWFNDSPFGMEMHLKYLASVDLLYNLAGMVTDSRKLLSFGSRTEMFRRVLSNVV  420
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct VYVGAPWWFNDSPFGMEMHLKYLASVDLLYNLAGMVTDSRKLLSFGSRTEMFRRVLSNVV  420
DSSP  EEELLLLLLLLLHHHHHHHHHHHHLLLLHHHLLLLLLLLLLLLHHHHHHHHHHHHHHHHH


DSSP  HHHHHLLLLLHHHHHHHHHHHHLHHHHHHHL
Query GEMVEKGQIPIKEARELVKHVSYDGPKALFF  451
ident |||||||||||||||||||||||||||||||
Sbjct GEMVEKGQIPIKEARELVKHVSYDGPKALFF  451
DSSP  HHHHHLLLLLHHHHHHHHHHHHLHHHHHHHL


No 2: Query=1j5sA Sbjct=3iacA Z-score=49.7

back to top
DSSP  LLLLLLLLLLLLHHHHHHHH-HHLLLLEEELLLLLLHHHHHHLLLLLLHHHHHLLLLHHH
Query HMFLGEDYLLTNRAAVRLFN-EVKDLPIVDPHNHLDAKDIVENKPWNDIWEVEGATDHYV   59
ident   |  || || |  |  |        || | | ||    |                ||| 
Sbjct ATFXTEDFLLKNDIARTLYHkYAAPXPIYDFHCHLSPQEIADDRRFDNLGQIWLEGDHYK   60
DSSP  LLLLLLLLLLLLHHHHHHHHhLLLLLLEEELLLLLLHHHHHHLLLLLLHHHHHHLLLLHH


DSSP  HHHHHHLLLLHHHLLL-LLLHHHHHHHHHHHHHHHLLLHHHHHHHHHHHHHLLLL-LLLL
Query WELMRRCGVSEEYITG-SRSNKEKWLALAKVFPRFVGNPTYEWIHLDLWRRFNIK-KVIS  117
ident |   |  || |  |||   |  ||  | |   |   ||| | | || | | | |      
Sbjct WRALRSAGVDESLITGkETSDYEKYXAWANTVPKTLGNPLYHWTHLELRRPFGITgTLFG  120
DSSP  HHHHHHLLLLHHHLLLlLLLHHHHHHHHHHHHHHLLLLHHHHHHHHHHHLLLLLLlLLLL


DSSP  HHHHHHHHHHHHHHLLL--LLHHHHHHHLLEEEEELLLLLLLLLHHHHHHHHH-LLLLEE
Query EETAEEIWEETKKKLPE--MTPQKLLRDMKVEILCTTDDPVSTLEHHRKAKEA-VEGVTI  174
ident   ||| ||     ||               |    |||||   || ||            
Sbjct PDTAESIWTQCNEKLATpaFSARGIXQQXNVRXVGTTDDPIDSLEYHRQIAADdSIDIEV  180
DSSP  HHHHHHHHHHHHHHHLLhhHLHHHHHHHLLEEEEELLLLLLLLLHHHHHHHHLlLLLLEE


DSSP  ELLLLLHHHHLLLLLLHHHHHHHHHHHHLLLLLLHHHHHHHHHHHHHHHHLLLLLEEEEE
Query LPTWRPDRAMNVDKEGWREYVEKMGERYGEDTSTLDGFLNALWKSHEHFKEHGCVASDHA  234
ident  | ||||        |   |  |            |    ||     ||   || |||| 
Sbjct APSWRPDKVFKIELDGFVDYLRKLEAAADVSITRFDDLRQALTRRLDHFAACGCRASDHG  240
DSSP  ELLLLLHHHHLLLLLLHHHHHHHHHHHHLLLLLLHHHHHHHHHHHHHHHHHLLLLEEEEE


DSSP  ELLLLLLLLL-HHHHHHHHHHHLLLLLLLHHHHHHHHHHHHHHHHHHHHHHLLEEEEEEL
Query LLEPSVYYVD-ENRARAVHEKAFSGEKLTQDEINDYKAFMMVQFGKMNQETNWVTQLHIG  293
ident         |       |   |   || |   ||        |  |       || |||||
Sbjct IETLRFAPVPdDAQLDAILGKRLAGETLSELEIAQFTTAVLVWLGRQYAARGWVXQLHIG  300
DSSP  ELLLLLLLLLlHHHHHHHHHHHHLLLLLLHHHHHHHHHHHHHHHHHHHHHHLLEEEEEEL


DSSP  EELLLLHHHHHHLLLLLLLLEELLlLLHHHHHHHHHHHLL---LLLLEEEEELLHHHHHH
Query ALRDYRDSLFKTLGPDSGGDISTNfLRIAEGLRYFLNEFD---GKLKIVLYVLDPTHLPT  350
ident | |      |  |||| | |       |   |   |   |      |  || | |     
Sbjct AIRNNNTRXFRLLGPDTGFDSIGD-NNISWALSRLLDSXDvtnELPKTILYCLNPRDNEV  359
DSSP  EELLLLHHHHHHHLLLLLLLEELL-LLLHHHHHHHHHHHHlllLLLEEEEEELLHHHHHH


DSSP  HHHHHHHLL------LEEELLLLLLLLLHHHHHHHHHHHHLLLLHHHLLLLLLLLLLLLH
Query ISTIARAFP------NVYVGAPWWFNDSPFGMEMHLKYLASVDLLYNLAGMVTDSRKLLS  404
ident   |    |        |  |  |||||   |    |  |    ||    |  ||||  ||
Sbjct LATXIGNFQgpgiagKVQFGSGWWFNDQKDGXLRQLEQLSQXGLLSQFVGXLTDSRSFLS  419
DSSP  HHHHHHHLLllllllLEEELLLLHHHLLHHHHHHHHHHHHHHLLHHHLLLLLLLLLLLLL


DSSP  HhHHHHHHHHHHHHHHHHHHHLLLLL--HHHHHHHHHHHHLHHHHHHHL--
Query FgSRTEMFRRVLSNVVGEMVEKGQIP--IKEARELVKHVSYDGPKALFF--  451
ident    | | ||| | |  |     | ||         |           |   
Sbjct Y-TRHEYFRRILCNLLGQWAQDGEIPddEAXLSRXVQDICFNNAQRYFTik  469
DSSP  L-HHHHHHHHHHHHHHHHHHHLLLLLllHHHHHHHHHHHHLHHHHHHLLll


No 3: Query=1j5sA Sbjct=2qpxA Z-score=25.2

back to top
DSSP  llllllllllllHHHHhhHHHHLLLLEEELLLLLLhhhhhhLLLLLLHHHHHLlLLHHhh
Query hmflgedylltnRAAVrlFNEVKDLPIVDPHNHLDakdiveNKPWNDIWEVEGaTDHYvw   60
ident                      |   |  | | |                           
Sbjct -----------gXDDL--SEFVDQVPLLDHHCHFL-----iDGKVPNRDDRLA-QVST-e   40
DSSP  -----------lLLLL--HHHHHHLLEEEEEELLL-----lLLLLLLHHHHHH-HHLL-l


DSSP  HHHHHLlllhhhllllllhhhhhhhhhhhHHHHLLLHHHHHHHHHHHHHLlllllllhhh
Query ELMRRCgvseeyitgsrsnkekwlalakvFPRFVGNPTYEWIHLDLWRRFnikkviseet  120
ident                                       |                     
Sbjct ADKDYP-----------------------LADTKNRLAYHGFLALAKEFA----------   67
DSSP  LLLLLL-----------------------HHHHLLLHHHHHHHHHHHHHL----------


DSSP  hhhhHHHHhhHLLL-----LLHHHHHHHLLEEEEELLLL--lllllHHHHHHHhHLLLLE
Query aeeiWEETkkKLPE-----MTPQKLLRDMKVEILCTTDD--pvstlEHHRKAKeAVEGVT  173
ident                                  |                       |  
Sbjct --ldANNP-lAAXNdpgyaTYNHRIFGHFHFKELLIDTGfvpddpiLDLDQTA-ELVGIP  123
DSSP  --llLLLL-lLLLLhhhhhHHHHHHHHHLLEEEEEEELLlllllllLLHHHHH-HHHLLL


DSSP  EELLLLLHHHHLlllllhhhHHHHhhhhhlllLLLHHHHHHHHHHHHHHHHLLLLLEEEE
Query ILPTWRPDRAMNvdkegwreYVEKmgerygedTSTLDGFLNALWKSHEHFKEHGCVASDH  233
ident      |                                   |        | || |    
Sbjct VKAIYRLETHAE-------dFXLE--------HDNFAAWWQAFSNDVKQAKAHGFVGFXS  168
DSSP  EEEEEEHHHHHH-------hHHLL--------LLLHHHHHHHHHHHHHLLLLLLLLLEEE


DSSP  EEL---LLLLLLLLHHHHHHHHHHHLLLLLllhhhHHHHHHHHHHHHHHHHHHHLLEEEE
Query ALL---EPSVYYVDENRARAVHEKAFSGEKltqdeINDYKAFMMVQFGKMNQETNWVTQL  290
ident             |    | |                                      | 
Sbjct IAAyrvGLHLEPVNVIEAAAGFDTWKHSGE-krltSKPLIDYXLYHVAPFIIAQDXPLQF  227
DSSP  LHHhhlLLLLLLLLHHHHHHHHHHHHHHLL-llllLHHHHHHHHHHHHHHHHHHLLLEEE


DSSP  EELEEllllhhhhhhlllllLLLEeLLLL-LHHHhHHHHHHHLLL-LLLEEEE-ELLHhh
Query HIGALrdyrdslfktlgpdsGGDIsTNFL-RIAEgLRYFLNEFDG-KLKIVLY-VLDPth  347
ident | |                   |     |       |  |  |    || ||        
Sbjct HVGYG---------------DADT-DXYLgNPLL-XRDYLKAFTKkGLKVVLLhCYPY--  268
DSSP  EELLL---------------LLLL-LHHHlLHHH-HHHHHHHHHHhLLLEEEEeLLLL--


DSSP  HHHHHHHHHHLLLEEeLLLLLLL--LLHHhHHHHHHHHHLLLLHHHLlLLLLLLL-LLLH
Query LPTISTIARAFPNVYvGAPWWFN--DSPFgMEMHLKYLASVDLLYNLaGMVTDSR-KLLS  404
ident        |  ||| |                                     |       
Sbjct HREAGYLASVFPNLY-FDISLLDnlGPSG-ASRVFNEAVELAPYTRI-LFASDAStYPEX  325
DSSP  HHHHHHHHHHLLLEE-EELLLHHhhLHHH-HHHHHHHHLLLLLHHHE-ELLLLLLlLHHH


DSSP  HHHHHHHHHHHHHHHHHHHhhlLLLLHHHHHHHHHHHHLHHHHHHHL-------
Query FGSRTEMFRRVLSNVVGEMvekGQIPIKEARELVKHVSYDGPKALFF-------  451
ident  |     |   |                                |         
Sbjct YGLAARQFKQALVAHFNQL---PFVDLAQKKAWINAICWQTSAKLYHqerelrv  376
DSSP  HHHHHHHHHHHHHHHHHLL---LLLLHHHHHHHHHHHHLHHHHHHLLlhhhhll


No 4: Query=1j5sA Sbjct=3irsA Z-score=14.3

back to top
DSSP  llllllllllllhhhhhhhhhhllLLEEELLLLLLHHhhhhllllllhhhhhLLLLHHHh
Query hmflgedylltnraavrlfnevkdLPIVDPHNHLDAKdivenkpwndiweveGATDHYVw   60
ident                         | | |      |                        
Sbjct ------------------------LKIIDFRLRPPAM-----gflnariytrPDIRNRF-   30
DSSP  ------------------------LLLEELLLLLLLH-----hhhhlhhhhlHHHHHHH-


DSSP  hhhhhllllhhhllllllhhhhhhhhhhhhhhhllLHHHHHHhhhhhhhllllllllhhh
Query elmrrcgvseeyitgsrsnkekwlalakvfprfvgNPTYEWIhldlwrrfnikkviseet  120
ident                                                             
Sbjct ----------------------------------tRQLGFEP------------------   38
DSSP  ----------------------------------hHHHLLLL------------------


DSSP  hhhhhhhhhhhlllLLHHHHHHHLLEEEEELLLL-------lLLLL--HHHHHHHhhlll
Query aeeiweetkkklpeMTPQKLLRDMKVEILCTTDD-------pVSTL--EHHRKAKeaveg  171
ident                           |                                 
Sbjct -----apsaeekslELMFEEMAAAGIEQGVCVGRnssvlgsvSNADvaAVAKAYP-----   88
DSSP  -----lhhhhhllhHHHHHHHHHLLLLEEEEELLeellleelLHHHhhHHHHHLL-----


DSSP  LEEELLLLLhhHHLLllllhhhhhhhhhhhhllllllhhHHHHHHHHHHHHHHlllLLEE
Query VTILPTWRPdrAMNVdkegwreyvekmgerygedtstldGFLNALWKSHEHFKehgCVAS  231
ident     |                                      |                
Sbjct DKFHPVGSI--EAAT-----------------------rKEAMAQMQEILDLG---IRIV  120
DSSP  LLEEEEEEL--LLLL-----------------------hHHHHHHHHHHHHLL---LLLE


DSSP  EEEEL------LLLLllllhhhhhhhhhhhlllllllhhhhhhhhhHHHHHHHHHHHHHL
Query DHALL------EPSVyyvdenraravhekafsgekltqdeindykaFMMVQFGKMNQETN  285
ident                                                             
Sbjct NLEPGvwatpmHVDD-------------------------------RRLYPLYAFCEDNG  149
DSSP  EELHHhlllllLLLL-------------------------------HHHHHHHHHHHHLL


DSSP  LEEEEEE---LEELlllhhhhhhlllllllleelLLLLHHHHHHHHHHHLLlLLLEEE--
Query WVTQLHI---GALRdyrdslfktlgpdsggdistNFLRIAEGLRYFLNEFDgKLKIVL--  340
ident                                         |     |  |   |  |   
Sbjct IPVIMMTggnAGPD--------------------ITYTNPEHIDRVLGDFP-DLTVVSsh  188
DSSP  LLEEEELlllLLLL--------------------HHHHLHHHHHHHHHHLL-LLLEEEeh


DSSP  EELLhhHHHHHHHHHHHLLLEEeLLLLLlLLLHH-HHHHHHHHHHLllLHHHLLLLLLLL
Query YVLDptHLPTISTIARAFPNVYvGAPWWfNDSPF-GMEMHLKYLASvdLLYNLAGMVTDS  399
ident           |   |   || |   |         |         |   |       |  
Sbjct GNWP--WVQEIIHVAFRRPNLY-LSPDM-YLYNLpGHADFIQAANS--FLADRMLFGTAY  242
DSSP  HHLL--LHHHHHHHHHHLLLEE-EELHH-HHLLLlLHHHHHHHHLL--HHHHLLLLLLLL


DSSP  LLllHHHHHHHHHHHhhHHHHhhhhhlllllhhhhHHHHHHHHLHHHHHHHL----
Query RKllSFGSRTEMFRRvlSNVVgemvekgqipikeaRELVKHVSYDGPKALFF----  451
ident          || |                                    |      
Sbjct PM-cPLKEYTEWFLT--LPIK--------------PDAMEKILHGNAERLLAqagr  281
DSSP  LL-lLHHHHHHHHHL--LLLL--------------HHHHHHHHLHHHHHHHHhlll


No 5: Query=1j5sA Sbjct=4dlfA Z-score=14.0

back to top
DSSP  llllllllllllhhhhhhhhhhllLLEEELLLLLLhhhhhhllllllhhhhhLLLLHhhh
Query hmflgedylltnraavrlfnevkdLPIVDPHNHLDakdivenkpwndiweveGATDHyvw   60
ident                             | | |                           
Sbjct ------------------------ALRIDSHQHFW----ryraadypwigagMGVLA---   29
DSSP  ------------------------LLLEEEEELLL----lllhhhlllllllLHHHL---


DSSP  hhhhhllllhhhllllllhhhhhhhhhhhhhhhlllhhhhhhhhhhhhhllllllllhhh
Query elmrrcgvseeyitgsrsnkekwlalakvfprfvgnptyewihldlwrrfnikkviseet  120
ident                                                             
Sbjct ------------------------------------------------------------   29
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhhhhhllllLHHHHHHHLLEEEEELLL---LLLL---lLHHHHHHHhhlllLEE
Query aeeiweetkkklpemTPQKLLRDMKVEILCTTD---DPVS---tLEHHRKAKeavegVTI  174
ident                    |                        ||              
Sbjct ---------rdylpdALHPLMHAQALGASIAVQaraGRDEtaflLELACDEA-----RIA   75
DSSP  ---------llllhhHHHHHHHHLLLLEEEEELlllLHHHhhhhHHHHLLLL-----LEE


DSSP  ELLLLLHhhhllllllhhhhhhhhhhhhllllllhhhhHHHHHHHHHHHHLLLLLEEEEE
Query LPTWRPDramnvdkegwreyvekmgerygedtstldgfLNALWKSHEHFKEHGCVASDHA  234
ident       |                                  |                | 
Sbjct AVVGWED-----------------------------lrAPQLAERVAEWRGTKLRGFRHQ  106
DSSP  EEEELLL-----------------------------llLLLHHHHHHLLLLLLEEEEEEL


DSSP  EL---lLLLLlllhhhhhhhhhhhlllllllhhhhhhhHHHHHHHHHHHHHHHLLEEEEE
Query LL---ePSVYyvdenraravhekafsgekltqdeindyKAFMMVQFGKMNQETNWVTQLH  291
ident |                                                 |    |    
Sbjct LQdeadVRAF---------------------------vDDADFARGVAWLQANDYVYDVL  139
DSSP  HHhlllHHHH---------------------------hHLHHHHHHHHHHHHLLLEEEEL


DSSP  ELeellllhhhhhhlllllllleelllLLHHhHHHHHHHHLLlLLLEEEE--ELLH----
Query IGalrdyrdslfktlgpdsggdistnfLRIAeGLRYFLNEFDgKLKIVLY--VLDP----  345
ident                                     |    |     ||           
Sbjct VF------------------------eRQLP-DVQAFCARHD-AHWLVLDhaGKPAlaef  173
DSSP  LL------------------------hHHHH-HHHHHHHHLL-LLLEEEHhhHLLLhhhl


DSSP  --------HHHHHHHHHHHhLLLEEELLL-LLLL---------lLHHHHHHHHHHHHLLL
Query --------THLPTISTIARaFPNVYVGAP-WWFN---------dSPFGMEMHLKYLASVD  387
ident                  |   | |                         |  |       
Sbjct drddtalaRWRAALRELAA-LPHVVCKLSgLVTEadwrrglrasDLRHIEQCLDAALDAF  232
DSSP  lllllhhhHHHHHHHHHHL-LLLEEEEELlLLLLllllllllhhHHHHHHHHHHHHHHHH


DSSP  LHHHLlLLLLLLLL---llHHHHHHHHHHHHHHHHHhhhhhlllllhhhHHHHHHHHHLH
Query LLYNLaGMVTDSRK---llSFGSRTEMFRRVLSNVVgemvekgqipikeARELVKHVSYD  444
ident     |     |        |         |                              
Sbjct GPQRL-MFGSDWPVcllaaSYDEVASLVERWAESRL-------------SAAERSALWGG  278
DSSP  LHHHE-EELLLLLHhhhllLHHHHHHHHHHHHHHHL-------------LHHHHHHHLLH


DSSP  HHHHHHL--
Query GPKALFF--  451
ident          
Sbjct TAARCYAlp  287
DSSP  HHHHHLLll


No 6: Query=1j5sA Sbjct=1bf6A Z-score=14.0

back to top
DSSP  llllllllllllhhhhhhhhhhllLLEEELLLLLL------------hhHHHHLlllllh
Query hmflgedylltnraavrlfnevkdLPIVDPHNHLD------------akDIVENkpwndi   48
ident                               | ||               |          
Sbjct --------------------sfdpTGYTLAHEHLHidlsgfknnvdcrlDQYAF------   34
DSSP  --------------------llllLLEEEEEELLLeelhhhhllhhheeLLHHH------


DSSP  hhhhllllhhhhhhhhhllllhhhllllllhhhhhhhhhhhhhhhlllhhhhhhhhhhhh
Query wevegatdhyvwelmrrcgvseeyitgsrsnkekwlalakvfprfvgnptyewihldlwr  108
ident                                                             
Sbjct ------------------------------------------------------------   34
DSSP  ------------------------------------------------------------


DSSP  hllllllllhhhhhhhhhhhhhhlllllHHHHHHHLL---EEEEELLLLLL--LLLHHHH
Query rfnikkviseetaeeiweetkkklpemtPQKLLRDMK---VEILCTTDDPV--STLEHHR  163
ident                                   |     |                   
Sbjct ----------------------------ICQEMNDLMtrgVRNVIEMTNRYmgRNAQFML   66
DSSP  ----------------------------HHHHHHHHHhllEEEEEELLLHHhlLLHHHHH


DSSP  HHHHhLLLLEEELLLLLHhhHLLLlllhHHHHhhhhhhhllllllHHHHHHHHHHHHHHH
Query KAKEaVEGVTILPTWRPDraMNVDkegwREYVekmgerygedtstLDGFLNALWKSHEHF  223
ident        |                     | |                    |       
Sbjct DVMR-ETGINVVACTGYY--QDAF---fPEHV-------------ATRSVQELAQEMVDE  107
DSSP  HHHH-HHLLEEEEEELLL--LHHH---lLLHH-------------HHLLHHHHHHHHHHH


DSSP  HL-------LLLLEE-EEEE-LLLLlllllhhhhhhhhhhhlllllllhhhhHHHHHHHH
Query KE-------HGCVAS-DHAL-LEPSvyyvdenraravhekafsgekltqdeiNDYKAFMM  274
ident  |                                                          
Sbjct IEqgidgteLKAGIIaEIGTsEGKI---------------------------TPLEEKVF  140
DSSP  HHlllllllLLEEEEeEEELlLLLL---------------------------LHHHHHHH


DSSP  HHHHHHHHHHLLEEEEEELEellllhhhhhhlllllllleelllLLHHHhHHHHHHHLLL
Query VQFGKMNQETNWVTQLHIGAlrdyrdslfktlgpdsggdistnfLRIAEgLRYFLNEFDG  334
ident          |      |                               | |         
Sbjct IAAALAHNQTGRPISTHTSF-----------------------sTMGLEqLALLQAHGVD  177
DSSP  HHHHHHHHHHLLLEEEELHH-----------------------hLLHHHhHHHHHHLLLL


DSSP  llLEEE-EELLHHHHHHhHHHHHHLLlEEELLLL----lLLLLhHHHHHHHHHHHLLLLH
Query klKIVL-YVLDPTHLPTiSTIARAFPnVYVGAPW----wFNDSpFGMEMHLKYLASVDLL  389
ident               |             ||                    |  |    ||
Sbjct lsRVTVgHCDLKDNLDN-ILKMIDLG-AYVQFDTigknsYYPD-EKRIAMLHALRDRGLL  234
DSSP  hhHEEElLLLLLLLHHH-HHHHHHLL-LEEEELLlllllLLLH-HHHHHHHHHHHHLLLH


DSSP  HHLlLLLLLLLL--------lLHHHHHHHHHHHHHH-HHHHhhhhlllllhhhhHHHHHH
Query YNLaGMVTDSRK--------lLSFGSRTEMFRRVLS-NVVGemvekgqipikeaRELVKH  440
ident         |                     |   |                      |  
Sbjct NRV-MLSMDITRrshlkanggYGYDYLLTTFIPQLRqSGFS-------------QADVDV  280
DSSP  HHE-EELLLLLLhhhlhhhllLLLLHHHHLHHHHHHhLLLL-------------HHHHHH


DSSP  HHLHHHHHHHL
Query VSYDGPKALFF  451
ident      |   | 
Sbjct MLRENPSQFFQ  291
DSSP  HHLHHHHHHLL


No 7: Query=1j5sA Sbjct=2ob3A Z-score=13.8

back to top
DSSP  llllllllllllhhhhhhhhhhlllLEEELLLLLL----------------hhHHHHLll
Query hmflgedylltnraavrlfnevkdlPIVDPHNHLD----------------akDIVENkp   44
ident                               | |                       |   
Sbjct ----------drintvrgpitiseaGFTLTHEHICgssagflrawpeffgsrkALAEK--   48
DSSP  ----------lleeelleeelhhhhLLEEEEELLEellllhhhhlhhhhllhhHHHHH--


DSSP  lllhhhhhllllhhhhhhhhhllllhhhllllllhhhhhhhhhhhhhhhlllhhhhhhhh
Query wndiwevegatdhyvwelmrrcgvseeyitgsrsnkekwlalakvfprfvgnptyewihl  104
ident                                                             
Sbjct ------------------------------------------------------------   48
DSSP  ------------------------------------------------------------


DSSP  hhhhhllllllllhhhhhhhhhhhhhhlllllHHHHHHHLL---EEEEELLLLL--lLLL
Query dlwrrfnikkviseetaeeiweetkkklpemtPQKLLRDMK---VEILCTTDDP--vSTL  159
ident                                     ||      |               
Sbjct --------------------------------AVRGLRRARaagVRTIVDVSTFdigRDV   76
DSSP  --------------------------------HHHHHHHHHhllLLEEEELLLHhhlLLH


DSSP  HHHHHHHHhLLLLEEELLLLLHHHHllllllHHHHHHhhhhhhllllllhhhHHHHHHHH
Query EHHRKAKEaVEGVTILPTWRPDRAMnvdkegWREYVEkmgerygedtstldgFLNALWKS  219
ident             | |                                         |   
Sbjct SLLAEVSR-AADVHIVAATGLWFDP------PLSMRL--------------rSVEELTQF  115
DSSP  HHHHHHHH-HHLLEEELEEELLLLL------LHHHHL--------------lLHHHHHHH


DSSP  HHHHHL-------LLLLEEEEEELLLLlllllhhhhhhhhhhhlllllllhhhhHHHHHH
Query HEHFKE-------HGCVASDHALLEPSvyyvdenraravhekafsgekltqdeiNDYKAF  272
ident                      |                                      
Sbjct FLREIQygiedtgIRAGIIXVATTGKA---------------------------TPFQEL  148
DSSP  HHHHHHlllllllLLLLEEEEELLLLL---------------------------LHHHHH


DSSP  HHHHHHHHHHHHLLEEEEEELeellllhhhhhhlllllllleelllLLHHHH-HHHHHHH
Query MMVQFGKMNQETNWVTQLHIGalrdyrdslfktlgpdsggdistnfLRIAEG-LRYFLNE  331
ident            |      |                            |  |     |  |
Sbjct VLKAAARASLATGVPVTTHTA-----------------------asQRDGEQqAAIFESE  185
DSSP  HHHHHHHHHHHHLLLEEEELL-----------------------hhHLHHHHhHHHHHHL


DSSP  LLLllLEEEEE--LLHHhHHHHHHHHHHLllEEELL-LLLL-----------------ll
Query FDGklKIVLYV--LDPThLPTISTIARAFpnVYVGA-PWWF-----------------nd  371
ident                   |      |        |                         
Sbjct GLSpsRVCIGHsdDTDD-LSYLTALAARG--YLIGLdHIPYsaiglednasasallgirs  242
DSSP  LLLhhHEEELLhhHLLL-HHHHHHHHHLL--LEEEElLLLLllllllllhhhhhhhllll


DSSP  LHHHHHhHHHHHHLLLLHHHLlLLLLLLLL-----------------lLHHHHHHHHHHH
Query SPFGMEmHLKYLASVDLLYNLaGMVTDSRK-----------------lLSFGSRTEMFRR  414
ident          | |              |                                 
Sbjct WQTRAL-LIKALIDQGYMKQI-LVSNDWTFgfssyvtnimdvmdrvnpDGMAFIPLRVIP  300
DSSP  HHHHHH-HHHHHHHLLLHHHE-EELLLLLLeellllllhhhhhhhhllLHHHHHHHLHHH


DSSP  HHHHHHhhhhhlllllhhhHHHHHHHHHLHHHHHHHL----
Query VLSNVVgemvekgqipikeARELVKHVSYDGPKALFF----  451
ident  |                   |         |         
Sbjct FLREKG------------vPQETLAGITVTNPARFLSptlr  329
DSSP  HHHHLL------------lLHHHHHHHHLHHHHHHHLllll


No 8: Query=1j5sA Sbjct=1gkpA Z-score=13.7

back to top
DSSP  llllllllllllhhhhhhhHHHL-------------------------------------
Query hmflgedylltnraavrlfNEVK-------------------------------------   23
ident                                                             
Sbjct -----------pllikngeIITAdsrykadiyaegetitrigqnleappgtevidatgky   49
DSSP  -----------leeeelleEEELleeeeleeeelllllleeellllllllleeeelllle


DSSP  -LLLEEELLLLLL--------hhHHHHllllllhhhhhllllhhhhhhhhhllllhhhll
Query -DLPIVDPHNHLD--------akDIVEnkpwndiwevegatdhyvwelmrrcgvseeyit   74
ident       ||| |                                                 
Sbjct vFPGFIDPHVHIYlpfmatfakdTHET---------------------------------   76
DSSP  eEELEEEEEELLLleelleelllLHHH---------------------------------


DSSP  llllhhhhhhhhhhhhhhhlllhhhhhhhhhhhhhllllllllhhhhhhhhhhhhhhlll
Query gsrsnkekwlalakvfprfvgnptyewihldlwrrfnikkviseetaeeiweetkkklpe  134
ident                                                             
Sbjct ------------------------------------------------------------   76
DSSP  ------------------------------------------------------------


DSSP  llHHHHHHHLLEEEEELLLL------LLLL-LHHHHHHHhHLLLLEEELLLLLHHHhlll
Query mtPQKLLRDMKVEILCTTDD------PVST-LEHHRKAKeAVEGVTILPTWRPDRAmnvd  187
ident     |                               ||                      
Sbjct --GSKAALMGGTTTYIEMCCpsrnddALEGyQLWKSKAE-GNSYCDYTFHMAVSKF----  129
DSSP  --HHHHHHHLLEEEEEEEELllllllHHHHhHHHHHHHL-LLLLLEEEEEEELLLL----


DSSP  lllhhhhhhhhhhhhllllllhhhhHHHHHHHHHHHHLLLLLEEEEEELllllllllhhh
Query kegwreyvekmgerygedtstldgfLNALWKSHEHFKEHGCVASDHALLepsvyyvdenr  247
ident                                        |       |            
Sbjct -------------------------DEKTEGQLREIVADGISSFXIFLS-----------  153
DSSP  -------------------------LLLHHHHHHHHHHLLLLEEEEEEL-----------


DSSP  hhhhhhhhlllllllhhhhhhhHHHHHHHHHHHHHHHLLEEEEEEL---eELLLLHHHHH
Query aravhekafsgekltqdeindyKAFMMVQFGKMNQETNWVTQLHIG---aLRDYRDSLFK  304
ident                           | |      |       |             |  
Sbjct ---------------yknffgvDDGEMYQTLRLAKELGVIVTAHCEnaelVGRLQQKLLS  198
DSSP  ---------------lllllllLHHHHHHHHHHHHHHLLEEEEEELlhhhHHHHHHHHHH


DSSP  HLllllLLLE--ELLLL--LHHHHHHHHHHHLllLLLEEEE-ELLHHHHHHHHHHHHHLL
Query TLgpdsGGDI--STNFL--RIAEGLRYFLNEFdgKLKIVLY-VLDPTHLPTISTIARAFP  359
ident                            ||                   |           
Sbjct EGktgpEWHEpsRPEAVeaEGTARFATFLETT--GATGYVVhLSCKPALDAAMAAKARGV  256
DSSP  LLlllhHHLLllLLHHHhhHHHHHHHHHHHHH--LLEEEELlLLLHHHHHHHHHHHHLLL


DSSP  LEEELLLllllLLHH-------------------------HHHHHHHHhhllllHHHLLL
Query NVYVGAPwwfnDSPF-------------------------GMEMHLKYlasvdlLYNLAG  394
ident   |                                                         
Sbjct PIYIESV--ipHFLLdktyaerggveamkyimspplrdkrNQKVLWDA----laQGFIDT  310
DSSP  LEEEEEE--hhHHHLlhhhhhllhhhhhlllllllllllhHHHHHHHH----hhLLLLLE


DSSP  LLLLLLL-------------------lLHHHHHHHHHHHHHH--HHHHhhhhlllllhhh
Query MVTDSRK-------------------lLSFGSRTEMFRRVLS--NVVGemvekgqipike  433
ident   ||                            |                           
Sbjct VGTDHCPfdteqkllgkeaftaipngiPAIEDRVNLLYTYGVsrGRLD------------  358
DSSP  EELLLLLllhhhhhhhlllhhhlllllLLLLLHHHHHHHHHLllLLLL------------


DSSP  hHHHHHHHHLHHHHHHHL------------------------------------------
Query aRELVKHVSYDGPKALFF------------------------------------------  451
ident                ||                                           
Sbjct -IHRFVDAASTKAAKLFGlfprkgtiavgsdadlvvydpqyrgtisvktqhvnndyngfe  417
DSSP  -HHHHHHHHLHHHHHHLLllllllllllllllleeeeelllleellhhhlllllllllll


DSSP  -----------------------------------------
Query -----------------------------------------  451
ident                                          
Sbjct gfeidgrpsvvtvrgkvavrdgqfvgekgwgkllrrepmyf  458
DSSP  lleelleeeeeeelleeeeelleelllllllllllllllll


No 9: Query=1j5sA Sbjct=3cjpA Z-score=13.7

back to top
DSSP  llllllllllllhhhhhhhhhhlllLEEELLLLLLhHHHHhllllllhhhhhllllhhhh
Query hmflgedylltnraavrlfnevkdlPIVDPHNHLDaKDIVenkpwndiwevegatdhyvw   60
ident                           | | | |                           
Sbjct -------------------------LIIDGHTHVI-LPVE--------------------   14
DSSP  -------------------------LLEEEEEELL-LLHH--------------------


DSSP  hhhhhllllhhhllllllhhhhhhhhhhhhhhhlllhhhhhhhhhhhhhllllllllhhh
Query elmrrcgvseeyitgsrsnkekwlalakvfprfvgnptyewihldlwrrfnikkviseet  120
ident                                                             
Sbjct ------------------------------------------------------------   14
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhhhhhllllLHHHHHHHLLEEEEELLL---------------------------
Query aeeiweetkkklpemTPQKLLRDMKVEILCTTD---------------------------  153
ident                   |      |                                  
Sbjct ---------------KHIKIMDEAGVDKTILFStsihpetavnlrdvkkemkklndvvng   59
DSSP  ---------------HHHHHHHHHLLLEEEEELllllhhhlllhhhhhhhhhhhhhhhll


DSSP  ---------llLLLL--HHHHHHHhhlllLEEELLLLLhhHHLLllllhhhhhhhhhhhh
Query ---------dpVSTL--EHHRKAKeavegVTILPTWRPdrAMNVdkegwreyvekmgery  202
ident                                                             
Sbjct ktnsmidvrrnSIKEltNVIQAYP-----SRYVGFGNV--PVGL----------------   96
DSSP  lllllhhhhhhHHHHhhHHHHHLL-----LLEEEEELL--LLLL----------------


DSSP  llllllhHHHHHHHHHHHHHHHlllLLEE-EEEE-LLLLLllllhhhhhhhhhhhlllll
Query gedtstlDGFLNALWKSHEHFKehgCVAS-DHAL-LEPSVyyvdenraravhekafsgek  260
ident                      |    |                                 
Sbjct -----seNDTNSYIEENIVNNK---LVGIgELTPaSGQIK--------------------  128
DSSP  -----lhHHHHHHHHHHLLLLL---LLEEeEELLlLLLHH--------------------


DSSP  llhhhhhhhhhhHHHHHHHHHH-HHLLEEEEEELEEllllhhhhhhlllllllleelllL
Query ltqdeindykafMMVQFGKMNQ-ETNWVTQLHIGALrdyrdslfktlgpdsggdistnfL  319
ident                   |            |                           |
Sbjct ------------SLKPIFKYSMdSGSLPIWIHAFNP---------------------lvL  155
DSSP  ------------HHHHHHHHHHhLLLLLEEELLLLL---------------------llH


DSSP  LHHHHHHHHHHHLLlLLLEEE--EELLhhHHHHHHHHHHHLLLEEELLlLLLLllhhHHH
Query RIAEGLRYFLNEFDgKLKIVL--YVLDptHLPTISTIARAFPNVYVGApWWFNdspfGME  377
ident             |  |    |           |    |    | |               
Sbjct QDIKEIAELCKAFP-KVPVILghMGGS--NWMTAVELAKEIQNLYLDT-SAYF----STF  207
DSSP  HHHHHHHHHHHHLL-LLLEEEhhHHHH--HHHHHHHHHHHLLLEEEEL-LLLL----LHH


DSSP  HhHHHHhlllLHHHLLLLLLLLLLllHHHHHHHHHHHHHHhhhhhhhhlllllhhhHHHH
Query MhLKYLasvdLLYNLAGMVTDSRKllSFGSRTEMFRRVLSnvvgemvekgqipikeAREL  437
ident   ||       |       ||           |                           
Sbjct V-LKIV--inELPLKCIFGTDMPF-gDLQLSIEAIKKMSN----------------DSYV  247
DSSP  H-HHHH--hhHLLLLEELLLLLLL-lLHHHHHHHHHHHLL----------------LHHH


DSSP  HHHHHLHHHHHHHL-
Query VKHVSYDGPKALFF-  451
ident    |  |    |   
Sbjct ANAVLGDNISRLLNi  262
DSSP  HHHHHLHHHHHHHLl


No 10: Query=1j5sA Sbjct=3k2gB Z-score=13.7

back to top
DSSP  --llllllllllllhhhhhhhhhhlllLEEELLLLLLhhhhhhllllllhhhhhllllhh
Query --hmflgedylltnraavrlfnevkdlPIVDPHNHLDakdivenkpwndiwevegatdhy   58
ident                                 | ||                        
Sbjct slselspchvrsgrixtvdgpipssalGHTLXHEHLQ--------------------ndc   40
DSSP  llllllllllllleeeelleeeehhhlLLEELLLLLL--------------------eel


DSSP  hhhhhHHLL-lLHHHLLllLLHHhhHHHHHHhhhhhlllhhhhhhhhhhhhhllllllll
Query vwelmRRCG-vSEEYITgsRSNKekWLALAKvfprfvgnptyewihldlwrrfnikkvis  117
ident                             |                               
Sbjct rcwwnPPQEpeRQYLAE--APIS--IEILSE-----------------------------   67
DSSP  hhhllLLLLhhHHHHHH--LLLL--HHHHHH-----------------------------


DSSP  hhhhhhhhhhhhhhllllLHHHHHHHLL---EEEEELLLLL--lLLLHHHHHHHhHLLLL
Query eetaeeiweetkkklpemTPQKLLRDMK---VEILCTTDDP--vSTLEHHRKAKeAVEGV  172
ident                                                   |    |  ||
Sbjct lrqdpfvnkhnialddldLAIAEVKQFAavgGRSIVDPTCRgigRDPVKLRRIS-AETGV  126
DSSP  hhllhhhllllleellhhHHHHHHHHHHhllLLEEEELLLLlllLLHHHHHHHH-HHHLL


DSSP  EEELLLLLHhhHLLLlllHHHHHHhhhhhhllllllhhhHHHHHHHHHHHHHL-------
Query TILPTWRPDraMNVDkegWREYVEkmgerygedtstldgFLNALWKSHEHFKE-------  225
ident                                                             
Sbjct QVVXGAGYY--LASS--xPETAAR--------------lSADDIADEIVAEALegtdgtd  168
DSSP  EEEELLLLL--LHHH--lLHHHHL--------------lLHHHHHHHHHHHHHlllllll


DSSP  LLLLEE-EEEELLlllllllhhhhhhhhhhhlllllllhhhhHHHHHHHHHHHHHHHHHH
Query HGCVAS-DHALLEpsvyyvdenraravhekafsgekltqdeiNDYKAFMMVQFGKMNQET  284
ident                                                            |
Sbjct ARIGLIgEIGVSS---------------------------dfTAEEEKSLRGAARAQVRT  201
DSSP  LLLLLEeEELLLL---------------------------llLHHHHHHHHHHHHHHHHH


DSSP  LLEEEEEELEellllhhhhhhlllllllleelllLLHHHHHHHHHHHlLLLL--LEEEEE
Query NWVTQLHIGAlrdyrdslfktlgpdsggdistnfLRIAEGLRYFLNEfDGKL--KIVLYV  342
ident       |                            | |        |  |      ||  
Sbjct GLPLXVHLPG-----------------------wFRLAHRVLDLVEE-EGADlrHTVLCH  237
DSSP  LLLEEELLLL-----------------------lLLLHHHHHHHHHH-LLLLhhHEEELL


DSSP  --LLHHHHHHHHHHHHHLllEEELL------------lllLLLLhHHHHHHHHHHHLLLL
Query --LDPTHLPTISTIARAFpnVYVGA------------pwwFNDSpFGMEMHLKYLASVDL  388
ident             | |                                       ||    
Sbjct xnPSHXDPVYQATLAQRG--AFLEFdxigxdffyadqgvqCPSD-DEVARAILGLADHGY  294
DSSP  lhHHLLLHHHHHHHHHHL--LEEEEllllllleelllleeLLLH-HHHHHHHHHHHHLLL


DSSP  HHHLlLLLLLLLL--------lLHHHHHHHHHHHHHHHHHhhhhhlllllhhhHHHHHHH
Query LYNLaGMVTDSRK--------lLSFGSRTEMFRRVLSNVVgemvekgqipikeARELVKH  440
ident |        |                  |  |   |                        
Sbjct LDRI-LLSHDVFVkxxltryggNGYAFVTKHFLPRLRRHG------------lDDAALET  341
DSSP  HHHE-EELLLLLLhhhlhhhllLLLLHHHHLHHHHHHHLL------------lLHHHHHH


DSSP  HHLHHHHHHHL------
Query VSYDGPKALFF------  451
ident      |   |       
Sbjct LXVTNPRRVFDasiegh  358
DSSP  HHLHHHHHHHLllllll


No 11: Query=1j5sA Sbjct=2y1hB Z-score=13.4

back to top
DSSP  llllllllllllhhhhhhhhhhlLLLEEELLLLLL----hhHHHHllllllhhhhhllll
Query hmflgedylltnraavrlfnevkDLPIVDPHNHLD----akDIVEnkpwndiwevegatd   56
ident                            || | ||       |                  
Sbjct -----------------------GVGLVDCHCHLSapdfdrDLDD---------------   22
DSSP  -----------------------LLLEEEEEELLLlhhhllLHHH---------------


DSSP  hhhhhhhhhllllhhhllllllhhhhhhhhhhhhhhhlllhhhhhhhhhhhhhlllllll
Query hyvwelmrrcgvseeyitgsrsnkekwlalakvfprfvgnptyewihldlwrrfnikkvi  116
ident                                                             
Sbjct ------------------------------------------------------------   22
DSSP  ------------------------------------------------------------


DSSP  lhhhhhhhhhhhhhhlllllHHHHHHHLLEEEEELLL-LLLL---lLHHHHHHHhhlllL
Query seetaeeiweetkkklpemtPQKLLRDMKVEILCTTD-DPVS---tLEHHRKAKeavegV  172
ident                              |  |                           
Sbjct --------------------VLEKAKKANVVALVAVAeHSGEfekiMQLSERYN-----G   57
DSSP  --------------------HHHHHHHLLEEEEEELLlLHHHhhhhHHHHHHLL-----L


DSSP  EEELLLLLHhhHLLLLLLHhhhhhhhhhhhllllllhhHHHHHHHHHHHHHHLlLLLEE-
Query TILPTWRPDraMNVDKEGWreyvekmgerygedtstldGFLNALWKSHEHFKEhGCVAS-  231
ident   ||                                    |       |  |     |  
Sbjct FVLPCLGVH--PVQGLDQR---------------svtlKDLDVALPIIENYKD-RLLAIg   99
DSSP  LEEEEELLL--LEELLLLE---------------ellhHHHHHHHHHHHHHLL-LLLEEe


DSSP  EEEELLLllllllhhhhhhhhhhhlllllllHHHHHHHHHHHHHHHHHHHHHHLLEEEEE
Query DHALLEPsvyyvdenraravhekafsgekltQDEINDYKAFMMVQFGKMNQETNWVTQLH  291
ident    |                             |                   |     |
Sbjct EVGLDFS-------------------prfagTGEQKEEQRQVLIRQIQLAKRLNLPVNVH  140
DSSP  EEEEELL-------------------lllllLHHHHHHHHHHHHHHHHHHHHHLLLEEEE


DSSP  ELEellllhhhhhhlllllllleelllllHHHHHHHHHHHLllLLLEEE-EELLhhHHHH
Query IGAlrdyrdslfktlgpdsggdistnflrIAEGLRYFLNEFdgKLKIVL-YVLDptHLPT  350
ident                                              |  |           
Sbjct SRS-------------------------aGRPTINLLQEQG--AEKVLLhAFDG--RPSV  171
DSSP  EEL-------------------------lHHHHHHHHHHLL--LLLEEEeLLLL--LHHH


DSSP  HHHHHHhlLLEEELLlllllLLHHH--HHHHHHHHhlllLHHHLlLLLLLLL-------l
Query ISTIARafPNVYVGApwwfnDSPFG--MEMHLKYLasvdLLYNLaGMVTDSR-------k  401
ident      |                          | |     |       |||         
Sbjct AMEGVR--AGYFFSI---ppSIIRSgqKQKLVKQL----PLTSI-CLETDSPalgpekqv  221
DSSP  HHHHHH--LLLEEEE---lhHHHLLhhHHHHHHHL----LHHHE-EELLLLLllllllll


DSSP  lLHHHhHHHHHHHHHHHHHHhhhhlllllhhhHHHHHHHHHLHHHHHHHL------
Query lLSFGsRTEMFRRVLSNVVGemvekgqipikeARELVKHVSYDGPKALFF------  451
ident                  | |              | |  |       ||       
Sbjct rNEPW-NISISAEYIAQVKG-----------iSVEEVIEVTTQNALKLFPklrhll  265
DSSP  lLLHH-HHHHHHHHHHHHHL-----------lLHHHHHHHHHHHHHHHLLlhhhhl


No 12: Query=1j5sA Sbjct=2ffiA Z-score=13.1

back to top
DSSP  llllllllllllhhhhhhhhhhlllLEEELLLLLL----------------hHHHHhlll
Query hmflgedylltnraavrlfnevkdlPIVDPHNHLD----------------aKDIVenkp   44
ident                             | | |                           
Sbjct ----------------------lhlTAIDSHAHVFsrglnlasqrryapnydAPLG----   34
DSSP  ----------------------lllLLEELLLLLLlhhhhhhllllllllllLLHH----


DSSP  lllhhhhhllllhhhhhhhhhllllhhhllllllhhhhhhhhhhhhhhhlllhhhhhhhh
Query wndiwevegatdhyvwelmrrcgvseeyitgsrsnkekwlalakvfprfvgnptyewihl  104
ident                                                             
Sbjct ------------------------------------------------------------   34
DSSP  ------------------------------------------------------------


DSSP  hhhhhllllllllhhhhhhhhhhhhhhlllllHHHHHHHLLEEEEELLL----LLLLL--
Query dlwrrfnikkviseetaeeiweetkkklpemtPQKLLRDMKVEILCTTD----DPVST--  158
ident                                     ||                      
Sbjct -------------------------------dYLGQLRAHGFSHGVLVQpsflGTDNRyl   63
DSSP  -------------------------------hHHHHHHHLLLLEELLLLlhhhLLLLHhh


DSSP  LHHHHHHHhhllllEEELLLLLhhHHLLllllhhhhhhhhhhhhllllllhhhhhhhHHH
Query LEHHRKAKeavegvTILPTWRPdrAMNVdkegwreyvekmgerygedtstldgflnaLWK  218
ident |                          |                                
Sbjct LSALQTVP-----gQLRGVVXL--ERDV-----------------------------EQA   87
DSSP  HHHHHHLL-----lLLLLLLLL--LLLL-----------------------------LHH


DSSP  HHHHHHLLLLLEEEEEEL---LLLLLLLlhhhhhhhhhhhlllllllhhhhhhhhhhHHH
Query SHEHFKEHGCVASDHALL---EPSVYYVdenraravhekafsgekltqdeindykafMMV  275
ident         |       |     |                                     
Sbjct TLAEXARLGVRGVRLNLXgqdXPDLTGA-----------------------------QWR  118
DSSP  HHHHHHLLLLLEEELLLLlllLLLLLLL-----------------------------LLH


DSSP  HHHHHHHHHLLEEEEEELeellllhhhhhhlllllllleelllLLHHHHHHhHHHHLllL
Query QFGKMNQETNWVTQLHIGalrdyrdslfktlgpdsggdistnfLRIAEGLRyFLNEFdgK  335
ident        |  |   ||                             |    |  |      
Sbjct PLLERIGEQGWHVELHRQ------------------------vADIPVLVR-ALQPY--G  151
DSSP  HHHHHHHHHLLEEEELLL------------------------lLLHHHHHH-HHLLL--L


DSSP  LLEEEE--ELLH-------HHHHHHHHHhHHLLLEEELL-lLLLL-----lLHHHHHHHH
Query LKIVLY--VLDP-------THLPTISTIaRAFPNVYVGA-pWWFN-----dSPFGMEMHL  380
ident | ||                      |       | |                      |
Sbjct LDIVIDhfGRPDarrglgqPGFAELLTL-SGRGKVWVKVsgIYRLqgspeeNLAFARQAL  210
DSSP  LLEEELhhHLLLlllllllLLHHHHLLL-LLLLLEEEEEelHHHLlllhhhHHHHHHHHH


DSSP  HHHHLLLLhHHLLLLLLLLLL-----llHHHHHHHHHHHHHHhhhhhhhhlllllhhhHH
Query KYLASVDLlYNLAGMVTDSRK-----llSFGSRTEMFRRVLSnvvgemvekgqipikeAR  435
ident   |              |          ||||  | |                       
Sbjct CALEAHYG-AERLXWGSDWPHtqhesevSFGSAVEQFEALGC----------------SA  253
DSSP  HHHHHHLL-HHHEEEELLLLLlllllllLHHHHHHHHHHHLL----------------LH


DSSP  HHHHHHHLHHHHHHHL----
Query ELVKHVSYDGPKALFF----  451
ident  |      |   |||     
Sbjct QLRQALLLDTARALFGfele  273
DSSP  HHHHHHHLHHHHHHLLllll


No 13: Query=1j5sA Sbjct=4mupB Z-score=13.0

back to top
DSSP  llllllllllllhhhhhhhhhhLLLL--EEELLLlLLHH-----------------HHHH
Query hmflgedylltnraavrlfnevKDLP--IVDPHNhLDAK-----------------DIVE   41
ident                          |   ||                            |
Sbjct -----------lvrklsgtapnPAFPrgAVDTQM-HMYLpgypalpggpglppgalPGPE   48
DSSP  -----------lllllllllllLLLLllLEELLL-LLLLlllllllllllllllllLLHH


DSSP  Llllllhhhhhllllhhhhhhhhhllllhhhllllllhhhhhhhhhhhhhhhlllhhhhh
Query Nkpwndiwevegatdhyvwelmrrcgvseeyitgsrsnkekwlalakvfprfvgnptyew  101
ident                                                             
Sbjct D-----------------------------------------------------------   49
DSSP  H-----------------------------------------------------------


DSSP  hhhhhhhhllllllllhhhhhhhhhhhhhhlllllHHHHHHHLLEEEEELLL----LLLL
Query ihldlwrrfnikkviseetaeeiweetkkklpemtPQKLLRDMKVEILCTTD----DPVS  157
ident                                       |           |         
Sbjct -----------------------------------YRRLMQWLGIDRVIITQgnahQRDN   74
DSSP  -----------------------------------HHHHHHHHLLLEEEEELlhhhLLLL


DSSP  L--LHHHHHHHhhllllEEELLLLLhhhhllllllhhhhhhhhhhhhllllllhhhhHHH
Query T--LEHHRKAKeavegvTILPTWRPdramnvdkegwreyvekmgerygedtstldgfLNA  215
ident    |                                                        
Sbjct GntLACVAEMG-----eAAHAVVII-------------------------------dATT   98
DSSP  HhhHHHHHHHH-----hHEEEEELL-------------------------------lLLL


DSSP  HHHHHHHHHLLLLLEEEEEELllllllllhhhhhhhhhhhlllllllhhhhhhhhHHHHH
Query LWKSHEHFKEHGCVASDHALLepsvyyvdenraravhekafsgekltqdeindykAFMMV  275
ident   |  |     | |      |                                       
Sbjct TEKDMEKLTAAGTVGARIMDL----------------------------pggavnLSELD  130
DSSP  LHHHHHHHHHLLEEEEEEELL----------------------------llllllHHHHH


DSSP  HHHHHHHHHLLEEEEEELeellllhhhhhhlllllllleelllLLHHHHHHhHHHHLllL
Query QFGKMNQETNWVTQLHIGalrdyrdslfktlgpdsggdistnfLRIAEGLRyFLNEFdgK  335
ident           |                                      |   |      
Sbjct AVDERAHAADWMVAVQFD------------------------gNGLLDHLP-RLQKI--R  163
DSSP  HHHHHHHHLLLEEEEELL------------------------hHHHHHHHH-HHHLL--L


DSSP  LLEEEE--ELLHH-------HHHHHHHHHHhLLLEEELL-lLLLL----lLHHHHHHHHH
Query LKIVLY--VLDPT-------HLPTISTIARaFPNVYVGA-pWWFN----dSPFGMEMHLK  381
ident    |                             |                          
Sbjct SRWVFDhhGKFFKgirtdgpEMAALLKLID-RGNLWFKFagVYESsrkswPYADVAAFSR  222
DSSP  LEEEELhhHHLLLllllllhHHHHHHHHHH-HLLEEEEEllHHHLlllllLLHHHHHHHH


DSSP  HHHLllLHHHLLLLLLLLLL--------llHHHHHHHHHHHHHhhhhhhhhhlllllhhh
Query YLASvdLLYNLAGMVTDSRK--------llSFGSRTEMFRRVLsnvvgemvekgqipike  433
ident   |            |                    |     |                 
Sbjct VIAA--HAPERIVWGTNWPHnsvretaaypDDARLAELTLGWL----------------p  264
DSSP  HHHH--HLHHHEEELLLLLLlllllhhhllLHHHHHHHHHLLL----------------l


DSSP  HHHHHHHHHLHHHHHHHL----
Query ARELVKHVSYDGPKALFF----  451
ident             | |||     
Sbjct DEAARHRALVENPEALFKlspv  286
DSSP  LHHHHHHHHLHHHHHHHLllll


No 14: Query=1j5sA Sbjct=4b3zD Z-score=13.0

back to top
DSSP  ----------------------------llllllllllllhhhhhhhhhhlLLLEEELLL
Query ----------------------------hmflgedylltnraavrlfnevkDLPIVDPHN   32
ident                                                         |   
Sbjct drllikggriinddqslyadvyledglikqigenlivpggvktieangrmvIPGGIDVNT   60
DSSP  leeeeeeeeeelllleeeeeeeeelleeeeeellllllllleeeelllleeEELEEEEEE


DSSP  LLL---hhHHHHllllllhhhhhllllhhhhhhhhhllllhhhllllllhhhhhhhhhhh
Query HLD---akDIVEnkpwndiwevegatdhyvwelmrrcgvseeyitgsrsnkekwlalakv   89
ident  |      |                                                   
Sbjct YLQktaadDFFQ------------------------------------------------   72
DSSP  LLLlllllLHHH------------------------------------------------


DSSP  hhhhlllhhhhhhhhhhhhhllllllllhhhhhhhhhhhhhhlllllHHHHHHHLLEEEE
Query fprfvgnptyewihldlwrrfnikkviseetaeeiweetkkklpemtPQKLLRDMKVEIL  149
ident                                                             
Sbjct -----------------------------------------------GTRAALVGGTTMI   85
DSSP  -----------------------------------------------HHHHHHHLLEEEE


DSSP  ELLLL------LLLLL-HHHHHHHHHLlLLEEELLLLLHHHhllllllhhhhhhhhhhhh
Query CTTDD------PVSTL-EHHRKAKEAVeGVTILPTWRPDRAmnvdkegwreyvekmgery  202
ident                    |  |                                     
Sbjct IDHVVpepgssLLTSFeKWHEAADTKS-CCDYSLHVDITSW-------------------  125
DSSP  EEEELllllllHHHHHhHHHHHHHLLL-LLEEEEEEELLLL-------------------


DSSP  llllllhhhhHHHHHHHHHHHH-LLLLLEEEEEELllllllllhhhhhhhhhhhllllll
Query gedtstldgfLNALWKSHEHFK-EHGCVASDHALLepsvyyvdenraravhekafsgekl  261
ident                   |      |                                  
Sbjct ----------YDGVREELEVLVqDKGVNSFQVYMA-------------------------  150
DSSP  ----------LLLHHHHHHHHHhLLLLLEEEEELL-------------------------


DSSP  lhhhhhhhHHHHHHHHHHHHHHHLLEEEEEELEE--LLLL-HHHHHH-llllLLLL--EE
Query tqdeindyKAFMMVQFGKMNQETNWVTQLHIGAL--RDYR-DSLFKT-lgpdSGGD--IS  315
ident                          |   |                       |      
Sbjct -ykdvyqmSDSQLYEAFTFLKGLGAVILVHAENGdlIAQEqKRILEMgitgpEGHAlsRP  209
DSSP  -lllllllLHHHHHHHHHHHHHHLLEEEEELLLHhhHHHHhHHHHHLlllllHHHHhhLL


DSSP  LLL--LLHHHHHHHHHHHLlllLLEEEE-ELLHHHHHHHHHHHHHLLLEEELLLlllLLL
Query TNF--LRIAEGLRYFLNEFdgkLKIVLY-VLDPTHLPTISTIARAFPNVYVGAPwwfNDS  372
ident                              |        |       | |           
Sbjct EELeaEAVFRAITIAGRIN---CPVYITkVMSKSAADIIALARKKGPLVFGEPI-aaSLG  265
DSSP  HHHhhHHHHHHHHHHHHHL---LLEEEEeELLHHHHHHHHHHHHHLLLEEEEEL-hhHHH


DSSP  H--------------------------HHHHHHHHHHHllllHHHLLLLLLLLLL-----
Query P--------------------------FGMEMHLKYLAsvdlLYNLAGMVTDSRK-----  401
ident                                     ||       |              
Sbjct TdgthywsknwakaaafvtspplspdpTTPDYLTSLLA----CGDLQVTGSGHCPystaq  321
DSSP  LllhhhhlllhhhhhhlllllllllllLHHHHHHHHHH----HLLLLLLLLLLLLllhhh


DSSP  --------------lLHHHHHHHHHHHHHH--HHHHhhhhlllllhhhhHHHHHHHHLHH
Query --------------lLSFGSRTEMFRRVLS--NVVGemvekgqipikeaRELVKHVSYDG  445
ident                     |                                  |    
Sbjct kavgkdnftlipegvNGIEERMTVVWDKAVatGKMD-------------ENQFVAVTSTN  368
DSSP  hhhhlllhhhlllllLLLLLHHHHHHHHHLllLLLL-------------HHHHHHHHLHH


DSSP  HHHHHL------------------------------------------------------
Query PKALFF------------------------------------------------------  451
ident     |                                                       
Sbjct AAKIFNlyprkgriavgsdadvviwdpdklktitakshksaveynifegmechgsplvvi  428
DSSP  HHHHHLllllllllllllllleeeeeeeeeeelllllllllllllllllleeeeeeeeee


DSSP  -------------------------------------------------
Query -------------------------------------------------  451
ident                                                  
Sbjct sqgkivfedgninvnkgmgrfiprkafpehlyqrvkirnkvfglqgvsr  477
DSSP  elleeeeelleellllllllllllllllhhhhhhhhhhhhhllllllll


No 15: Query=1j5sA Sbjct=2vc5A Z-score=13.0

back to top
DSSP  llllllllllllhhhhhhhhhhlllLEEELLLLLL-------------------hHHHHh
Query hmflgedylltnraavrlfnevkdlPIVDPHNHLD-------------------aKDIVe   41
ident                               | ||                        | 
Sbjct ---------mriplvgkdsieskdiGFTLIHEHLRvfseavrqqwphlynedeefRNAV-   50
DSSP  ---------llllllllllllhhhlLLEELLLLLLlllhhhhhhlhhhllhhhhhHHHH-


DSSP  llllllhhhhhllllhhhhhhhhhllllhhhllllllhhhhhhhhhhhhhhhlllhhhhh
Query nkpwndiwevegatdhyvwelmrrcgvseeyitgsrsnkekwlalakvfprfvgnptyew  101
ident                                                             
Sbjct ------------------------------------------------------------   50
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhhllllllllhhhhhhhhhhhhhhllllLHHHHHHHLLEEEEELLLLL--lLLL
Query ihldlwrrfnikkviseetaeeiweetkkklpemTPQKLLRDMKVEILCTTDDP--vSTL  159
ident                                      |      |               
Sbjct ----------------------------------NEVKRAMQFGVKTIVDPTVMglgRDI   76
DSSP  ----------------------------------HHHHHHHHLLLLEEEELLLLlllLLH


DSSP  HHHHHHHHHLLlLEEELLLLLHhhHLLLlllHHHHhhhhhhhhllllLLHHhhHHHHHHH
Query EHHRKAKEAVEgVTILPTWRPDraMNVDkegWREYvekmgerygedtSTLDgfLNALWKS  219
ident     |   |                  |                                
Sbjct RFMEKVVKATG-INLVAGTGIY--IYID--lPFYF------------LNRS--IDEIADL  117
DSSP  HHHHHHHHLLL-LEEEELEELL--LLLL--lLHHH------------LLLL--HHHHHHH


DSSP  HHHHHL-------LLLLEEEEEELLlllllllhhhhhhhhhhhlllllllhhhhHHHHHH
Query HEHFKE-------HGCVASDHALLEpsvyyvdenraravhekafsgekltqdeiNDYKAF  272
ident   |                  |  |                                   
Sbjct FIHDIKegiqgtlNKAGFVXIAADE--------------------------pgiTKDVEK  151
DSSP  HHHHHHlllllllLLLLLEEEELLL--------------------------lllLHHHHH


DSSP  HHHHHHHHHHHHLLEEEEEELEellllhhhhhhlllllllleellLLLH-hhhHHHHHHH
Query MMVQFGKMNQETNWVTQLHIGAlrdyrdslfktlgpdsggdistnFLRI-aegLRYFLNE  331
ident         | ||      |  |                                |    |
Sbjct VIRAAAIANKETKVPIITHSNA-----------------------HNNTgleqQRILTEE  188
DSSP  HHHHHHHHHHHHLLLEEEELLL-----------------------LLLHhhhhHHHHHHL


DSSP  LLLllLEEEEE--LLHHhHHHHHHHHHHLllEEELLLL----lLLLLhHHHHHHHHHHHL
Query FDGklKIVLYV--LDPThLPTISTIARAFpnVYVGAPW----wFNDSpFGMEMHLKYLAS  385
ident      ||              |  ||        |        |             |  
Sbjct GVDpgKILIGHlgDTDN-IDYIKKIADKG--SFIGLDRygldlFLPV-DKRNETTLRLIK  244
DSSP  LLLhhHEEELLhhHLLL-HHHHHHHHHLL--LEEEELLlllllLLLH-HHHHHHHHHHHH


DSSP  LLLHHHLlLLLLLLLL-----------------llHHHHHHHHHHHHHHHHHHhhhhlll
Query VDLLYNLaGMVTDSRK-----------------llSFGSRTEMFRRVLSNVVGemvekgq  428
ident             |                      |     |     |            
Sbjct DGYSDKI-MISHDYCCtidwgtakpeykpklaprwSITLIFEDTIPFLKRNGV-------  296
DSSP  LLLLLLE-EELLLLLLllllllllhhhhhhhllllLLLHHHHLHHHHHHLLLL-------


DSSP  llhhhHHHHHHHHHLHHHHHHHL
Query ipikeARELVKHVSYDGPKALFF  451
ident        |         ||  | 
Sbjct -----NEEVIATIFKENPKKFFS  314
DSSP  -----LHHHHHHHHLHHHHHHLL


No 16: Query=1j5sA Sbjct=2dvtA Z-score=12.9

back to top
DSSP  llllllllllllhhhhhhhhhhlLLLEEELLLLLL---hhhhhhlllllLHHHHhLLLLh
Query hmflgedylltnraavrlfnevkDLPIVDPHNHLD---akdivenkpwnDIWEVeGATDh   57
ident                            |    |                | |        
Sbjct -----------------------MQGKVALEEHFAipetlqdsagfvpgDYWKE-LQHR-   35
DSSP  -----------------------LLLEEEEEEEELlhhhhhhhllllllLHHHH-HHHH-


DSSP  hhhhhhhhllllhhhllllllhhhhhhhhhhhhhhhlllhhhhhhhhhhhhhllllllll
Query yvwelmrrcgvseeyitgsrsnkekwlalakvfprfvgnptyewihldlwrrfnikkvis  117
ident                                                             
Sbjct ------------------------------------------------------------   35
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhhhhhhhhllllLHHHHHHHLLEEEEELLL-----------------LLLL---
Query eetaeeiweetkkklpemTPQKLLRDMKVEILCTTD-----------------DPVS---  157
ident                   |  ||      |                              
Sbjct ------------lldiqdTRLKLMDAHGIETMILSLnapavqaipdrrkaieiARRAndv   83
DSSP  ------------hhllllHHHHHHHHLLEEEEEEEElllhhhhlllhhhhhhhHHHHhhh


DSSP  lLHHHHHHHhhlllLEEELLLLLhhHHLLllllhhhhhhhhhhhhllllllhhhhHHHHH
Query tLEHHRKAKeavegVTILPTWRPdrAMNVdkegwreyvekmgerygedtstldgfLNALW  217
ident   |   |          |                                       |  
Sbjct lAEECAKRP-----DRFLAFAAL--PLQD--------------------------PDAAT  110
DSSP  hHHHHHHLL-----LLEEEEELL--LLLL--------------------------HHHHH


DSSP  HHHHHHH-LLLLLEEEEEEL---------LLLLllllhhhhhhhhhhhlllllllhhhhh
Query KSHEHFK-EHGCVASDHALL---------EPSVyyvdenraravhekafsgekltqdein  267
ident           | |                                               
Sbjct EELQRCVnDLGFVGALVNGFsqegdgqtpLYYD---------------------------  143
DSSP  HHHHHHHhLLLLLEEEEELLlllllllllLLLL---------------------------


DSSP  hhhHHHHHHHHHHHHHHLLEEEEEElEELLL--LHHHHHhllllLLLL----EELL-llL
Query dykAFMMVQFGKMNQETNWVTQLHIgALRDY--RDSLFKtlgpdSGGD----ISTN-flR  320
ident          |            ||                                    
Sbjct ---LPQYRPFWGEVEKLDVPFYLHP-RNPLPqdSRIYDG----hPWLLgptwAFAQetaV  195
DSSP  ---LHHHHHHHHHHHHHLLLEEEEL-LLLLHhhLHHHLL----lHHHLhhhlHHHHhhhH


DSSP  HHHHHH--HHHHHLLlLLLEEEEellHHHHHH----------------------hhHHHH
Query IAEGLR--YFLNEFDgKLKIVLYvldPTHLPT----------------------isTIAR  356
ident  |  |       |    | | |                                      
Sbjct HALRLMasGLFDEHP-RLNIILGhmgEGLPYMmwridhrnawvklpprypakrrfmDYFN  254
DSSP  HHHHHHhlLHHHHLL-LLLEEELhhhLLHHHHhhhhhhllllllllllllllllhhHHHH


DSSP  hlLLEEeLLLLllLLLHhhhHHHHHHHHLLLLHHHLlLLLLLLLLLlHHHHHHHHHHHHH
Query afPNVYvGAPWwfNDSPfgmEMHLKYLASVDLLYNLaGMVTDSRKLlSFGSRTEMFRRVL  416
ident    |                   |                ||             |    
Sbjct --ENFH-ITTS--GNFR---TQTLIDAILEIGADRI-LFSTDWPFE-NIDHASDWFNATS  304
DSSP  --HHEE-EELL--LLLL---HHHHHHHHLLLLHHHE-ELLLLLLLL-LHHHHHHHHHHLL


DSSP  HhhhhhhhhlllllhhhHHHHHHHHHLHHHHHHHL--
Query SnvvgemvekgqipikeARELVKHVSYDGPKALFF--  451
ident                  |              ||   
Sbjct I----------------AEADRVKIGRTNARRLFKld  325
DSSP  L----------------LHHHHHHHHLHHHHHHLLll


No 17: Query=1j5sA Sbjct=4qrnA Z-score=12.8

back to top
DSSP  llllLLLLllllhhhhhhhhhhLLLLEEELLLLLL-------------------hhhhhh
Query hmflGEDYlltnraavrlfnevKDLPIVDPHNHLD-------------------akdive   41
ident                                                             
Sbjct ----SMTQ-------dlktggeQGYLRIATEEAFAtreiidvylrmirdgtadkgmvslw   49
DSSP  ----LLLL-------lllllllLLLLLEEEEEEELlhhhhhhhhhhhhhllllhhhhhhh


DSSP  lllllLHHHhHLLLLhhhhhhhhhllllhhhllllllhhhhhhhhhhhhhhhlllhhhhh
Query nkpwnDIWEvEGATDhyvwelmrrcgvseeyitgsrsnkekwlalakvfprfvgnptyew  101
ident         |                                                   
Sbjct gfyaqSPSE-RATQI---------------------------------------------   63
DSSP  hhhhhLLLH-HHHHH---------------------------------------------


DSSP  hhhhhhhhllllllllhhhhhhhhhhhhhhllllLHHHHHHHLLEEEEELLL--------
Query ihldlwrrfnikkviseetaeeiweetkkklpemTPQKLLRDMKVEILCTTD--------  153
ident                                                             
Sbjct -------------------------lerlldlgeRRIADMDATGIDKAILALtspgvqpl   98
DSSP  -------------------------hhhhhlllhHHHHHHHHLLLLEEEEEEllllllll


DSSP  --------lLLLLLHHHHHHHHHLllLEEELLLLLhhHHLLllllhhhhhhhhhhhhlll
Query --------dPVSTLEHHRKAKEAVegVTILPTWRPdrAMNVdkegwreyvekmgeryged  205
ident                    |                 |                      
Sbjct hdldeartlATRANDTLADACQKY-pDRFIGMGTV--APQD-------------------  136
DSSP  llhhhhhhhHHHHHHHHHHHHHHL-lLLEEELLLL--LLLL-------------------


DSSP  lllhhhhHHHHHHHHHHHH-LLLLLEEEEEEL---LLLLllllhhhhhhhhhhhllllll
Query tstldgfLNALWKSHEHFK-EHGCVASDHALL---EPSVyyvdenraravhekafsgekl  261
ident                     | |                                     
Sbjct -------PEWSAREIHRGArELGFKGIQINSHtqgRYLD---------------------  168
DSSP  -------HHHHHHHHHHHHhLLLLLLEEELLLlllLLLL---------------------


DSSP  lhhhhhhhHHHHhHHHHHHHHHHLLEEEEEeLEEL---lLLHHHHhhllllLLLL---EE
Query tqdeindyKAFMmVQFGKMNQETNWVTQLHiGALR---dYRDSLFktlgpdSGGD---IS  315
ident           |          |       |  |          |                
Sbjct --------EEFF-DPIFRALVEVDQPLYIH-PATSpdsmIDPMLE-----aGLDGaifGF  213
DSSP  --------LHHH-HHHHHHHHHHLLLEEEL-LLLLllllLHHHHH-----hLLLLlllHH


DSSP  LL--lLLHHHHHH-HHHHHLLlLLLEEEEellHHHHHH----------------------
Query TN--fLRIAEGLR-YFLNEFDgKLKIVLYvldPTHLPT----------------------  350
ident                        | |                                  
Sbjct GVetgMHLLRLITiGIFDKYP-SLQIMVGhmgEALPYWlyrldymhqagvrsqryermkp  272
DSSP  HHhhhHHHHHHHHhLHHHHLL-LLLEEELhhhHLHHHHhhhhhhhhhhhhhlllllllll


DSSP  ----hhHHHHhlLLEEeLLLLllLLLHhhhHHHHHHHHLLLLHHHLlLLLLLLLLllHHH
Query ----isTIARafPNVYvGAPWwfNDSPfgmEMHLKYLASVDLLYNLaGMVTDSRKllSFG  406
ident              ||               |   |    |           |        
Sbjct lkktieGYLK--SNVL-VTNS--GVAW---EPAIKFCQQVMGEDRV-MYAMDYPY-qYVA  322
DSSP  llllhhHHHH--HLEE-EELL--LLLL---HHHHHHHHHHHLHHHE-ELLLLLLL-lLLH


DSSP  HHHHHHHHhhHHHHhhhhhlllllhhhhHHHHHHHHLHHHHHHHL-
Query SRTEMFRRvlSNVVgemvekgqipikeaRELVKHVSYDGPKALFF-  451
ident                                 |          |  
Sbjct DEVRAMDA--MDMS--------------AQTKKKFFQTNAEKWFKl  352
DSSP  HHHHHHHL--LLLL--------------HHHHHHHHLHHHHHHLLl


No 18: Query=1j5sA Sbjct=1itqA Z-score=12.8

back to top
DSSP  llllllllllllhHHHHHHHHHLL-LLEEELLLLLL-----------hhhhhHLLLLllh
Query hmflgedylltnrAAVRLFNEVKD-LPIVDPHNHLD-----------akdivENKPWndi   48
ident                           |  | || |                         
Sbjct ------------dFFRDEAERIMRdSPVIDGHNDLPwqlldmfnnrlqderaNLTTL---   45
DSSP  ------------lHHHHHHHHHHLlLLEEEEEELHHhhhhhhhllllllhhhLLLLL---


DSSP  hhhhllllhhhhhhhhhllllhhhllllllhhhhhhhhhhhhhhhlllhhhhhhhhhhhh
Query wevegatdhyvwelmrrcgvseeyitgsrsnkekwlalakvfprfvgnptyewihldlwr  108
ident                                                             
Sbjct ------------------------------------------------------------   45
DSSP  ------------------------------------------------------------


DSSP  hllllllllhhhhhhhhhhhhhhlllllHHHHHHHLLEEEEELLLL------------LL
Query rfnikkviseetaeeiweetkkklpemtPQKLLRDMKVEILCTTDD------------PV  156
ident                                 ||   |                      
Sbjct -----------------------agthtNIPKLRAGFVGGQFWSVYtpcdtqnkdavrRT   82
DSSP  -----------------------lllllLHHHHHHLLEEEEEEEELllhhhllllhhhHH


DSSP  LL-LHHHHHHHH-HLLL------------------LEEELLLLLHHHhllllllhhhhhh
Query ST-LEHHRKAKE-AVEG------------------VTILPTWRPDRAmnvdkegwreyve  196
ident                |                   |  |                     
Sbjct LEqMDVVHRMCRmYPETflyvtssagirqafregkVASLIGVEGGHS-------------  129
DSSP  HHhHHHHHHHHHhLLLLeeelllhhhhhhhhhlllEEEEEEEELHHH-------------


DSSP  hhhhhhllllllhhhhhhhHHHHHHHHHLLLLLEEEEE---------ELLLllllllhhh
Query kmgerygedtstldgflnaLWKSHEHFKEHGCVASDHA---------LLEPsvyyvdenr  247
ident                               |                             
Sbjct ----------------idsSLGVLRALYQLGMRYLTLThscntpwadNWLV---------  164
DSSP  ----------------lllLHHHHHHHHHLLEEEEELLlllllllllLHHH---------


DSSP  hhhhhhhhlllllllhhHHHH-hHHHHHHHHHHHHHHHLLEEEEEEleellllhhhhhhl
Query aravhekafsgekltqdEIND-yKAFMMVQFGKMNQETNWVTQLHIgalrdyrdslfktl  306
ident                  |              |          |                
Sbjct ------------dtgdsEPQSqgLSPFGQRVVKELNRLGVLIDLAH--------------  198
DSSP  ------------lllllLLLLllLLHHHHHHHHHHHHHLLEEELLL--------------


DSSP  llllllleelllllHHHHHHHHHHHLllLLLEEE--EELLHH------HHHHHHHHHHHL
Query gpdsggdistnflrIAEGLRYFLNEFdgKLKIVL--YVLDPT------HLPTISTIARAF  358
ident                       |                                     
Sbjct -------------vSVATMKATLQLS--RAPVIFshSSAYSVcasrrnVPDDVLRLVKQT  243
DSSP  -------------lLHHHHHHHHHHL--LLLLEEllLLLLLLllllllLLHHHHHHHHHH


DSSP  LlEEELLLL-LLLL------LHHHHHHHHHHHHLLLLHHHLlLLLLLLL-------llLH
Query PnVYVGAPW-WFND------SPFGMEMHLKYLASVDLLYNLaGMVTDSR-------klLS  404
ident     |                      ||     |       |   |             
Sbjct D-SLVMVNFyNNYIsctnkaNLSQVADHLDHIKEVAGARAV-GFGGDFDgvprvpeglED  301
DSSP  L-LEEEELLlHHHHllllllLHHHHHHHHHHHHHHLLHHHE-EELLLLLlllllllllLL


DSSP  HHHhHHHHHHHHHHHHhhhhhlllllhhhHHHHHHHHHLHHHHHHHL-------------
Query FGSrTEMFRRVLSNVVgemvekgqipikeARELVKHVSYDGPKALFF-------------  451
ident            |                     ||    |     |              
Sbjct VSK-YPDLIAELLRRN------------wTEAEVKGALADNLLRVFEaveqasnltqape  348
DSSP  LLL-HHHHHHHHHHLL------------lLHHHHHHHHLHHHHHHHHhhhhlllllllll


DSSP  ---------------------
Query ---------------------  451
ident                      
Sbjct eepipldqlggscrthygyss  369
DSSP  lllllhhhlllllllllllll


No 19: Query=1j5sA Sbjct=3pnuA Z-score=12.6

back to top
DSSP  llllllllllllhhhhhhhHHHLlLLEEELLLLLLHH-HHHHllllllhhhhhllllhhh
Query hmflgedylltnraavrlfNEVKdLPIVDPHNHLDAK-DIVEnkpwndiwevegatdhyv   59
ident                             | | ||                          
Sbjct -----------enlyfqsnAMKL-KNPLDMHLHLRDNqMLEL------------------   30
DSSP  -----------llllllllLEEE-ELLEEEEELLLLHhHHHH------------------


DSSP  hhhhhhllllhhhllllllhhhhhhhhhhhhhhhlllhhhhhhhhhhhhhllllllllhh
Query welmrrcgvseeyitgsrsnkekwlalakvfprfvgnptyewihldlwrrfnikkvisee  119
ident                                                             
Sbjct ------------------------------------------------------------   30
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhhhhhhlllllHHHHHHhLLEEEEELLL-----LLLLL--LHHHHHHHHHLL--
Query taeeiweetkkklpemtPQKLLRdMKVEILCTTD-----DPVST--LEHHRKAKEAVE--  170
ident                     |                                  |    
Sbjct -----------------IAPLSA-RDFCAAVIMPnlippLCNLEdlKAYKMRILKACKde   72
DSSP  -----------------HHHHHH-LLLLEEEELLlllllLLLHHhhHHHHHHHHHHHLll


DSSP  LLEEELLLLLHhhhllllllhhhhhhhhhhhhllllllhhhhhhhHHHHHHHHHLLlLLE
Query GVTILPTWRPDramnvdkegwreyvekmgerygedtstldgflnaLWKSHEHFKEHgCVA  230
ident   | | |                                        |     |      
Sbjct NFTPLMTLFFK--------------------------------nyDEKFLYSAKDE-IFG   99
DSSP  LLEEEEEEELL--------------------------------llLHHHHHHHLLL-LLE


DSSP  EEEEELllllllllhhhhhhhhhhhlllllllhhhhhhHHHH-HHHHHHHHHHHHLLEEE
Query SDHALLepsvyyvdenraravhekafsgekltqdeindYKAF-MMVQFGKMNQETNWVTQ  289
ident                                                        |    
Sbjct IXLYPA---------------------gittnsnggvsSFDIeYLKPTLEAMSDLNIPLL  138
DSSP  EEELLL---------------------lllllllllllLLLHhHHHHHHHHHHHLLLLEE


DSSP  EEELEEllllhhhhhhllllllllEELLLL--LHHHHHHHHHHHLLlLLLEEEEellhhH
Query LHIGALrdyrdslfktlgpdsggdISTNFL--RIAEGLRYFLNEFDgKLKIVLYvldptH  347
ident  |                                |         |   ||||        
Sbjct VHGETN------------------DFVMDResNFAKIYEKLAKHFP-RLKIVME---hiT  176
DSSP  ELLLLL------------------LLHHHLlhHHHHHHHHHHHHLL-LLLEEEL---llL


DSSP  HHHHHHHHHHLLLEEELLLlllLLLHH-----------------------hhHHHHHHHH
Query LPTISTIARAFPNVYVGAPwwfNDSPF-----------------------gmEMHLKYLA  384
ident   |         | |                                        |  ||
Sbjct TKTLCELLKDYENLYATIT--lHHLIItlddviggkmnphlfckpiakryedKEALCELA  234
DSSP  LHHHHHHHHHLLLEEEEEL--lHHHLLlhhhhhlllllhhhllllllllhhhHHHHHHHH


DSSP  llllHHHLLLLLLLLLL--------lLHHHHHHHHHHHHHHHHHhhhhhlllllhhhHHH
Query svdlLYNLAGMVTDSRK--------lLSFGSRTEMFRRVLSNVVgemvekgqipikeARE  436
ident      |       ||            |                               |
Sbjct --fsGYEKVMFGSDSAPhpkgcaagvFSAPVILPVLAELFKQNS-------------SEE  279
DSSP  --hlLLLLEEELLLLLLlllllllllLLHHHHHHHHHHHHHHHL-------------LHH


DSSP  HHHHHHLHHHHHHHL--------------------------------------------
Query LVKHVSYDGPKALFF--------------------------------------------  451
ident        |                                                   
Sbjct NLQKFLSDNTCKIYDlkfkedkiltleekewqvpnvyedkynqvvpymageilkfqlkh  338
DSSP  HHHHHHLHHHHHHHLllllllleeeeellleelllleelllleellllllleelleell


No 20: Query=1j5sA Sbjct=3griA Z-score=12.6

back to top
DSSP  ---------------------------llllllllllllhhhhhhhhhhlLLLEEELLLL
Query ---------------------------hmflgedylltnraavrlfnevkDLPIVDPHNH   33
ident                                                       || | |
Sbjct xklikngkvlqngelqqadilidgkvikqiapaiepsngvdiidakghfvSPGFVDVHVH   60
DSSP  leeeelleeeelleeeeleeeeelleeeeeellllllllleeeelllleeEELEEEEEEL


DSSP  LLHH------HHHHllllllhhhhhllllhhhhhhhhhllllhhhllllllhhhhhhhhh
Query LDAK------DIVEnkpwndiwevegatdhyvwelmrrcgvseeyitgsrsnkekwlala   87
ident |          |                                                
Sbjct LREPggeykeTIET----------------------------------------------   74
DSSP  LLLLllllllLHHH----------------------------------------------


DSSP  hhhhhhlllhhhhhhhhhhhhhllllllllhhhhhhhhhhhhhhlllllHHHHHHHLLEE
Query kvfprfvgnptyewihldlwrrfnikkviseetaeeiweetkkklpemtPQKLLRDMKVE  147
ident                                                    |        
Sbjct -------------------------------------------------GTKAAARGGFT   85
DSSP  -------------------------------------------------HHHHHHHLLEE


DSSP  EEELLL-----LLLLL--LHHHHHHHHHLlLLEEELLLLLH--HHHLlllllhhhhhhhh
Query ILCTTD-----DPVST--LEHHRKAKEAVeGVTILPTWRPD--RAMNvdkegwreyvekm  198
ident   |                            |  ||                        
Sbjct TVCPXPntrpvPDSVEhfEALQKLIDDNA-QVRVLPYASITtrQLGK-------------  131
DSSP  EEEELLlllllLLLHHhhHHHHHHHHHHL-LLEELLLEELLhhHLLL-------------


DSSP  hhhhllllllhhhhhhHHHHhHHHHHLLLLLEEEEEelllllllllhhhhhhhhhhhlll
Query gerygedtstldgflnALWKsHEHFKEHGCVASDHAllepsvyyvdenraravhekafsg  258
ident                  |          |  |                            
Sbjct ----------------ELVD-FPALVKEGAFAFTDD------------------------  150
DSSP  ----------------LLLL-HHHHHLLLLLLEEEL------------------------


DSSP  llllhhhhhhHHHHHHHHHHHHHHHHLLEEEEEELE--ELLLlhhhhhhlllllLLLE--
Query ekltqdeindYKAFMMVQFGKMNQETNWVTQLHIGA--LRDYrdslfktlgpdsGGDI--  314
ident             |             |     |     |               |     
Sbjct ------gvgvQTASXXYEGXIEAAKVNKAIVAHCEDnsLIYG------------GAXHeg  192
DSSP  ------llllLLHHHHHHHHHHHHHHLLLEEELLLLhhHLLL------------LLEEll


DSSP  ----------ELLL---LLHHhHHHHHHHHLllLLLEEEE-ELLHHHHHHHHHHHHHLLL
Query ----------STNF---LRIAeGLRYFLNEFdgKLKIVLY-VLDPTHLPTISTIARAFPN  360
ident             |      ||                    |        |    ||   
Sbjct krskelgipgIPNIcesVQIA-RDVLLAEAA--GCHYHVChVSTKESVRVIRDAKRAGIH  249
DSSP  hhhhhhllleELLHhhhHHHH-HHHHHHHHH--LLLEEELlLLLHHHHHHHHHHHHLLLL


DSSP  EEELLLllllLLHH---------------------hhHHHHHHH-HLLLlhhhLLLLLLL
Query VYVGAPwwfnDSPF---------------------gmEMHLKYL-ASVDllynLAGMVTD  398
ident |                                       |                 ||
Sbjct VTAEVT--phHLLLteddipgnnaiykxnpplrstedREALLEGlLDGT----IDCIATD  303
DSSP  EEEEEL--hhHHHLlhhhlllllhhhllllllllhhhHHHHHHHhHLLL----LLEELLL


DSSP  LLL----------------lLHHHHHHHHHHHHHH-HHHHhhhhlllllhhhHHHHHHHH
Query SRK----------------lLSFGSRTEMFRRVLS-NVVGemvekgqipikeARELVKHV  441
ident                                     |                       
Sbjct HAPhardekaqpxekapfgiVGSETAFPLLYTHFVkNGDW------------TLQQLVDY  351
DSSP  LLLllhhhhlllllllllllLLLLLHHHHHHHHHLlLLLL------------LHHHHHHH


DSSP  HLHHHHHHHL--------------------------------------------------
Query SYDGPKALFF--------------------------------------------------  451
ident     |   |                                                   
Sbjct LTIKPCETFNleygtlkengyadltiidldseqeikgedflskadntpfigykvygnpil  411
DSSP  HLHHHHHHLLllllllllllllleeeeelllleellhhhllllllllllllleelleeee


DSSP  -----------
Query -----------  451
ident            
Sbjct txvegevkfeg  422
DSSP  eeelleeeeel


No 21: Query=1j5sA Sbjct=1onxA Z-score=12.5

back to top
DSSP  llllllllllllhhhhhhhHHHL-------------------------------------
Query hmflgedylltnraavrlfNEVK-------------------------------------   23
ident                                                             
Sbjct ---midytaagftllqgahLYAPedrgicdvlvangkiiavasnipsdivpnctvvdlsg   57
DSSP  ---llllhhhlleeeeeeeEELLleeeeeeeeeelleeeeeellllllllllleeeelll


DSSP  ---LLLEEELLLLLLhhhhhhllllllhhhhhLLLLhhhhhhhhhllllhhhllllllhh
Query ---DLPIVDPHNHLDakdivenkpwndiweveGATDhyvwelmrrcgvseeyitgsrsnk   80
ident         | | ||                                              
Sbjct qilCPGFIDQHVHLI---------ggggeagpTTRT------------------------   84
DSSP  leeEELEEEEEELLL---------lllllllhHHLL------------------------


DSSP  hhhhhhhhhhhhhlllhhhhhhhhhhhhhllllllllhhhhhhhhhhhhhhlllllHHHH
Query ekwlalakvfprfvgnptyewihldlwrrfnikkviseetaeeiweetkkklpemtPQKL  140
ident                                                             
Sbjct -----------------------------------------------------pevALSR   91
DSSP  -----------------------------------------------------lllLHHH


DSSP  HHHLLEEEEELLL-----llLLLL--HHHHHHHHHLllLEEELLLLLHHHHllllllhhh
Query LRDMKVEILCTTD-----dpVSTL--EHHRKAKEAVegVTILPTWRPDRAMnvdkegwre  193
ident |    |                       |   |                          
Sbjct LTEAGVTSVVGLLgtdsisrHPESllAKTRALNEEG--ISAWMLTGAYHVP---------  140
DSSP  HHHLLEEEEEELLlllllllLHHHhhHHHHHHHHHL--LEEEEEEELLLLL---------


DSSP  hhhhhhhhhllllllhhhhhHHHH-HHHHHhhLLLLLEEEEEELLlllllllhhhhhhhh
Query yvekmgerygedtstldgflNALW-KSHEHfkEHGCVASDHALLEpsvyyvdenraravh  252
ident                          |               |                  
Sbjct ----------------srtiTGSVeKDVAI--IDRVIGVXCAISD---------------  167
DSSP  ----------------llllLLLHhHHHHH--LLLEEEEEEEELL---------------


DSSP  hhhlllllllhhhhhhhHHHHHHHHHHHHHHHL------LEEEEEELEEllllhhhhhhl
Query ekafsgekltqdeindyKAFMMVQFGKMNQETN------WVTQLHIGALrdyrdslfktl  306
ident                                         ||  | |             
Sbjct -----------hrsaapDVYHLANMAAESRVGGllggkpGVTVFHMGDS-----------  205
DSSP  -----------llllllLHHHHHHHHHHHHHHHhhhlllLEEEEEELLL-----------


DSSP  llllllleelllLLHHHHHHHHHH--HLLLlLLEEEEE--LLHHHHHHHHHHHHHLllEE
Query gpdsggdistnfLRIAEGLRYFLN--EFDGkLKIVLYV--LDPTHLPTISTIARAFpnVY  362
ident                       |         |                   ||      
Sbjct ------------KKALQPIYDLLEncDVPI-SKLLPTHvnRNVPLFEQALEFARKG--GT  250
DSSP  ------------LLLLHHHHHHHHllLLLH-HHEEEELhhHLHHHHHHHHHHHHLL--LL


DSSP  ELLL-LLLLllhhHHHHHHHHHHLL-LLHHHLlLLLLLLLL---------------lLHH
Query VGAP-WWFNdspfGMEMHLKYLASV-DLLYNLaGMVTDSRK---------------lLSF  405
ident                             |        |                     |
Sbjct IDITsSIDE--pvAPAEGIARAVQAgIPLARV-TLSSDGNGsqpffddegnlthigvAGF  307
DSSP  EEEElLLLL--llLHHHHHHHHHHLlLLHHHE-EEELLLLLeeeeellllleeeeeeLLL


DSSP  HhHHHHHHHHHHHHHHhhhhlllllhhhHHHHHHHHHLHHHHHHHL--------------
Query GsRTEMFRRVLSNVVGemvekgqipikeARELVKHVSYDGPKALFF--------------  451
ident          ||                                                 
Sbjct E-TLLETVQVLVKDYD-----------fSISDALRPLTSSVAGFLNltgkgeilpgndad  355
DSSP  H-HHHHHHHHHHHHHL-----------lLHHHHHHHHLHHHHHHLLllllllllllllll


DSSP  -----------------------------------
Query -----------------------------------  451
ident                                    
Sbjct llvmtpelrieqvyargklmvkdgkacvkgtfetd  390
DSSP  eeeellllleeeeeelleeeeelleelllllllll


No 22: Query=1j5sA Sbjct=2vunA Z-score=12.4

back to top
DSSP  -----------------------------------llllllllllllhhhhhhhhhhlLL
Query -----------------------------------hmflgedylltnraavrlfnevkDL   25
ident                                                             
Sbjct sktiiknigkivsgdikspvlqadtivvedgliaaiggeelmkdagdatiidaagstvTP   60
DSSP  leeeeellleeellllllleellleeeeelleeeeeelhhhhlllllleeeelllleeEE


DSSP  LEEELLLLLLHHHHhhllllllhhhhhlLLLHhhhhhhhhllllhhhllllllhhhhhhh
Query PIVDPHNHLDAKDIvenkpwndiwevegATDHyvwelmrrcgvseeyitgsrsnkekwla   85
ident    | | |    |                                               
Sbjct GLLDTHVHVSGGDY-------------aPRQK----------------------------   79
DSSP  LEEEEEELLLLLLE-------------eHHHL----------------------------


DSSP  hhhhhhhhlllhhhhhhhhhhhhhllllllllhhhhhhhhhhhhhhllllLHHHHHHHLL
Query lakvfprfvgnptyewihldlwrrfnikkviseetaeeiweetkkklpemTPQKLLRDMK  145
ident                                                             
Sbjct ------------------------------------------------tmDFISSALHGG   91
DSSP  ------------------------------------------------eeLHHHHHHLLL


DSSP  EEEEELLL-------------LLLLlLHHHHHHHHHL-LLLEEE-LLLLLHHHhllllll
Query VEILCTTD-------------DPVStLEHHRKAKEAV-EGVTIL-PTWRPDRAmnvdkeg  190
ident |                                  |   ||                   
Sbjct VTTMISAGsphfpgrpkdaagTKALaITLSKSYYNARpAGVKVHgGAVILEKG-------  144
DSSP  EEEEEELLllllllllllhhhHHHHhHHHHHHHHHLLhHHLEEElLEELLLLL-------


DSSP  hhhhhhhhhhhhllllllhhhhhhHHHHHHHHHHLLLLLEEEEEElllllllllhhhhhh
Query wreyvekmgerygedtstldgflnALWKSHEHFKEHGCVASDHALlepsvyyvdenrara  250
ident                                  |  |                       
Sbjct ------------------------LTEEDFIEMKKEGVWIVGEVG---------------  165
DSSP  ------------------------LLHHHHHHHHHLLLLEEEEEL---------------


DSSP  hhhhhlllllllhhhhhhhHHHHHHHHHHHHHHHLLEEEEEELEELLLlhhhhhhlllll
Query vhekafsgekltqdeindyKAFMMVQFGKMNQETNWVTQLHIGALRDYrdslfktlgpds  310
ident                                       | | |                 
Sbjct --------------lgtikNPEDAAPMVEWAHKHGFKVQMHTGGTSIP------------  199
DSSP  --------------lllllLHHHHHHHHHHHHHLLLEEEEELLLLLLL------------


DSSP  lLLEElllllHHHHHHHHHhhllllllEEEE------eLLHH-HHHHHHHHHhhllLEEE
Query gGDIStnflrIAEGLRYFLnefdgklkIVLY------vLDPT-HLPTISTIArafpNVYV  363
ident  |         |                |                  |            
Sbjct -GSST----vTADDVIKTK-------pDVVShinggptAISVqEVDRIMDET----DFAM  243
DSSP  -LLLL----lLHHHHHHHL-------lLEEElllllllLLLHhHHHHHHHHL----LLEE


DSSP  LLlllllLLHHHHHHHHHHHHLLLLHHHLlLLLLLLLL--lLHHHhHHHHHHHHH-HHHH
Query GApwwfnDSPFGMEMHLKYLASVDLLYNLaGMVTDSRK--lLSFGsRTEMFRRVL-SNVV  420
ident          |          |    |        |      |              |   
Sbjct EI--vqcGNPKIADYVARRAAEKGQLGRV-IFGNDAPSgtgLIPL-GILRNMCQIaSMSD  299
DSSP  EE--ellLLHHHHHHHHHHHHHHLLHHHE-EEELLLLLlllLLLL-HHHHHHHHHhHHLL


DSSP  hhhhhlllllhhhHHHHHHHHHLHHHHHHHL-----------------------------
Query gemvekgqipikeARELVKHVSYDGPKALFF-----------------------------  451
ident                |           |                                
Sbjct ------------iDPEVAVCMATGNSTAVYGlntgviapgkeadliimdtplgsvaedam  347
DSSP  ------------lLHHHHHHHHLHHHHHHHLllllllllllllleeeeelllllllllhh


DSSP  --------------------------------------
Query --------------------------------------  451
ident                                       
Sbjct gaiaagdipgisvvlidgeavvtksrntppakraakil  385
DSSP  hhhhhlllleeeeeeelleeeellllllllllllleel


No 23: Query=1j5sA Sbjct=3giqA Z-score=12.1

back to top
DSSP  -------------------------------llllllllllllhhhhhhhhhhlLLLEEE
Query -------------------------------hmflgedylltnraavrlfnevkDLPIVD   29
ident                                                            |
Sbjct ekldfkitggwiidgtgaprrradlgvrdgriaaigelgahparhawdasgkivAPGFID   60
DSSP  lleeeeeelleelllllllleeleeeeelleeeeeelllllleeeeeelllleeEELEEE


DSSP  LLLLLLHhHHHHLlllllhhhhhllllhhhhhhhhhllllhhhllllllhhhhhhhhhhh
Query PHNHLDAkDIVENkpwndiwevegatdhyvwelmrrcgvseeyitgsrsnkekwlalakv   89
ident  | | |    ||                                                
Sbjct VHGHDDL-MFVEK-----------------------------------------------   72
DSSP  LLLLLLL-HHHHL-----------------------------------------------


DSSP  hhhhlllhhhhhhhhhhhhhllllllllhhhhhhhhhhhhhhlllllHHHHHHHLLEEEE
Query fprfvgnptyewihldlwrrfnikkviseetaeeiweetkkklpemtPQKLLRDMKVEIL  149
ident                                                             
Sbjct ----------------------------------------------pDLRWKTSQGITTV   86
DSSP  ----------------------------------------------lLLHHHHLLLEEEE


DSSP  ELL----LLLL---------------------LLLHHHHHHHHHLLLLEEELLLLLHHHH
Query CTT----DDPV---------------------STLEHHRKAKEAVEGVTILPTWRPDRAM  184
ident                                                             
Sbjct VVGncgvSAAPaplpgntaaalallgetplfaDVPAYFAALDAQRPMINVAALVGHANLR  146
DSSP  EELllllLLLLllllllllhhhhhhlllllllLHHHHHHHHHHLLLLLEEEEEEEHHHHH


DSSP  LlllllHHHHhhhhhhhhllllllHHHHHHHHHHHHHHHHLLLLLEEEEEELllllllll
Query NvdkegWREYvekmgerygedtstLDGFLNALWKSHEHFKEHGCVASDHALLepsvyyvd  244
ident        |                      |         | | |     |         
Sbjct L---aaMRDP----------qaapTAAEQQAMQDMLQAALEAGAVGFSTGLA--------  185
DSSP  H---hhLLLL----------llllLHHHHHHHHHHHHHHHHHLLLEEEEELL--------


DSSP  hhhhhhhhhhhlllllllhhhhhHHHHHHHHHHHHHHHHHLLEEEEEELEellllhhhhh
Query enraravhekafsgekltqdeinDYKAFMMVQFGKMNQETNWVTQLHIGAlrdyrdslfk  304
ident                           |           |       ||            
Sbjct ------------------yqpgaVAQAAELEGLARVAAERRRLHTSHIRN----------  217
DSSP  ------------------lllhhHLLHHHHHHHHHHHHHLLLEEEEELLL----------


DSSP  hlllllllleelllLLHHHHHHHHHHHLLL-LLLEEE--EELL----HHHHHHHHHHHHH
Query tlgpdsggdistnfLRIAEGLRYFLNEFDG-KLKIVL--YVLD----PTHLPTISTIARA  357
ident                         |    |     |                        
Sbjct ------------eaDGVEAAVEEVLAIGRGtGCATVVshHKCMmpqnWGRSRATLANIDR  265
DSSP  ------------llLLHHHHHHHHHHHHHHhLLEEEEllLLLLlhhhLLLHHHHHHHHHH


DSSP  LL----LEEELLLllllLLHH---------------------------------------
Query FP----NVYVGAPwwfnDSPF---------------------------------------  374
ident        |           |                                        
Sbjct AReqgvEVALDIY----PYPGsstiliperaetiddiritwstphpecsgeyladiaarw  321
DSSP  HHhlllLEEEEEL----LLLEeeeellhhhllllllleeeeelllhhhllllhhhhhhhh


DSSP  --------------------hhHHHHHHHhlllLHHHLlLLLLLLLL-----llHHHHHH
Query --------------------gmEMHLKYLasvdLLYNLaGMVTDSRK-----llSFGSRT  409
ident                       |   |                |                
Sbjct gcdkttaarrlapagaiyfamdEDEVKRI---fQHPCC-MVGSDGLPndarphpRLWGSF  377
DSSP  lllhhhhhhhhlleeeeeelllHHHHHHH---hHLLLE-EELLLLLLlllllllHHHHHH


DSSP  HHHHHHHH-HHHHhhhhlllllhhhHHHHHHHHHLHHHHHHHL-----------------
Query EMFRRVLS-NVVGemvekgqipikeARELVKHVSYDGPKALFF-----------------  451
ident                            |         |   |                  
Sbjct TRVLGRYVrEARL-----------mTLEQAVARMTALPARVFGfaergvlqpgawadvvv  426
DSSP  HHHHHHHHhHLLL-----------lLHHHHHHHHLHHHHHHHLlllllllllllllleee


DSSP  -------------------------------------------------
Query -------------------------------------------------  451
ident                                                  
Sbjct fdpdtvadratwdeptlasvgiagvlvngaevfpqppadgrpgqvlrax  475
DSSP  elllllllllllllllllllleeeeeelleeeellllllllllllllll


No 24: Query=1j5sA Sbjct=3gg7A Z-score=12.1

back to top
DSSP  llllllllllllhhhhhhhhhhlllLEEELLLLLL----HHHHhhllllllhhhhhllll
Query hmflgedylltnraavrlfnevkdlPIVDPHNHLD----AKDIvenkpwndiwevegatd   56
ident                             | | |||                         
Sbjct -------------------------SLIDFHVHLDlypdPVAV-----------------   18
DSSP  -------------------------LLEEEEELHHhlllHHHH-----------------


DSSP  hhhhhhhhhllllhhhllllllhhhhhhhhhhhhhhhlllhhhhhhhhhhhhhlllllll
Query hyvwelmrrcgvseeyitgsrsnkekwlalakvfprfvgnptyewihldlwrrfnikkvi  116
ident                                                             
Sbjct ------------------------------------------------------------   18
DSSP  ------------------------------------------------------------


DSSP  lhhhhhhhhhhhhhhlllllhhhHHHHLLEeEEELLLL---LLLL-LHHHHHHhhhlllL
Query seetaeeiweetkkklpemtpqkLLRDMKVeILCTTDD---PVST-LEHHRKAkeavegV  172
ident                                               |             
Sbjct ---------------------arACEERQL-TVLSVTTtpaAWRGtLALAAGR------P   50
DSSP  ---------------------hhHHHHLLL-EEEELLLlhhHHHHhHHHHLLL------L


DSSP  EEELLLLLHhhHLLLLllhhhhhhhhhhhhllllllhhhHHHHHHHHHHHhhlllLLEEE
Query TILPTWRPDraMNVDKegwreyvekmgerygedtstldgFLNALWKSHEHfkehgCVASD  232
ident                                         |                   
Sbjct HVWTALGFHpeVVSER---------------------aaDLPWFDRYLPE-----TRFVG   84
DSSP  LEEELLLLLhhHLLLL---------------------hhHLHHHHHHHHH-----LLEEE


DSSP  -EEELLLllllllhhhhhhhhhhhlllllllhHHHHHHHHHHHHHHHHHHHHH-LLEEEE
Query -HALLEPsvyyvdenraravhekafsgekltqDEINDYKAFMMVQFGKMNQET-NWVTQL  290
ident    |                                                        
Sbjct eVGLDGS----------------------pslRGTWTQQFAVFQHILRRCEDHgGRILSI  122
DSSP  eEELLLL----------------------hhhHHHHHHHHHHHHHHHHHHHHLlLEEEEE


DSSP  EELeellllhhhhhhlllllllleelllLLHHhHHHHHHHHLLLLLLEEE-EELLhhHHH
Query HIGalrdyrdslfktlgpdsggdistnfLRIAeGLRYFLNEFDGKLKIVL-YVLDptHLP  349
ident |                                     |          |          
Sbjct HSR-------------------------RAES-EVLNCLEANPRSGTPILhWYSG--SVT  154
DSSP  ELL-------------------------LLHH-HHHHHHHHLHHHEEEEEeLLLL--LHH


DSSP  HhHHHHHHLLlEEELLLlllLLLHH-HHHHHHHHHhlllLHHHLlLLLLLLL------ll
Query TiSTIARAFPnVYVGAPwwfNDSPF-GMEMHLKYLasvdLLYNLaGMVTDSR------kl  402
ident      |                                          ||          
Sbjct E-LRRAISLG-CWFSVG--pTMVRTqKGAALIRSM----PRDRV-LTETDGPfleldgqa  205
DSSP  H-HHHHHHLL-LEEEEL--hHHHLLhHHHHHHHHL----LHHHE-EELLLLLlleellee


DSSP  LHHHhHHHHHHHHHHHHHHhhhhlllllhhhHHHHHHHHHLHHHHHHHL-
Query LSFGsRTEMFRRVLSNVVGemvekgqipikeARELVKHVSYDGPKALFF-  451
ident              ||                    |          |   
Sbjct ALPW-DVKSVVEGLSKIWQ-----------iPASEVERIVKENVSRLLGt  243
DSSP  LLHH-HHHHHHHHHHHHHL-----------lLHHHHHHHHHHHHHHHHHl


No 25: Query=1j5sA Sbjct=4ofcA Z-score=12.0

back to top
DSSP  llllllllllllhhhhhhhhhhlllLEEELLLLLL-------------------------
Query hmflgedylltnraavrlfnevkdlPIVDPHNHLD-------------------------   35
ident                             | | |                           
Sbjct -------------------------MKIDIHSHILpkewpdlkkrfgyggwvqlqhhskg   35
DSSP  -------------------------LLEEEEEELLllllllhhhhhllllleeeeeeell


DSSP  -----------------hHHHHhllllllhhhhhllllhhhhhhhhhllllhhhllllll
Query -----------------aKDIVenkpwndiwevegatdhyvwelmrrcgvseeyitgsrs   78
ident                    |                                        
Sbjct eakllkdgkvfrvvrencWDPE--------------------------------------   57
DSSP  eeeeeelleeeeeeehhhLLHH--------------------------------------


DSSP  hhhhhhhhhhhhhhhlllhhhhhhhhhhhhhllllllllhhhhhhhhhhhhhhllllLHH
Query nkekwlalakvfprfvgnptyewihldlwrrfnikkviseetaeeiweetkkklpemTPQ  138
ident                                                             
Sbjct ---------------------------------------------------------VRI   60
DSSP  ---------------------------------------------------------HHH


DSSP  HHHHHLLEEEEELLL----------------lLLLLLHHHHHHHHHLllLEEELLLLLhh
Query KLLRDMKVEILCTTD----------------dPVSTLEHHRKAKEAVegVTILPTWRPdr  182
ident        |                                                    
Sbjct REMDQKGVTVQALSTvpvmfsywakpedtlnlCQLLNNDLASTVVSY-pRRFVGLGTL--  117
DSSP  HHHHHHLLLEEEEELlhhhhlllllhhhhhhhHHHHHHHHHHHHHHL-lLLEEEEELL--


DSSP  HHLLllllhhhhhhhhhhhhllllllhhhhHHHHHHHHHHHH-LLLLLEEEEEEL----L
Query AMNVdkegwreyvekmgerygedtstldgfLNALWKSHEHFK-EHGCVASDHALL----E  237
ident  |                                 |  |    | |              
Sbjct PMQA--------------------------PELAVKEMERCVkELGFPGVQIGTHvnewD  151
DSSP  LLLL--------------------------HHHHHHHHHHHHhLLLLLEEEEELEelleE


DSSP  LLLllllhhhhhhhhhhhlllllllhhhhhhhhhHHHHHHHHHHHHHLLEEEEEElEELL
Query PSVyyvdenraravhekafsgekltqdeindykaFMMVQFGKMNQETNWVTQLHIgALRD  297
ident                                                      |      
Sbjct LNA-------------------------------QELFPVYAAAERLKCSLFVHP-WDMQ  179
DSSP  LLL-------------------------------HHHHHHHHHHHHHLLEEEEEL-LLLL


DSSP  LLHHHHhhllllLLLL---EELL-llLHHHHHH--HHHHHLLlLLLEEE--EELLhhHHH
Query YRDSLFktlgpdSGGD---ISTN-flRIAEGLR--YFLNEFDgKLKIVL--YVLDptHLP  349
ident                                         |  |||              
Sbjct MDGRMA-----kYWLPwlvGMPAettIAICSMImgGVFEKFP-KLKVCFahGGGA--FPF  231
DSSP  LLHHHH-----lLLHHhhlHHHHhhhHHHHHHHllLHHHHLL-LLLEEElhHHLL--HHH


DSSP  H---------------------hhHHHHhlllEEELLLLllLLLHHHHHHHHHHHhllll
Query T---------------------isTIARafpnVYVGAPWwfNDSPFGMEMHLKYLasvdl  388
ident |                                           |               
Sbjct TvgrishgfsmrpdlcaqdnpmnpKKYL---gSFYTDAL--VHDPLSLKLLTDVI-----  281
DSSP  HhhhhhhhhhhlhhhhlllllllhHHHL---lLLEEELL--LLLHHHHHHHHHHH-----


DSSP  HHHLLLLLLLLLLLlHHHHHHHHHHHhhHHHHhhhhhlllllhhhHHHHHHHHHLHHHHH
Query LYNLAGMVTDSRKLlSFGSRTEMFRRvlSNVVgemvekgqipikeARELVKHVSYDGPKA  448
ident         ||                                     |           |
Sbjct GKDKVILGTDYPFPlGELEPGKLIES--MEEF-------------DEETKNKLKAGNALA  326
DSSP  LLLLEELLLLLLLLlLLLLLLHHHHH--LLLL-------------LHHHHHHHHLHHHHH


DSSP  HHL------
Query LFF------  451
ident          
Sbjct FLGlerkqf  335
DSSP  HHLllhhhl


No 26: Query=1j5sA Sbjct=4hk5D Z-score=11.9

back to top
DSSP  llllllllllllhhhhhhhhhhlLLLEEELLLLLLHHhhhhllllllhhhhhllllhhhh
Query hmflgedylltnraavrlfnevkDLPIVDPHNHLDAKdivenkpwndiwevegatdhyvw   60
ident                            || | |                           
Sbjct -----------------------TPVVVDIHTHMYPP--------------------syi   17
DSSP  -----------------------LLLLEEEEEEELLH--------------------hhh


DSSP  hhhhhllllhhhLLLLLLH------------------hhhhHHHHhhhhhhlllhhhhhh
Query elmrrcgvseeyITGSRSN------------------kekwLALAkvfprfvgnptyewi  102
ident              |                             |                
Sbjct amlekrqtiplvRTFPQADeprlillsselaaldaaladpaAKLP---------------   62
DSSP  hhhhlllllleeEEELLEEeeeeellhhhhhhhhhhhhlllLLLL---------------


DSSP  hhhhhhhllllllllhhhhhhhhhhhhhhllllLHHHHHHHLLEEEEELLL---------
Query hldlwrrfnikkviseetaeeiweetkkklpemTPQKLLRDMKVEILCTTD---------  153
ident                                                             
Sbjct ---------------------grplsthfaslaQKMHFMDTNGIRVSVISLanpwfdfla  101
DSSP  ---------------------leellhhhllhhHHHHHHHHLLLLEEEEEElllllllll


DSSP  -------LLLLLLHhHHHHHHHLllLEEELLLLLHHHhllllllhhhhhhhhhhhhllll
Query -------DPVSTLEhHRKAKEAVegVTILPTWRPDRAmnvdkegwreyvekmgerygedt  206
ident              |        |                                     
Sbjct pdeapgiADAVNAEfSDMCAQHV--GRLFFFAALPLS-----------------------  136
DSSP  lllhhhhHHHHHHHhHHHHHLLL--LLEEEEEELLLL-----------------------


DSSP  llhhhHHHHHHHHHHHHHLL-LLLEEEEEEL---LLLLllllhhhhhhhhhhhlllllll
Query stldgFLNALWKSHEHFKEH-GCVASDHALL---EPSVyyvdenraravhekafsgeklt  262
ident         |   | |  |    |                                     
Sbjct ----aPVDAVKASIERVKNLkYCRGIILGTSglgKGLD----------------------  170
DSSP  ----lLHHHHHHHHHHHHLLlLEEEEEELLLlllLLLL----------------------


DSSP  hhhhhhhhHHHHHHHHHHHHHHLLEEEEEELEELLLLHHHhhhlllllllLEEL----ll
Query qdeindykAFMMVQFGKMNQETNWVTQLHIGALRDYRDSLfktlgpdsggDIST----nf  318
ident                            ||                               
Sbjct --------DPHLLPVFEAVADAKLLVFLHPHYGLPNEVYGprseeyghvlPLALgfpmet  222
DSSP  --------LHHHHHHHHHHHHLLLEEEELLLLLLLHHHHLllhhhlllhhHHHLhhhhhh


DSSP  lLHHHHHH--HHHHHLLlLLLEEEEellHHHHHH----------------------hhhh
Query lRIAEGLR--YFLNEFDgKLKIVLYvldPTHLPT----------------------isti  354
ident                    |   |     |                              
Sbjct tIAVARMYmaGVFDHVR-NLQMLLAhsgGTLPFLagriescivhdghlvktgkvpkdrrt  281
DSSP  hHHHHHHHhlLHHHHLL-LLLEEEHhhhLLHHHHhhhhhhhhhllhhhhhllllllllll


DSSP  HHHL--LLEEELLLllllllhhHHHHHHHHHHLLLLHHHLlLLLLLLLL-------llhh
Query ARAF--PNVYVGAPwwfndspfGMEMHLKYLASVDLLYNLaGMVTDSRK-------llsf  405
ident          |  |           |  |           |    ||              
Sbjct IWTVlkEQIYLDAV-------iYSEVGLQAAIASSGADRL-MFGTDHPFfppieedvqgp  333
DSSP  HHHHhhHLEEEELL-------lLLHHHHHHHHHHHLHHHE-ELLLLLLLlllllllllll


DSSP  HHHHHHHHHHHHHHHHhhhhlllllhhhHHHHHHHHHLHHHHHHHL------------
Query GSRTEMFRRVLSNVVGemvekgqipikeARELVKHVSYDGPKALFF------------  451
ident               ||                   |                      
Sbjct WDSSRLNAQAVIKAVG-----------eGSSDAAAVMGLNAVRVLSlkaelehhhhhh  380
DSSP  LHHHHHHHHHHHHHHL-----------lLLHHHHHHHLHHHHHHLLlhhhhhhhhhhl


No 27: Query=1j5sA Sbjct=2pajA Z-score=11.9

back to top
DSSP  llllllllllllhhhhhhhHHHL-------------------------------------
Query hmflgedylltnraavrlfNEVK-------------------------------------   23
ident                                                             
Sbjct ---------pstlirnaaaIMTGgrgtaddpsrvpgpdirivgdtidaigalaprpgeti   51
DSSP  ---------leeeeellleELLLllllllllllllllleeeelleeeeelllllllllee


DSSP  --------LLLEEELLLLLL------------------hHHHHhllllllhhhhhllllh
Query --------DLPIVDPHNHLD------------------aKDIVenkpwndiwevegatdh   57
ident             |  | ||                                         
Sbjct vdatdcviYPAWVNTHHHLFqsllkgepfralfderrfrLAAR-----------------   94
DSSP  eelllleeEELEELLLLLHHhhhllllllhhhllhhhhhHHHH-----------------


DSSP  hhhhhhhhllllhhhllllllhhhhhhhhhhhhhhhlllhhhhhhhhhhhhhllllllll
Query yvwelmrrcgvseeyitgsrsnkekwlalakvfprfvgnptyewihldlwrrfnikkvis  117
ident                                                             
Sbjct ------------------------------------------------------------   94
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhhhhhhhhlllllHHHHHHHLLEEEEELLLLLL------LLLHHHHHHHHHLLl
Query eetaeeiweetkkklpemtPQKLLRDMKVEILCTTDDPV------STLEHHRKAKEAVEg  171
ident                        |                               |    
Sbjct ------------------iGLIELARSGCATVADHNYVYypgmpfDSSAILFEEAEKLG-  135
DSSP  ------------------hHHHHHHLLLEEEEEELLLLLllllllLHHHHHHHHHHHLL-


DSSP  LEEELLLLLHhhHLLLLLL--hHHHHHhhhhhhllllllhhhHHHHHHHHHHHH-HLLL-
Query VTILPTWRPDraMNVDKEG--wREYVEkmgerygedtstldgFLNALWKSHEHF-KEHG-  227
ident                                            | |     |        
Sbjct LRFVLLRGGA--TQTRQLEadlPTALR-------------peTLDAYVADIERLaARYHd  180
DSSP  LEEEEEELLL--LLLLLLLlllLHHHL-------------llLHHHHHHHHHHHhHHLLl


DSSP  -------LLEEE-EEELllllllllhhhhhhhhhhhlllllllhhhhhhhHHHHHHHHHH
Query -------CVASD-HALLepsvyyvdenraravhekafsgekltqdeindyKAFMMVQFGK  279
ident         |       |                                     |     
Sbjct aspramrRVVMApTTVL------------------------------ysiSPREMRETAA  210
DSSP  lllllleEEEELlLLLL------------------------------lllLHHHHHHHHH


DSSP  HHHHHLLEEEEEELeellllhhhhhhlllllllleellLLLHHHHHHHHHhhlllllLEE
Query MNQETNWVTQLHIGalrdyrdslfktlgpdsggdistnFLRIAEGLRYFLnefdgklKIV  339
ident            |                                                
Sbjct VARRLGLRMHSHLS------------------------GKSPVAFCGEHD---wlgsDVW  243
DSSP  HHHHLLLEEEEELL------------------------LLLHHHHHHHLL---llllLEE


DSSP  E-EELLhhHHHHHHHHHHHLLlEEELL---lLLLLllhhhhhhHHHHHHLLLlhhHLLLL
Query L-YVLDptHLPTISTIARAFPnVYVGA---pWWFNdspfgmemHLKYLASVDllyNLAGM  395
ident                         |                       |           
Sbjct YaHLVK--VDADEIALLAQTG-TGVAHcpqsNGRL--------PVREMADAG---VPVSI  289
DSSP  EeLLLL--LLHHHHHHHHHHL-LEEEElhhhHHLL--------LLLLHHHHL---LLEEE


DSSP  LLLLL--LLLHH-HHHHHHHHHHHhHHHHhhhhlllllhhhHHHHHHHHHLHHHHHHHL-
Query VTDSR--KLLSF-GSRTEMFRRVLsNVVGemvekgqipikeARELVKHVSYDGPKALFF-  451
ident   |           |   |                          | |    |       
Sbjct GVDGAasNEAADmISEVHMTWLAQ-RARL-----------aSIAEVIHWGTAGGARVMGl  337
DSSP  LLLHHhhLLLLLhHHHHHHHHHHH-HHLL-----------lLHHHHHHHHLHHHHHHHLl


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  451
ident                                                             
Sbjct devgkvavgyaadiavyrlddpryfglhdpaigpvasggrpsvmalfsagkrvvvddlie  397
DSSP  llllllllllllleeeeelllhhhlllllhhhhhhhllllleeeeeeelleeeeelllll


DSSP  ------------------------
Query ------------------------  451
ident                         
Sbjct gvdikelggearrvvrellrevvv  421
DSSP  lllhhhhhhhhhhhhhhhhhhhhl


No 28: Query=1j5sA Sbjct=3nqbA Z-score=11.8

back to top
DSSP  --------------llllllllllllhhhhhhHHHH------------------------
Query --------------hmflgedylltnraavrlFNEV------------------------   22
ident                                    |                        
Sbjct epadlnddtlraravaaargdqrfdvlitggtLVDVvtgelrpadigivgaliasvhepa   60
DSSP  llhhhllhhhhhhhhhhhhlllleeeeeelleEELLlllleeeleeeeelleeeeeelll


DSSP  ---------------lLLLEEELLLLLL--hHHHHhllllllhhhhhllllhhhhhhhhh
Query ---------------kDLPIVDPHNHLD--aKDIVenkpwndiwevegatdhyvwelmrr   65
ident                      | | |                                  
Sbjct srrdaaqvidaggayvSPGLIDTHXHIEssxITPA-------------------------   95
DSSP  lllleeeeeelllleeEELEEEEEELHHhhlLLHH-------------------------


DSSP  llllhhhllllllhhhhhhhhhhhhhhhlllhhhhhhhhhhhhhllllllllhhhhhhhh
Query cgvseeyitgsrsnkekwlalakvfprfvgnptyewihldlwrrfnikkviseetaeeiw  125
ident                                                             
Sbjct ------------------------------------------------------------   95
DSSP  ------------------------------------------------------------


DSSP  hhhhhhllllLHHHHHHHLLEEEEELLLL------lLLLL-HHHHHHHHhlLLLEEELLL
Query eetkkklpemTPQKLLRDMKVEILCTTDD------pVSTL-EHHRKAKEavEGVTILPTW  178
ident                     |               |                       
Sbjct ----------AYAAAVVARGVTTIVWDPHefgnvhgVDGVrWAAKAIEN--LPLRAILLA  143
DSSP  ----------HHHHHHHLLLEEEEEELLHhhhhhhlHHHHhHHHHHHLL--LLLEEEEEE


DSSP  LLHHHHLLLLLLhHHHHhhhhhhhllllllhhhHHHHHHHHHHhhhLLLLLEE-EEEELl
Query RPDRAMNVDKEGwREYVekmgerygedtstldgFLNALWKSHEhfkEHGCVAS-DHALLe  237
ident           |                          |                      
Sbjct PSCVPSAPGLER-GGAD---------------fDAAILADLLS---WPEIGGIaEIXNXr  184
DSSP  LLLLLLLLLLLL-LLLL---------------lLHHHHHHHHL---LLLEEEEeEELLHh


DSSP  llLLLLlhhhhhhhhhhhlllllllhhhhhhhhhHHHHHHHHHHHHHLLEEEEEELeell
Query psVYYVdenraravhekafsgekltqdeindykaFMMVQFGKMNQETNWVTQLHIGalrd  297
ident                                                      |      
Sbjct gvIERD----------------------------PRXSGIVQAGLAAEKLVCGHAR----  212
DSSP  hhHLLL----------------------------HHHHHHHHHHHHHLLEEEELLL----


DSSP  llhhhhhhlllllllleelllLLHHHHHHHHHHHLlllllEEEEELLH-HHHHHHHHHHh
Query yrdslfktlgpdsggdistnfLRIAEGLRYFLNEFdgklkIVLYVLDP-THLPTISTIAr  356
ident                            |  |              |     |        
Sbjct ---------------------GLKNADLNAFXAAG----vSSDHELVSgEDLXAKLRAG-  246
DSSP  ---------------------LLLHHHHHHHHHLL----lLEELLLLLhHHHHHHHHLL-


DSSP  hlllEEELLLlllLLLHhHHHHHHHHHHLLLLHHHLLLLLLLLLL------lLHHHHHHH
Query afpnVYVGAPwwfNDSPfGMEMHLKYLASVDLLYNLAGMVTDSRK------lLSFGSRTE  410
ident                           |     |       ||                  
Sbjct ----LTIELR--gSHDH-LLPEFVAALNTLGHLPQTVTLCTDDVFpddllqgGGLDDVVR  299
DSSP  ----LEEEEE--lLLHH-HHHHHHHHHHHHLLLLLLEEEELLLLLhhhhhhlLLHHHHHH


DSSP  HHHHHHHHhhhhhhhlllllhhhhhHHHHHHHLHHHHHHHL-------------------
Query MFRRVLSNvvgemvekgqipikearELVKHVSYDGPKALFF-------------------  451
ident    |                     |                                  
Sbjct RLVRYGLK----------------pEWALRAATLNAAQRLGrsdlgliaagrradivvfe  343
DSSP  HHHHLLLL----------------hHHHHHHHLHHHHHHHLlllllllllllllleeeel


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  451
ident                                                             
Sbjct dlngfsarhvlasgravaeggrxlvdiptcdttvlkgsxklplrxandflvksqgakvrl  403
DSSP  lllllleeeeeelleeeeelleelllllllllhhhllllllllllhhhhllllllleeee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  451
ident                                                             
Sbjct atidrprftqwgeteadvkdgfvvppegatxisvthrhgxaepttktgfltgwgrwngaf  463
DSSP  eeeellllleeeeeeeeeelleellllleeeeeeellllllllleeeeeeelllllllee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  451
ident                                                             
Sbjct attvshdshnltvfggnagdxalaanavigtgggxavasegkvtailplplsglvsdapl  523
DSSP  eelllllllleeeeellhhhhhhhhhhhhhllleeeeeelleeeeeeelllllllllllh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  451
ident                                                             
Sbjct eevarafedlreavgkvvewqppylvfkacfgatlacnigphqtdxgiadvltgkvxesp  583
DSSP  hhhhhhhhhhhhhhhhhlllllllllhhhhhlllllllllleelllleeelllleeelll


DSSP  ----
Query ----  451
ident     
Sbjct viev  587
DSSP  eeel


No 29: Query=1j5sA Sbjct=1k6wA Z-score=11.8

back to top
DSSP  ---------------------------llllllllllllhhhhhhhhhhlLLLEEELLLL
Query ---------------------------hmflgedylltnraavrlfnevkDLPIVDPHNH   33
ident                                                     | | || |
Sbjct alqtiinarlpgeeglwqihlqdgkisaidaqsgvmpitensldaeqglvIPPFVEPHIH   60
DSSP  llleeeeellllllleeeeeeelleeeeeeeellllllllleeelllleeELLEEEEEEL


DSSP  LL-----------------------------------HHHHHhllllllhhhhhllllhh
Query LD-----------------------------------AKDIVenkpwndiwevegatdhy   58
ident ||                                                          
Sbjct LDttqtagqpnwnqsgtlfegierwaerkallthddvKQRAW------------------  102
DSSP  LLlllllllllllllllhhhhhhhhhllhhhllhhhhHHHHH------------------


DSSP  hhhhhhhllllhhhllllllhhhhhhhhhhhhhhhlllhhhhhhhhhhhhhllllllllh
Query vwelmrrcgvseeyitgsrsnkekwlalakvfprfvgnptyewihldlwrrfnikkvise  118
ident                                                             
Sbjct ------------------------------------------------------------  102
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhhhhhhhlllllHHHHHHHLLEEEEELLLLL---LLLL-HHHHHHHHHL-LLLE
Query etaeeiweetkkklpemtPQKLLRDMKVEILCTTDDP---VSTL-EHHRKAKEAV-EGVT  173
ident                     |           |  |      |        |  |     
Sbjct -----------------qTLKWQIANGIQHVRTHVDVsdaTLTAlKAMLEVKQEVaPWID  145
DSSP  -----------------hHHHHHHHLLEEEEEEEEELlllLLHHhHHHHHHHHHHlLLLE


DSSP  EELLLLLHHHHLLllllhhhhhhhhhhhhllllllhhHHHHHHHHHHHHHhlllLLEEEE
Query ILPTWRPDRAMNVdkegwreyvekmgerygedtstldGFLNALWKSHEHFkehgCVASDH  233
ident       |                                   |                 
Sbjct LQIVAFPQEGILS----------------------ypNGEALLEEALRLG----ADVVGA  179
DSSP  EEEEEELLLLLLL----------------------llLHHHHHHHHHHLL----LLEEEE


DSSP  EELllllllllhhhhhhhhhhhlllllllhhhHHHHHHHHHHHHHHHHHHHLLEEEE-EE
Query ALLepsvyyvdenraravhekafsgekltqdeINDYKAFMMVQFGKMNQETNWVTQL-HI  292
ident                                    |            |           
Sbjct IPH--------------------------fefTREYGVESLHKTFALAQKYDRLIDVhCD  213
DSSP  LHH--------------------------hllLHHHHHHHHHHHHHHHHHHLLEEEEeEL


DSSP  LEellllhhhhhhlllllllleELLLLLHhhhHHHHHHHLLLllLEEE-EELLHHH----
Query GAlrdyrdslfktlgpdsggdiSTNFLRIaegLRYFLNEFDGklKIVL-YVLDPTH----  347
ident                            |                                
Sbjct EI--------------------DDEQSRFvetVAALAHHEGMgaRVTAsHTTAMHSynga  253
DSSP  LL--------------------LLLLLLHhhhHHHHHHHHLLhhHEEEeELHHHHHllhh


DSSP  -hHHHHHHHHHLLlEEELL--llLLLL-------lhhhhhhHHHHHHLLLLhhhLLLLLL
Query -lPTISTIARAFPnVYVGA--pwWFND-------spfgmemHLKYLASVDLlynLAGMVT  397
ident                   |                        |                
Sbjct ytSRLFRLLKMSG-INFVAnplvNIHLqgrfdtypkrrgitRVKEMLESGI---NVCFGH  309
DSSP  hhHHHHHHHHHHL-LEEEElhhhHHHHllllllllllllllLHHHHHHLLL---LEEELL


DSSP  LLLL-----lLHHHhhHHHHHHHHHH--HHHHhhhlllllhHHHHHHHHHHHLHHHHHHH
Query DSRK-----lLSFGsrTEMFRRVLSN--VVGEmvekgqipiKEARELVKHVSYDGPKALF  450
ident |                                                           
Sbjct DDVFdpwyplGTAN--MLQVLHMGLHvcQLMG---------YGQINDGLNLITHHSARTL  358
DSSP  LLLLllllllLLLL--HHHHHHHHHHhlLLLL---------HHHHHHHHHHHLHHHHHHL


DSSP  L-----------------------------------------------------------
Query F-----------------------------------------------------------  451
ident                                                             
Sbjct Nlqdygiaagnsanliilpaengfdalrrqvpvrysvrggkviastqpaqttvyleqpea  418
DSSP  Lllllllllllllleeeellllhhhhhhhllllleeeelleeeeellllleeeellleee


DSSP  -----
Query -----  451
ident      
Sbjct idykr  423
DSSP  ellll


No 30: Query=1j5sA Sbjct=2gwgA Z-score=11.7

back to top
DSSP  llllllllllllhhhhhhhhhhlllLEEELLLLLLHH-----------------------
Query hmflgedylltnraavrlfnevkdlPIVDPHNHLDAK-----------------------   37
ident                           | | | |                           
Sbjct -------------------------XIIDIHGHYTTApkaledwrnrqiagikdpsvxpk   35
DSSP  -------------------------LLEEEEEELLLLlhhhhhhhhhhhhhhhlhhhlll


DSSP  --------hhHHLLllllhhhhhllllhhhhhhhhhllllhhhllllllhhhhhhhhhhh
Query --------diVENKpwndiwevegatdhyvwelmrrcgvseeyitgsrsnkekwlalakv   89
ident                                                             
Sbjct vselkisddeLQAS----------------------------------------------   49
DSSP  hhhllllhhhHHHH----------------------------------------------


DSSP  hhhhlllhhhhhhhhhhhhhllllllllhhhhhhhhhhhhhhlllLLHHHHHHHLLEEEE
Query fprfvgnptyewihldlwrrfnikkviseetaeeiweetkkklpeMTPQKLLRDMKVEIL  149
ident                                                  |          
Sbjct -------------------------------------------iiENQLKKXQERGSDLT   66
DSSP  -------------------------------------------hhLLHHHHHHHHLLLEE


DSSP  ELLL---------llLLLL-HHHHHHHHHLllLEEELLLLLhHHHLLllllhhhhhhhhh
Query CTTD---------dpVSTL-EHHRKAKEAVegVTILPTWRPdRAMNVdkegwreyvekmg  199
ident                     |                                       
Sbjct VFSPragdfnvsstwAAICnELCYRVSQLF-pDNFIGAAXL-PQSPG-------------  111
DSSP  EEELllllhhhhhhhHHHHhHHHHHHHHHL-lLLEEEEEEL-LLLLL-------------


DSSP  hhhllllllhhhHHHHHHHHHHHHH-LLLLLEEEEEEL--------lLLLLlllhhhhhh
Query erygedtstldgFLNALWKSHEHFK-EHGCVASDHALL--------ePSVYyvdenrara  250
ident                      |    | | ||               |            
Sbjct -----------vDPKTCIPELEKCVkEYGFVAINLNPDpsgghwtspPLTD---------  151
DSSP  -----------lLHHHHHHHHHHHHhLLLLLEEEELLLlllllllllLLLL---------


DSSP  hhhhhlllllllhhhhhhhhhHHHHHHHHHHHHHLLEEEEEeleellllhhhhhhlllll
Query vhekafsgekltqdeindykaFMMVQFGKMNQETNWVTQLHigalrdyrdslfktlgpds  310
ident                                 |       |                   
Sbjct ---------------------RIWYPIYEKXVELEIPAXIH-----------------vs  173
DSSP  ---------------------HHHHHHHHHHHHHLLLEEEL-----------------ll


DSSP  LLLE--elllllHHHH-hHHHHHHLLlLLLEEEE--ELLH-HHHH---------hhhHHH
Query GGDI--stnflrIAEG-lRYFLNEFDgKLKIVLY--VLDP-THLP---------tisTIA  355
ident  |                      |   || |          |                 
Sbjct TGAHylnadttaFXQCvaGDLFKDFP-ELKFVIPhgGGAVpYHWGrfrglaqexkkpLLE  232
DSSP  LLLHhhhhhhhhHHHHhhLLHHHHLL-LLLEEELhhHLLLhHHHHhhhhhhhhllllLHH


DSSP  HHL-LLEEeLLLLllLLLHHHHHHHHHHHhllllHHHLLLLLLLLLL---------llhh
Query RAF-PNVYvGAPWwfNDSPFGMEMHLKYLasvdlLYNLAGMVTDSRK---------llsf  405
ident      |              |                                       
Sbjct DHVlNNIF-FDTC--VYHQPGIDLLNTVI-----PVDNVLFASEXIGavrgidprtgfyy  284
DSSP  HHLlLLEE-EELL--LLLHHHHHHHHHHL-----LHHHEELLLLLLLlllleelllleel


DSSP  hHHHHHHHHhhHHHHhhhhhlllllhhhHHHHHHHHHLHHHHHHHL--------------
Query gSRTEMFRRvlSNVVgemvekgqipikeARELVKHVSYDGPKALFF--------------  451
ident            |                  |                             
Sbjct dDTKRYIEA--STIL-------------TPEEKQQIYEGNARRVYPrldaalkakgkleh  329
DSSP  lLLHHHHHH--LLLL-------------LHHHHHHHHLHHHHHHLHhhhhhhhhhhhhll


No 31: Query=1j5sA Sbjct=1j6pA Z-score=11.6

back to top
DSSP  --------------------------llllllllllllhhhhhhhhhhlLLLEEELLLLL
Query --------------------------hmflgedylltnraavrlfnevkDLPIVDPHNHL   34
ident                                                         | | 
Sbjct hhxiignclilkdfssepfwgaveiengtikrvlqgevkvdldlsgklvXPALFNTHTHA   60
DSSP  leeeeeeeeelllllllleeeeeeeelleeeeeeelllllleellleeeEELEEEEEELH


DSSP  LhhhhhhllllllhhhhhllLLHHHHHhhhhllllhhhllllllhhhhhhhhhhhhhhhl
Query DakdivenkpwndiwevegaTDHYVWElmrrcgvseeyitgsrsnkekwlalakvfprfv   94
ident                                                             
Sbjct P---------------xtllRGVAEDL---------------------------------   72
DSSP  H---------------hhhhLLLLLLL---------------------------------


DSSP  llhhhhhhhhhhhhhllllllllhhhhhhhhhhhhhhlllllhHHHHHHLLEEEEELLLL
Query gnptyewihldlwrrfnikkviseetaeeiweetkkklpemtpQKLLRDMKVEILCTTDD  154
ident                                            |                
Sbjct --------------sfeewlfskvlpiedrltekxayygtilaQXEXARHGIAGFVDXYF  118
DSSP  --------------lhhhhhhllhhhhhllllhhhhhhhhhhhHHHHHLLLEEEEEEEEL


DSSP  lllLLHHHHHHHHHLLlLEEELLLLLhhHHLLllllhhhhhhhhhhhhllllllhhhHHH
Query pvsTLEHHRKAKEAVEgVTILPTWRPdrAMNVdkegwreyvekmgerygedtstldgFLN  214
ident      |   ||         | |                                     
Sbjct ---HEEWIAKAVRDFG-XRALLTRGL--VDSN------------------------gDDG  148
DSSP  ---LHHHHHHHHHHHL-LEEEEEEEE--LLLL------------------------lLLL


DSSP  HHHHHHHHHHLLL-------LLEEE-EEELllllllllhhhhhhhhhhhlllllllhhhh
Query ALWKSHEHFKEHG-------CVASD-HALLepsvyyvdenraravhekafsgekltqdei  266
ident                      |    |                                 
Sbjct GRLEENLKLYNEWngfegriFVGFGpHSPY------------------------------  178
DSSP  LHHHHHHHHHHHHllhhhleEEEEEeLLLL------------------------------


DSSP  hhhHHHHHHHHHHHHHHHLLEEEEEELEellllhhhhhhlllllllleeLLLLLHhhHHH
Query ndyKAFMMVQFGKMNQETNWVTQLHIGAlrdyrdslfktlgpdsggdisTNFLRIaeGLR  326
ident                   |     |                        |        | 
Sbjct -lcSEEYLKRVFDTAKSLNAPVTIHLYE---------------------TSKEEY--DLE  214
DSSP  -llLHHHHHHHHHHHHHHLLLEEEEELL---------------------LLLLLL--LLH


DSSP  HHHHHLLLLLLEEE-EELLhhHHHHHHHHHHHlLLEEELLL--LLLLllhhhhhhHHHHH
Query YFLNEFDGKLKIVL-YVLDptHLPTISTIARAfPNVYVGAP--WWFNdspfgmemHLKYL  383
ident   ||      |                          |                      
Sbjct DILNIGLKEVKTIAaHCVH--LPERYFGVLKD-IPFFVSHNpaSNLK--lgngiaPVQRX  269
DSSP  HHHLLLLLLLLEEEeELLL--LLHHHHHHHLL-LLEEEEELhhHHHH--llllllLHHHH


DSSP  HLLLLhhhLLLLLLLLLL-lLHHHhhHHHHHHHHHHHHHHHHHlllllhhhHHHHHHHHH
Query ASVDLlynLAGMVTDSRK-lLSFGsrTEMFRRVLSNVVGEMVEkgqipikeARELVKHVS  442
ident              ||      |         |  |                         
Sbjct IEHGX---KVTLGTDGAAsnNSLN--LFFEXRLASLLQKAQNP-----rnlDVNTCLKXV  319
DSSP  HHLLL---EEEELLLLLLllLLLL--HHHHHHHHHHHHHLLLL-----lllLHHHHHHHH


DSSP  LHHHHHHHL---------------------------------------------------
Query YDGPKALFF---------------------------------------------------  451
ident                                                             
Sbjct TYDGAQAXGfksgkieegwnadlvvidldlpexfpvqniknhlvhafsgevfatxvagkw  379
DSSP  LHHHHHHHLllllllllllllleeeeelllhhhllhhhhhhhhhhllllllleeeellee


DSSP  ----------------------------
Query ----------------------------  451
ident                             
Sbjct iyfdgeyptidseevkrelariekelys  407
DSSP  eeellllllllhhhhhhhhhhhhhhhhl


No 32: Query=1j5sA Sbjct=4cqbA Z-score=11.4

back to top
DSSP  ----------------------------llllllllllllhhhhhhhhhhlLLLEEELLL
Query ----------------------------hmflgedylltnraavrlfnevkDLPIVDPHN   32
ident                                                        || | 
Sbjct skdfdliirnaylsekdsvydigivgdriikieakiegtvkdeidakgnlvSPGFVDAHT   60
DSSP  llleeeeeeeeeelllleeeeeeeelleeeeeelllllleeeeeellllleEELEEEEEE


DSSP  LLLhhhhhhllllllhhhHHLLllhhHHHHHHhllllhhhllllllhhhhhhhhhhhhhh
Query HLDakdivenkpwndiweVEGAtdhyVWELMRrcgvseeyitgsrsnkekwlalakvfpr   92
ident | |                                                         
Sbjct HMD------------ksfTSTGerlpKFWSRP----------------------------   80
DSSP  LHH------------hllLLLLllllLLLLLL----------------------------


DSSP  hlllhhhhhhhhhhhhhllllllllhhhhhhhhhhhhhhllllLHHHHHHHLLEEEEELL
Query fvgnptyewihldlwrrfnikkviseetaeeiweetkkklpemTPQKLLRDMKVEILCTT  152
ident                                                           | 
Sbjct ----------------ytrdaaiedglkyyknatheeikrhviEHAHMQVLHGTLYTRTH  124
DSSP  ----------------llhhhhhhhhhhhhhhllhhhhhhhhhHHHHHHHHLLEEEEEEE


DSSP  LLL----LLLL-HHHHHHHHHL-LLLEEELLLLLHHHHLLllllhhhhhhhhhhhhllll
Query DDP----VSTL-EHHRKAKEAV-EGVTILPTWRPDRAMNVdkegwreyvekmgerygedt  206
ident  |          |    |||       |           |                    
Sbjct VDVdsvaKTKAvEAVLEAKEELkDLIDIQVVAFAQSGFFV--------------------  164
DSSP  EELllllLLHHhHHHHHHHHHLlLLLEEEEEEELLLLLLL--------------------


DSSP  llhhhhhhhHHHHHHHHHLLLLLEEEEEElllllllllhhhhhhhhhhhlllllllhhhh
Query stldgflnaLWKSHEHFKEHGCVASDHALlepsvyyvdenraravhekafsgekltqdei  266
ident                     ||                                      
Sbjct ------dleSESLIRKSLDMGCDLVGGVD---------------------------patr  191
DSSP  ------lllHHHHHHHHHHHLLLEEELLL---------------------------llll


DSSP  hhhhhHHHHHHHHHHHHHLLEEEEEELEellllhhhhhhlllllllleelllLLHHHHHH
Query ndykaFMMVQFGKMNQETNWVTQLHIGAlrdyrdslfktlgpdsggdistnfLRIAEGLR  326
ident             |   |       ||                                  
Sbjct ennveGSLDLCFKLAKEYDVDIDYHIHD----------------------igTVGVYSIN  229
DSSP  lllhhHHHHHHHHHHHHLLLEEEEEELL----------------------lhHHHHHHHH


DSSP  HHHHHL-LLLL--LEEEE-ELLHHH-----hhhHHHHHHHLLlEEELLllllLLLHHHhh
Query YFLNEF-DGKL--KIVLY-VLDPTH-----lptISTIARAFPnVYVGApwwfNDSPFGme  377
ident                                                        |    
Sbjct RLAQKTiENGYkgRVTTShAWCFADapsewldeAIPLYKDSG-MKFVT-cfsSTPPTM--  285
DSSP  HHHHHHhHLLLllLEEEEeLLHHHHllhhhhhhHHHHHHHHL-LEEEE-ellLLLLLL--


DSSP  hHHHHHHLLLlhhHLLLLLLLLLL-----lLHHHhhHHHHHHHHHH--HHHHhhhlllll
Query mHLKYLASVDllyNLAGMVTDSRK-----lLSFGsrTEMFRRVLSN--VVGEmvekgqip  430
ident      |          |   |                                       
Sbjct -PVIKLLEAG---INLGCASDNIRdfwvpfGNGD--MVQGALIETQrlELKT--------  331
DSSP  -LHHHHHHLL---LEEEEELLLLLllllllLLLL--HHHHHHHHHHhhLLLL--------


DSSP  hHHHHHHHHHHHLHHHHHHHL---------------------------------------
Query iKEARELVKHVSYDGPKALFF---------------------------------------  451
ident       |                                                     
Sbjct -NRDLGLIWKMITSEGARVLGieknygievgkkadlvvlnslspqwaiidqakrlcvikn  390
DSSP  -HHHHHHHHHHHLHHHHHHHLlhhhlllllllllleeeellllhhhhhhhllleeeeeel


DSSP  ------------
Query ------------  451
ident             
Sbjct griivkdeviva  402
DSSP  leeeeelleell


No 33: Query=1j5sA Sbjct=3ls9A Z-score=11.4

back to top
DSSP  --------------------------------llllllllllllhhhhhhhhhhlLLLEE
Query --------------------------------hmflgedylltnraavrlfnevkDLPIV   28
ident                                                             
Sbjct milirgltrvitfddqereledadilidgpkivavgkdlsdrsvsrtidgrgmiaLPGLI   60
DSSP  leeeeeeeeeellllllleeeeeeeeeelleeeeeellllllllleeeellleeeEELEE


DSSP  ELLLLLLhhhhhhllllllhhhhhlLLLH-hHHHHhhhllllhhhllllllhhhhhhhhh
Query DPHNHLDakdivenkpwndiwevegATDH-yVWELmrrcgvseeyitgsrsnkekwlala   87
ident   | ||                                                      
Sbjct NSHQHLY---------------egaMRAIpqLERV-------------------------   80
DSSP  EEEELHH---------------hhhHLLLhhHLLL-------------------------


DSSP  hhhhhhlllhhhhhhhhhhhhhllllllllhhhhhhhhhhhhhhlllllhHHHHHHLLEE
Query kvfprfvgnptyewihldlwrrfnikkviseetaeeiweetkkklpemtpQKLLRDMKVE  147
ident                                                             
Sbjct ----------------tmaswlegvltrsagwwrdgkfgpdvirevaravLLESLLGGIT  124
DSSP  ----------------lhhhhhhhhhhhhhhhhhlllllhhhhhhhhhhhHHHHHHLLEE


DSSP  EEELLLL-----lLLLL-HHHHHHHHHLLlLEEELLLLLHhhHLLL------LLLHhhhh
Query ILCTTDD-----pVSTL-EHHRKAKEAVEgVTILPTWRPDraMNVD------KEGWreyv  195
ident                        |                                    
Sbjct TVADQHLffpgatADSYiDATIEAATDLG-IRFHAARSSM--TLGKseggfcDDLF----  177
DSSP  EEEEEELllllllLLLHhHHHHHHHHHHL-LEEEEEELLL--LLLHhhllllLHHH----


DSSP  hhhhhhhllllllhhhHHHHHHHHHHHH-HLLL--------LLEEE-EEELllllllllh
Query ekmgerygedtstldgFLNALWKSHEHF-KEHG--------CVASD-HALLepsvyyvde  245
ident                                            |                
Sbjct --------------vePVDRVVQHCLGLiDQYHepepfgmvRIALGpCGVP---------  214
DSSP  --------------llLHHHHHHHHHHHhHHHLllllllleEEEELlLLLL---------


DSSP  hhhhhhhhhhlllllllhhhhhhhHHHHHHHHHHHHHHHLLEEEEEELEellllhhhhhh
Query nraravhekafsgekltqdeindyKAFMMVQFGKMNQETNWVTQLHIGAlrdyrdslfkt  305
ident                         |      |  |          |              
Sbjct ----------------------ydKPELFEAFAQMAADYDVRLHTHFYE-----------  241
DSSP  ----------------------llLHHHHHHHHHHHHHHLLEEEEEELL-----------


DSSP  llllllllEELLL-------LLHHHHHHHHHhhlllllLEEEE-ELLHhHHHHhHHHHHH
Query lgpdsggdISTNF-------LRIAEGLRYFLnefdgklKIVLY-VLDPtHLPTiSTIARA  357
ident                           |              |     |            
Sbjct --------PLDAGmsdhlygMTPWRFLEKHG---wasdRVWLAhAVVP-PREE-IPEFAD  288
DSSP  --------LLHHHhhhhhhlLLHHHHHHHLL---llllLEEEEeLLLL-LHHH-HHHHHH


DSSP  LLlEEELLLllLLLL--HHHHhhHHHHHHLLLlhhHLLLLLLLL----LLLLhHHHHHHH
Query FPnVYVGAPwwFNDS--PFGMemHLKYLASVDllyNLAGMVTDS----RKLLsFGSRTEM  411
ident    |                                  |  |                  
Sbjct AG-VAIAHLiaPDLRmgWGLA--PIREYLDAG---ITVGFGTTGsasnDGGN-LLGDLRL  341
DSSP  HL-LEEEELhhHHHHllLLLL--LHHHHHHLL---LEEEELLLLllllLLLL-HHHHHHH


DSSP  HHHHHH--hhhHHHHhlllllhhhHHHHHHHHHLHHHHHHHL------------------
Query FRRVLS--nvvGEMVekgqipikeARELVKHVSYDGPKALFF------------------  451
ident                                    |                        
Sbjct AALAHRpadpnEPEK-------wlSARELLRMATRGSAECLGrpdlgvleegraadiacw  394
DSSP  HHHHLHhhlllLHHH-------llLHHHHHHHLLHHHHHHLLlllllllllllllleeee


DSSP  -----------------------------------------------------------
Query -----------------------------------------------------------  451
ident                                                            
Sbjct rldgvdrvgvhdpaiglimtglsdraslvvvngqvlvenerpvladlerivanttalip  453
DSSP  elllhhhlllllhhhhhhhlllllllleeeelleeeeelleellllhhhhhhhhhhhll


No 34: Query=1j5sA Sbjct=1yrrB Z-score=11.2

back to top
DSSP  ---------------------------llllllllllllhhhhhhhhhhlLLLEEELLLL
Query ---------------------------hmflgedylltnraavrlfnevkDLPIVDPHNH   33
ident                                                        |    
Sbjct yaltqgriftgheflddhavviadgliksvcpvaelppeieqrslngailSPGFIDVQLN   60
DSSP  leeelleeelllleelleeeeeelleeeeeeehhhlllllleeelllleeEELEEEEEEL


DSSP  L------------LHHHHhhllllllhhhhhllllhhhhhhhhhllllhhhllllllhhh
Query L------------DAKDIvenkpwndiwevegatdhyvwelmrrcgvseeyitgsrsnke   81
ident                                                             
Sbjct GcggvqfndtaeaVSVET------------------------------------------   78
DSSP  EelleelllllllLLHHH------------------------------------------


DSSP  hhhhhhhhhhhhlllhhhhhhhhhhhhhllllllllhhhhhhhhhhhhhhlllllhHHHH
Query kwlalakvfprfvgnptyewihldlwrrfnikkviseetaeeiweetkkklpemtpQKLL  141
ident                                                             
Sbjct -------------------------------------------------------lEIMQ   83
DSSP  -------------------------------------------------------hHHHH


DSSP  HHLL---EEEEELLLLL-----LLLL-HHHHHHHHHLLLLEEELLLLLHhhhllllllhh
Query RDMK---VEILCTTDDP-----VSTL-EHHRKAKEAVEGVTILPTWRPDramnvdkegwr  192
ident              |                |                             
Sbjct KANEksgCTNYLPTLITtsdelMKQGvRVMREYLAKHPNQALGLHLEGP-----------  132
DSSP  HHHHlllEEEEEEEELLllhhhHHHHhHHHHHHHHHLLLLLLLEEEELL-----------


DSSP  hhhhhhhhhhllllllhhhhhHHHHHHHHHHHLlLLLEEEEEelllllllllhhhhhhhh
Query eyvekmgerygedtstldgflNALWKSHEHFKEhGCVASDHAllepsvyyvdenraravh  252
ident                       ||                 |                  
Sbjct ------------------wlnAALVDFLCENAD-VITKVTLA------------------  155
DSSP  ------------------lllLHHHHHHHHLHH-HEEEEEEL------------------


DSSP  hhhlllllllhhhhhhhhHHHHHHHHHHHHHHLLEEEEEELEellllhhhhhhlllllll
Query ekafsgekltqdeindykAFMMVQFGKMNQETNWVTQLHIGAlrdyrdslfktlgpdsgg  312
ident                                   |                         
Sbjct -----------------pEMVPAEVISKLANAGIVVSAGHSN------------------  180
DSSP  -----------------hHHLLHHHHHHHHHHLLEEEELLLL------------------


DSSP  leelllllHHHHHHHHHHHllllLLEEEE----ELLHH------hHHHHHHHHhhllLEE
Query distnflrIAEGLRYFLNEfdgkLKIVLY----VLDPT------hLPTISTIArafpNVY  362
ident                                                 |   |      |
Sbjct -------aTLKEAKAGFRA----GITFAThlynAMPYItgrepglAGAILDEA----DIY  225
DSSP  -------lLHHHHHHHHHH----LEEEELllllLLLLLlllllhhHHHHHHLL----LLE


DSSP  ELLLllllLLHH-HHHHHHHHHHLlLLHHHLlLLLLLLLlllhhhHHHHHHHHHHHHHHH
Query VGAPwwfnDSPF-GMEMHLKYLASvDLLYNLaGMVTDSRkllsfgSRTEMFRRVLSNVVG  421
ident  |                            |   |||               | |    |
Sbjct CGII----ADGLhVDYANIRNAKR-LKGDKL-CLVTDAT--sgssLTMIEGVRNLVEHCG  277
DSSP  EEEE----LLLLlLLHHHHHHHHH-HHHHHE-EEELLLL--llllLLHHHHHHHHHHHHL


DSSP  hhhhlllllhhhHHHHHHHHHLHHHHHHHL------------------------------
Query emvekgqipikeARELVKHVSYDGPKALFF------------------------------  451
ident             |   |       |                                   
Sbjct -----------iALDEVLRMATLYPARAIGvekrlgtlaagkvanltaftpdfkitktiv  326
DSSP  -----------lLHHHHHHHHLHHHHHHLLllllllllllllllleeeellllleeeeee


DSSP  --------
Query --------  451
ident         
Sbjct ngnevvtq  334
DSSP  lleeeeel


No 35: Query=1j5sA Sbjct=2ogjA Z-score=11.2

back to top
DSSP  llllllllllllhhhhhhhHHHL-------------------------------------
Query hmflgedylltnraavrlfNEVK-------------------------------------   23
ident                                                             
Sbjct ---------qapilltnvkPVGFgkgasqsstdiliggdgkiaavgsalqapadtqrida   51
DSSP  ---------llleeeeeeeELLLlllllllleeeeellllleeeeelllllllleeelll


DSSP  ---LLLEEELLLLLLHHhhhhllllllhhhhhllllhhhhhhhhhllllhhhllllllhh
Query ---DLPIVDPHNHLDAKdivenkpwndiwevegatdhyvwelmrrcgvseeyitgsrsnk   80
ident        || | |                                               
Sbjct afiSPGWVDLHVHIWHG-------------------------------------------   68
DSSP  leeEELEEEEEELLLLL-------------------------------------------


DSSP  hhhhhhhhhhhhhlllhhhhhhhhhhhhhllllllllhhhhhhhhhhhhhhlllllhHHH
Query ekwlalakvfprfvgnptyewihldlwrrfnikkviseetaeeiweetkkklpemtpQKL  140
ident                                                             
Sbjct -------------------------------------------------gtdisirpSEC   79
DSSP  -------------------------------------------------lllllllhHHL


DSSP  HHHLLEEEEEL--LLLLLLLLHHHHHHHHHLLlLEEELLLLLH----------HHHLLLL
Query LRDMKVEILCT--TDDPVSTLEHHRKAKEAVEgVTILPTWRPD----------RAMNVDK  188
ident      |  |                   |      |                       |
Sbjct GAERGVTTLVDagSAGEANFHGFREYIIEPSR-ERIKAFLNLGsiglvacnrvPELRDIK  138
DSSP  LHHHLEEEEEEelLLLLLLHHHHHHHLLLLLL-LEEEEEEELLllllllllllLLLLLHH


DSSP  llhhhhhhhhhhhhllllllhhhHHHHHHHHHHHHHlLLLLEEEEEELLlllllllhhhh
Query egwreyvekmgerygedtstldgFLNALWKSHEHFKeHGCVASDHALLEpsvyyvdenra  248
ident                         |               |                   
Sbjct ---------------------diDLDRILECYAENS-EHIVGLXVRASH-----------  165
DSSP  ---------------------hlLHHHHHHHHHLLL-LLEEEEEEEELH-----------


DSSP  hhhhhhhlllllllhhhhHHHHHHHHHHHHHHHHHHLLEEEEEELEellllhhhhhhlll
Query ravhekafsgekltqdeiNDYKAFMMVQFGKMNQETNWVTQLHIGAlrdyrdslfktlgp  308
ident                               |           | |               
Sbjct ---------------vitGSWGVTPVKLGKKIAKILKVPXXVHVGE--------------  196
DSSP  ---------------hhhLLLLLHHHHHHHHHHHHHLLLEEEEELL--------------


DSSP  llllleelllLLHHhHHHHHHhhlllLLLEEEEE--LLHH-HHHH----HHHHHHHLLLE
Query dsggdistnfLRIAeGLRYFLnefdgKLKIVLYV--LDPT-HLPT----ISTIARAFPNV  361
ident                     |         |                      |      
Sbjct --------ppALYD-EVLEIL-----GPGDVVTHcfNGKSgSSIXededLFNLAERCEGI  242
DSSP  --------llLLHH-HHHHHL-----LLLLEEELllLLLLlLLLLllhhHHHHHHHLLLL


DSSP  EELLlLLLLLlhhHHHHHHHHHHLLLLHhhLLLLLLLLLL--llhhhHHHHHHHHHHHHH
Query YVGApWWFNDspfGMEMHLKYLASVDLLynLAGMVTDSRK--llsfgSRTEMFRRVLSNV  419
ident                           ||       ||                   |  |
Sbjct RLDIgHGGAS---FSFKVAEAAIARGLL--PFSISTDLHGhsxnfpvWDLATTXSKLLSV  297
DSSP  EEELlLLLLL---LLHHHHHHHHHLLLL--LLLLLLLLLLlllllllLLHHHHHHHHHHL


DSSP  HhhhhhlllllhhhHHHHHHHHHLHHHHHHHL----------------------------
Query VgemvekgqipikeARELVKHVSYDGPKALFF----------------------------  451
ident                 | |       |                                 
Sbjct D------------xPFENVVEAVTRNPASVIRldxenrldvgqradftvfdlvdadleat  345
DSSP  L------------lLHHHHHHLLLHHHHHHLLllllllllllllleeeeeeeeeeeeeee


DSSP  ----------------------------------
Query ----------------------------------  451
ident                                   
Sbjct dsngdvsrlkrlfepryavigaeaiaasryipra  379
DSSP  llllleeeeeeeeeeeeeeelleeeellllllll


No 36: Query=1j5sA Sbjct=2imrA Z-score=11.0

back to top
DSSP  llllllllllllhhhhhhHHHH--------------------------------------
Query hmflgedylltnraavrlFNEV--------------------------------------   22
ident                                                             
Sbjct ----------htprlltcDVLYtgaqspggvvvvgetvaaaghpdelrrqyphaaeerag   50
DSSP  ----------lleeeeeeLEEElleelleeeeeelleeeeeelhhhhhhhlllleeeell


DSSP  --LLLLEEELLLLLL------------------------------HHHHhhllllllhhh
Query --KDLPIVDPHNHLD------------------------------AKDIvenkpwndiwe   50
ident      | |  | |||                              |              
Sbjct avIAPPPVNAHTHLDmsayefqalpyfqwipevvirgrhlrgvaaAQAG-----------   99
DSSP  leELLLLLEEEEELLllhhhhhhlhhhhllhhhhhhhllllhhhhHHHH-----------


DSSP  hhllllhhhhhhhhhllllhhhllllllhhhhhhhhhhhhhhhlllhhhhhhhhhhhhhl
Query vegatdhyvwelmrrcgvseeyitgsrsnkekwlalakvfprfvgnptyewihldlwrrf  110
ident                                                             
Sbjct ------------------------------------------------------------   99
DSSP  ------------------------------------------------------------


DSSP  lllllllhhhhhhhhhhhhhhlllllhhhHHHHLLEEEEELLLLlLLLL-HHHHHHHhhl
Query nikkviseetaeeiweetkkklpemtpqkLLRDMKVEILCTTDDpVSTL-EHHRKAKeav  169
ident                               |                             
Sbjct ---------------------------adTLTRLGAGGVGDIVW-APEVmDALLARE---  128
DSSP  ---------------------------hhHHHHLLLLLEEEEEL-LHHHhHHHHLLL---


DSSP  lLLEEELLLLLHhhHLLLlllhhhhhhhhhhhhllllllhHHHHHHHHHHHHHHHLLL--
Query eGVTILPTWRPDraMNVDkegwreyvekmgerygedtstlDGFLNALWKSHEHFKEHG--  227
ident                                         |    |     |        
Sbjct -DLSGTLYFEVL--NPFP-------------------dkaDEVFAAARTHLERWRRLErp  166
DSSP  -LLLEEEEEEEL--LLLH-------------------hhhHHHHHHHHHHHHHHHLLLll


DSSP  --LLEEE-EEELllllllllhhhhhhhhhhhlllllllhhhhhhhHHHHHHHHHHHHHHH
Query --CVASD-HALLepsvyyvdenraravhekafsgekltqdeindyKAFMMVQFGKMNQET  284
ident         |                                        |          
Sbjct glRLGLSpHTPF-------------------------------tvSHRLMRLLSDYAAGE  195
DSSP  leEEEEEeLLLL-------------------------------llLHHHHHHHHHHHHHH


DSSP  LLEEEEEELEEllllhhhhhhllllllllEELLLL-------------------------
Query NWVTQLHIGALrdyrdslfktlgpdsggdISTNFL-------------------------  319
ident     | |                                                     
Sbjct GLPLQIHVAEH-----------------pTELEMFrtgggplwdnrmpalyphtlaevig  238
DSSP  LLLLEEEELLL-----------------hHHHHHHhhlllllhhhllhhhllllhhhhhl


DSSP  -------lHHHHH-HHHHhhlllLLLEEE-EELLhhHHHHHHHHHHHLLlEEELL-----
Query -------rIAEGL-RYFLnefdgKLKIVL-YVLDptHLPTISTIARAFPnVYVGA-----  365
ident             |               |         |             |       
Sbjct repgpdltPVRYLdELGV----lAARPTLvHMVN--VTPDDIARVARAG-CAVVTcprsn  291
DSSP  llllllllHHHHHhHHLL----hHHLLEEeELLL--LLHHHHHHHHHHL-LLEEElhhhh


DSSP  -llLLLLlhhhhhhHHHHHHLLLLhhhLLLLLLLLLL-lLHHHhhHHHHHHHHHHHHHHh
Query -pwWFNDspfgmemHLKYLASVDLlynLAGMVTDSRK-lLSFGsrTEMFRRVLSNVVGEm  423
ident                    |            |||                         
Sbjct hhlECGT------fDWPAFAAAGV---EVALGTDSVAsgETLN--VREEVTFARQLYPG-  339
DSSP  hhlLLLL------lLHHHHHHLLL---LEEELLLLHHhhLLLL--LHHHHHHHHHHLLL-


DSSP  hhlllllhhhHHHHHHHHHLHHHHHHHL----------------------
Query vekgqipikeARELVKHVSYDGPKALFF----------------------  451
ident                      |                            
Sbjct ---------lDPRVLVRAAVKGGQRVVGtpflrrgetwqegfrwelsrdl  380
DSSP  ---------lLHHHHHHHHHHHHHHHHLlllllllllllhhhlhhhllll


No 37: Query=1j5sA Sbjct=1a4mA Z-score=10.8

back to top
DSSP  llllllllllllhhhhhhhhhHLLLLEEELLLLLLhhhhhhlLLLL--------------
Query hmflgedylltnraavrlfneVKDLPIVDPHNHLDakdivenKPWN--------------   46
ident                          | |  | |||                         
Sbjct -------------------tpAFNKPKVELHVHLD--gaikpETILyfgkkrgialpadt   39
DSSP  -------------------llLLLLLEEEEEEEHH--hlllhHHHHhhhhhhllllllll


DSSP  LHHHhHLLLLHHhhhhhhhllllhhhllllllhhhhhhhhhhhhhhhllLHHHhhhhhhh
Query DIWEvEGATDHYvwelmrrcgvseeyitgsrsnkekwlalakvfprfvgNPTYewihldl  106
ident                                                   |         
Sbjct VEEL-RNIIGMD-------------------------------------KPLS-------   54
DSSP  HHHH-HHHHLLL-------------------------------------LLLL-------


DSSP  hhhllllllllhhhhhhhhhhhhhhlllllhhHHHHHLLEEEEELLLLLL----------
Query wrrfnikkviseetaeeiweetkkklpemtpqKLLRDMKVEILCTTDDPV----------  156
ident                                        |        |           
Sbjct --lpgflakfdyympviagcreaikriayefvEMKAKEGVVYVEVRYSPHllanskvdpm  112
DSSP  --hhhhhllhhhhhhhhlllhhhhhhhhhhhhHHHHHLLEEEEEEEELLHhhllllllll


DSSP  -------------LLLHHHHHHHH--HLLLLEEELLLLLH-HHHLlllllhhhhhhhhhh
Query -------------STLEHHRKAKE--AVEGVTILPTWRPD-RAMNvdkegwreyvekmge  200
ident                        |     |                              
Sbjct pwnqtegdvtpddVVDLVNQGLQEgeQAFGIKVRSILCCMrHQPS---------------  157
DSSP  hhhlllllllhhhHHHHHHHHHHHhhHHHLLEEEEEEEEElLLHH---------------


DSSP  hhllllllhhhhhhHHHHHHHHHHLLLLLEEEEE--ELLLLlllllhhhhhhhhhhhlll
Query rygedtstldgflnALWKSHEHFKEHGCVASDHA--LLEPSvyyvdenraravhekafsg  258
ident                             || | |                          
Sbjct -----------wslEVLELCKKYNQKTVVAMDLAgdETIEG-------------------  187
DSSP  -----------hhhHHHHHHHHLLLLLEEEEEEEllLLLLL-------------------


DSSP  llllhhhhhhhhHHHHHHHHHHHH-HHLLeEEEEEleellllhhhhhhlllllllleell
Query ekltqdeindykAFMMVQFGKMNQ-ETNWvTQLHIgalrdyrdslfktlgpdsggdistn  317
ident                 |                |                          
Sbjct ---------sslFPGHVEAYEGAVkNGIH-RTVHA------------------------g  213
DSSP  ---------hhhLHHHHHHHHHHHhHLLE-EEEEE------------------------l


DSSP  lllHHHHHHHHHHHLlllLLEEEEEllhhHHHHhhHHHHHL--LLEEELLLLlLLLL---
Query flrIAEGLRYFLNEFdgkLKIVLYVldptHLPTisTIARAF--PNVYVGAPWwFNDS---  372
ident      |  |                    |              |               
Sbjct evgSPEVVREAVDIL---KTERVGH--gyHTIEdeALYNRLlkENMHFEVCP-WSSYltg  267
DSSP  lllLHHHHHHHHHLL---LLLEEEE--lhHHHHlhHHHHHHhhLLLEEEELH-HHHHhll


DSSP  --hhhhHHHHHHHHLllLHHHLlLLLLLLLLllhhhHHHHHHHHHHH-HHHHhhhhllll
Query --pfgmEMHLKYLASvdLLYNLaGMVTDSRKllsfgSRTEMFRRVLS-NVVGemvekgqi  429
ident                     |     ||        |                       
Sbjct awdpktTHAVVRFKN--DKANY-SLNTDDPL--ifkSTLDTDYQMTKkDMGF--------  314
DSSP  llllllLLHHHHHHH--LLLLE-EELLLLLL--lllLLHHHHHHHHHhLLLL--------


DSSP  lhhhHHHHHHHHhLHHHHHHHL------------------
Query pikeARELVKHVsYDGPKALFF------------------  451
ident       |  |           |                  
Sbjct ----TEEEFKRL-NINAAKSSFlpeeekkellerlyreyq  349
DSSP  ----LHHHHHHH-HHHHHHLLLllhhhhhhhhhhhhhhll


No 38: Query=1j5sA Sbjct=3mkvA Z-score=10.6

back to top
DSSP  --llllllllllllhHHHH------------------------------hhhhhlLLLEE
Query --hmflgedylltnrAAVR------------------------------lfnevkDLPIV   28
ident                                                             
Sbjct lttflfrngalldpdHPDLlqgfeiliedgfirevsdkpikssnahvidvkgktiMPGLI   60
DSSP  lleeeeeeeeellllLLLLeeeeeeeeelleeeeeellllllllleeeelllleeEELEE


DSSP  ELLLLLLhhhhhhllllllhhhhhllLLHHhhhhhhhllllhhhllllllhhhhhhhhhh
Query DPHNHLDakdivenkpwndiwevegaTDHYvwelmrrcgvseeyitgsrsnkekwlalak   88
ident | | |                                                       
Sbjct DLHVHVV-----------------aiEFNL------------------------------   73
DSSP  EEEELLL-----------------llLLLH------------------------------


DSSP  hhhhhlllhhhhhhhhhhhhhllllllllhhhhhhhhhhhhhhllllLHHHHHHHLLEEE
Query vfprfvgnptyewihldlwrrfnikkviseetaeeiweetkkklpemTPQKLLRDMKVEI  148
ident                                                             
Sbjct -------------------------------prvatlpnvlvtlravPIMRAMLRRGFTT  102
DSSP  -------------------------------hhhllllhhhhhhhhhHHHHHHHHLLEEE


DSSP  EELLLlllllLHHHHHHHHH-LLLLEEELL-LLLHhhHLLL----------LLLHhhHHH
Query LCTTDdpvstLEHHRKAKEA-VEGVTILPT-WRPDraMNVD----------KEGWreYVE  196
ident                      |||                                    
Sbjct VRDAG--gagYPFKQAVESGlVEGPRLFVSgRALS--QTGGhadprarsdyMPPD--SPC  156
DSSP  EEELL--lllHHHHHHHHLLlLLLLEEEELlLEEE--LLLLllllllllllLLLL--LLL


DSSP  HHhhhhllllllhhhHHHHHHHHHHHHHLLLLLEEEEEELLlllllllhhhhhhhhhhhl
Query KMgerygedtstldgFLNALWKSHEHFKEHGCVASDHALLEpsvyyvdenraravhekaf  256
ident                               |                             
Sbjct GC-cvrvgalgrvadGVDEVRRAVREELQMGADQIXIMASG------------------g  197
DSSP  LL-llllllleeellLHHHHHHHHHHHHHHLLLLEEEELLL------------------l


DSSP  llllllhhhhhhhHHHHHHHHHHHHHHHLLEEEEEELeellllhhhhhhlllllllleel
Query sgekltqdeindyKAFMMVQFGKMNQETNWVTQLHIGalrdyrdslfktlgpdsggdist  316
ident                          |        |                         
Sbjct vasptdpvgvfgySEDEIRAIVAEAQGRGTYVLAHAY-----------------------  234
DSSP  lllllllllllllLHHHHHHHHHHHHLLLLLEEEEEL-----------------------


DSSP  llllHHHHHHHHHHHLllllLEEE-EELLhhHHHHHHHHHHHLLlEEELLLL--------
Query nflrIAEGLRYFLNEFdgklKIVL-YVLDptHLPTISTIARAFPnVYVGAPW--------  367
ident                                               ||            
Sbjct ----TPAAIARAVRCG----VRTIeHGNL--IDDETARLVAEHG-AYVVPTLvtydalas  283
DSSP  ----LHHHHHHHHHLL----LLEEeELLL--LLHHHHHHHHHHL-LEEELLHhhhhhhhh


DSSP  ---------------lLLLLhhHHHHHHHHHHLLLLhhHLLLlLLLLL--LLLHHHhHHH
Query ---------------wFNDSpfGMEMHLKYLASVDLlyNLAGmVTDSR--KLLSFGsRTE  410
ident                                             ||              
Sbjct egekyglppesiakiaDVHG--AGLHSIEIMKRAGV--KMGF-GTDLLgeAQRLQS-DEF  337
DSSP  hlllllllhhhhllhhHHHL--LHHHHHHHHHHHLL--LLLL-LLLLLhhHHHHLL-HHH


DSSP  HHHHHHHhhhhhhhhlllllhhhHHHHHHHHHLHHHHHHHL-------------------
Query MFRRVLSnvvgemvekgqipikeARELVKHVSYDGPKALFF-------------------  451
ident                            |                                
Sbjct RILAEVL----------------SPAEVIASATIVSAEVLGmqdklgrivpgahadvlvv  381
DSSP  HHHHLLL----------------LHHHHHHHLLHHHHHHLLllllllllllllllleeee


DSSP  ---------------------------------
Query ---------------------------------  451
ident                                  
Sbjct dgnplksvdcllgqgehiplvmkdgrlfvnele  414
DSSP  llllllllllllllllllleeeelleeeeelll


No 39: Query=1j5sA Sbjct=4dziC Z-score=10.5

back to top
DSSP  llllllllllllhhhhhhhhhHLLLLEEELLLLLLHH-----------------------
Query hmflgedylltnraavrlfneVKDLPIVDPHNHLDAK-----------------------   37
ident                             |  ||                           
Sbjct ---------------------ALNYRVIDVDNHYYEPldsftrhldkkfkrrgvqmlsdg   39
DSSP  ---------------------LLLLLEEEEEEELLLLlllllllllhhhlllleeeeell


DSSP  ------hhhhllllllhhhhhLLLLhhhhhhhhhllllhhhllllllhhhhhhhhhhhhh
Query ------divenkpwndiweveGATDhyvwelmrrcgvseeyitgsrsnkekwlalakvfp   91
ident                                                             
Sbjct krtwavigdrvnhfipnptfdPIIV-----------------------------------   64
DSSP  lleeeeelleellllllllllLEEL-----------------------------------


DSSP  hhllLHHHhhhhhhhhhhllllLLLL--hhhhhhhhhhhhhhllllLHHHHHHHLLEEEE
Query rfvgNPTYewihldlwrrfnikKVIS--eetaeeiweetkkklpemTPQKLLRDMKVEIL  149
ident                                                          |  
Sbjct -pgcLDLL--------frgeipDGVDpaslmkverladhpeyqnrdARIAVMDEQDIETA  115
DSSP  -lllLHHH--------hhllllLLLLhhhllleelhhhlhhhllhhHHHHHHHHHLEEEE


DSSP  ELL--------------------lLLLLL---LHHHHhhhhhllLLEEELLLLLHhhhll
Query CTT--------------------dDPVST---LEHHRkakeaveGVTILPTWRPDramnv  186
ident                                  |             |            
Sbjct FMLptfgcgveealkhdieatmasVHAFNlwlDEDWG---fdrpDHRIIAAPIVS-----  167
DSSP  EEEllhhhhhhhhllllhhhhhhhHHHHHhhhHHHLL---llllLLLEEELLLLL-----


DSSP  llllhhhhhhhhhhhhllllllhhhHHHHHHHHHHHHHLLLLLEEEEEELLlllllllhh
Query dkegwreyvekmgerygedtstldgFLNALWKSHEHFKEHGCVASDHALLEpsvyyvden  246
ident                                         |                   
Sbjct -----------------------laDPTRAVEEVDFVLARGAKLVLVRPAP---------  195
DSSP  -----------------------llLHHHHHHHHHHHHHLLLLLEELLLLL---------


DSSP  hhhhhhhhhlllllllHHHHHhhhHHHHHHHHHHHHHHLLEEEEEELE-ELLL--LHHHh
Query raravhekafsgekltQDEINdykAFMMVQFGKMNQETNWVTQLHIGA-LRDY--RDSLf  303
ident                                     |       |               
Sbjct -------------vpgLVKPRslgDRSHDPVWARLAEAGVPVGFHLSDsGYLHiaAAWG-  241
DSSP  -------------lllLLLLLlllLHHHHHHHHHHHHHLLLEEEELLLlLLHHhhHHLL-


DSSP  hhllllllllEELL-lLLHHHHHHHHH-HHLL---LLLLEEEEellhhhHHHHHHH----
Query ktlgpdsggdISTN-fLRIAEGLRYFL-NEFD---GKLKIVLYvldpthLPTISTI----  354
ident                   |                 ||| |                   
Sbjct ---gakdpldQVLLddRAIHDTMASMIvHGVFtrhPKLKAVSI---engSYFVHRLikrl  295
DSSP  ---llllhhhHHHHllHHHHHHHHHHHhLLHHhhlLLLLEEEE---lllLLHHHHHhhhh


DSSP  --------------hHHLL--LEEELLLllllllhhhHHHHHHHHHLLLLHHHLlLLLLL
Query --------------aRAFP--NVYVGAPwwfndspfgMEMHLKYLASVDLLYNLaGMVTD  398
ident                      ||               |  |  || |           |
Sbjct kkaantqpqyfpedpVEQLrnNVWIAPY---------YEDDLPELARVIGVDKI-LFGSD  345
DSSP  hhhhhhlhhhllllhHHHHhhHEEELLL---------LLLLHHHHHHHHLHHHL-LLLLL


DSSP  LLLllhhhHHHHhHHHHhHHHHhhhhhlllllhhhHHHHHHHHHLHHHHHHHL-----
Query SRKllsfgSRTEmFRRVlSNVVgemvekgqipikeARELVKHVSYDGPKALFF-----  451
ident         |    |                               |    |       
Sbjct WPHgeglaSPVS-FTAE-LKGF-------------SESDIRKIMRDNALDLLGvqvgs  388
DSSP  LLLlllllLHHH-HHHH-HLLL-------------LHHHHHHHHLHHHHHHHLlllll


No 40: Query=1j5sA Sbjct=1a5kC Z-score=10.4

back to top
DSSP  ----------------llllLLLLlLLLH-------------------------------
Query ----------------hmflGEDYlLTNR-------------------------------   13
ident                                                             
Sbjct snisrqayadmfgptvgdkvRLAD-TELWieveddlttygeevkfgggkvirdgmgqgqm   59
DSSP  leeehhhhhhhhlllllleeELLL-LLLEeelleelllllllllllllllllllllllll


DSSP  --------------------------------------------------------hhhh
Query --------------------------------------------------------aavr   17
ident                                                             
Sbjct laadcvdlvltnalivdhwgivkadigvkdgrifaigkagnpdiqpnvtipigaatevia  119
DSSP  lhhhllleeeeeeeeeelleeeeeeeeeelleeeeeeleellllllllleellllleeee


DSSP  hhhhhlLLLEEELLLLLLHHHhhhllllllhhhhhllllhhhhhhhhhllllhhhlllll
Query lfnevkDLPIVDPHNHLDAKDivenkpwndiwevegatdhyvwelmrrcgvseeyitgsr   77
ident            | | |                                            
Sbjct aegkivTAGGIDTHIHWICPQ---------------------------------------  140
DSSP  lllleeEELEEEEEEELLLLL---------------------------------------


DSSP  lhhhhhhhhhhhhhhhlllhhhhhhhhhhhhhllllllllhhhhhhhhhhhhhhlllllH
Query snkekwlalakvfprfvgnptyewihldlwrrfnikkviseetaeeiweetkkklpemtP  137
ident                                                             
Sbjct -----------------------------------------------------------Q  141
DSSP  -----------------------------------------------------------H


DSSP  HHHHHHLLEEEEELL-------------LLLLLL-LHHHHHhHHHLlLLEEELLLLLHhh
Query QKLLRDMKVEILCTT-------------DDPVST-LEHHRKaKEAVeGVTILPTWRPDra  183
ident         |                                       | |         
Sbjct AEEALVSGVTTMVGGgtgpaagthattcTPGPWYiSRMLQA-ADSL-PVNIGLLGKGN--  197
DSSP  HHHHHHHLEEEEEEElllllhhhhhlllLLHHHHhHHHHHH-HLLL-LLEEEEEEELL--


DSSP  hllllllhhhhhhhhhhhhllllllhhhHHHHHHHHHHHHhlllLLEEEEEEllllllll
Query mnvdkegwreyvekmgerygedtstldgFLNALWKSHEHFkehgCVASDHALlepsvyyv  243
ident                                ||                           
Sbjct --------------------------vsQPDALREQVAAG----VIGLEIHE--------  219
DSSP  --------------------------llLHHHHHHHHHHL----LLEEEEEH--------


DSSP  lhhhhhhhhhhhlllllllhhhhhhhhhHHHHHHHHHHHHHLLEEEEEELEEllllhhhh
Query denraravhekafsgekltqdeindykaFMMVQFGKMNQETNWVTQLHIGALrdyrdslf  303
ident                                        |      ||   |        
Sbjct ----------------------dwgatpAAIDCALTVADEMDIQVALHSDTL--------  249
DSSP  ----------------------hhlllhHHHHHHHHHHHHHLLEEEEELLLL--------


DSSP  hhlllllllleellLLLHHHHHHHHHHHLllllLEEE--EELL-hhhhHHHHHHHHhLLL
Query ktlgpdsggdistnFLRIAEGLRYFLNEFdgklKIVL--YVLD-pthlPTISTIARaFPN  360
ident                    |              |             | | |     ||
Sbjct -------------nESGFVEDTLAAIGGR----TIHTfhTEGAggghaPDIITACA-HPN  291
DSSP  -------------lLLLLHHHHHHHHLLL----LEEEllLLLLlllllLLHHHHHH-LLL


DSSP  EEELLLlllLLLHH------------------------------------hhHHHHHHHH
Query VYVGAPwwfNDSPF------------------------------------gmEMHLKYLA  384
ident             |                                               
Sbjct ILPSST--nPTLPYtlntidehldmlmvchhldpdiaedvafaesrirretiAAEDVLHD  349
DSSP  EEEEEE--hHHLLLlllhhhhhhhhhhhhhllllllhhhhhlllllllhhhhHHHHHHHH


DSSP  LlllHHHLlLLLLLLLlllHHHHhHHHHHHHHHHHHHHHHHLlLLLH----HHHHHHHHH
Query SvdlLYNLaGMVTDSRkllSFGSrTEMFRRVLSNVVGEMVEKgQIPI----KEARELVKH  440
ident              ||      |                                      
Sbjct L---GAFS-LTSSDSQamgRVGE-VILRTWQVAHRMKVQRGAlAEETgdndNFRVKRYIA  404
DSSP  L---LLLL-EEELLLLlllLLLL-HHHHHHHHHHHHHHHHLLlLLLLllllHHHHHHHHH


DSSP  HHLHHHHHHHL-------------------------------------------------
Query VSYDGPKALFF-------------------------------------------------  451
ident      |                                                      
Sbjct KYTINPALTHGiahevgsievgkladlvvwspaffgvkpatvikggmiaiapmgdinasi  464
DSSP  LLLHHHHHHLLllllllllllllllleeeelhhhlllllleeeelleeeeeeelllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  451
ident                                                             
Sbjct ptpqpvhyrpmfgalgsarhhcrltflsqaaaangvaerlnlrsaiavvkgcrtvqkadm  524
DSSP  lllllleeeelhhhlhhhhhhhleeeelhhhhhhlhhhhllllleeeellllllllhhhl


DSSP  ------------------------------------------
Query ------------------------------------------  451
ident                                           
Sbjct vhnslqpnitvdaqtyevrvdgelitsepadvlpmaqryflf  566
DSSP  lllllllleeelllllleeelleellllllllllllllllll


No 41: Query=1j5sA Sbjct=4c5yA Z-score=10.3

back to top
DSSP  llllllllllllhhhhhhhHHHL-------------------------------------
Query hmflgedylltnraavrlfNEVK-------------------------------------   23
ident                                                             
Sbjct -------deakvtiiyaglLIPGdgeplrnaalvisdkiiafvgseadipkkylrstqst   53
DSSP  -------lllleeeeeeeeELLLlllleeeeeeeeelleeeeeeehhhllhhhhhhllle


DSSP  ------LLLEEELLLLLL--------------------HHHHHhllllllhhhhhllllh
Query ------DLPIVDPHNHLD--------------------AKDIVenkpwndiwevegatdh   57
ident            | | |                                            
Sbjct hrvpvlMPGLWDCHMHFGgdddyyndytsglathpassGARLA-----------------   96
DSSP  eeeeeeEELEEEEEELLLlllllllllhhhhhllhhhhHHHHH-----------------


DSSP  hhhhhhhhllllhhhllllllhhhhhhhhhhhhhhhlllhhhhhhhhhhhhhllllllll
Query yvwelmrrcgvseeyitgsrsnkekwlalakvfprfvgnptyewihldlwrrfnikkvis  117
ident                                                             
Sbjct ------------------------------------------------------------   96
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhhhhhhhhlllllHHHHHHHLLEEEEELLLlllllLHHHHHHHHH-LLLLEEEL
Query eetaeeiweetkkklpemtPQKLLRDMKVEILCTTDdpvstLEHHRKAKEA-VEGVTILP  176
ident                                           |           |     
Sbjct ------------------rGCWEALQNGYTSYRDLA--gygCEVAKAINDGtIVGPNVYS  136
DSSP  ------------------hHHHHHHHLLEEEEEELL--llhHHHHHHHHLLlLLLLEEEE


DSSP  -LLLLhhHHLL--------lLLLHHHHHhHHHHH-------hllllllHHHHHHHHHHHH
Query -TWRPdrAMNV--------dKEGWREYVeKMGER-------ygedtstLDGFLNALWKSH  220
ident                                                             
Sbjct sGAAL--SQTAghgdifalpAGEVLGSY-GVMNPrpgywgagplciadGVEEVRRAVRLQ  193
DSSP  lLLEE--ELLLlllllllllHHHHHHHH-LLLLLllllllllleeellLHHHHHHHHHHH


DSSP  HHHHlllLLEEEEEE----------LLLLlllllhhhhhhhhhhhlllllllhhhhhhhH
Query EHFKehgCVASDHAL----------LEPSvyyvdenraravhekafsgekltqdeindyK  270
ident                                                             
Sbjct IRRG---AKVIXVMAsggvmsrddnPNFA----------------------------qfS  222
DSSP  HHHL---LLLEEEELllllllllllLLLL----------------------------llL


DSSP  HHHHHHHHHHHHHHLLEEEEEELeellllhhhhhhlllllllleelllllHHHHHHHHHH
Query AFMMVQFGKMNQETNWVTQLHIGalrdyrdslfktlgpdsggdistnflrIAEGLRYFLN  330
ident               |     |                                |      
Sbjct PEELKVIVEEAARQNRIVSAHVH---------------------------GKAGIMAAIK  255
DSSP  HHHHHHHHHHHHHLLLLEEEEEL---------------------------LHHHHHHHHH


DSSP  HLllllLEEE-EELLhhHHHHHHHHHHHLLlEEELLLLlLLLL-----------------
Query EFdgklKIVL-YVLDptHLPTISTIARAFPnVYVGAPWwFNDS-----------------  372
ident          |  |                      |                        
Sbjct AG----CKSLeHVSY--ADEEVWELMKEKG-ILYVATRsVIEIflasngeglvkeswakl  308
DSSP  HL----LLEEeELLL--LLHHHHHHHHHHL-LEEELLHhHHHHhhhhllllllllhhhll


DSSP  ---hhhhHHHHHHHHLLLLhhhLLLLLLLLLLLLHHHhHHHHHHHHHhhhhhhhhhllll
Query ---pfgmEMHLKYLASVDLlynLAGMVTDSRKLLSFGsRTEMFRRVLsnvvgemvekgqi  429
ident                            ||             |                 
Sbjct qaladshLKAYQGAIKAGV---TIALGTDTAPGGPTA-LELQFAVER-------------  351
DSSP  lhhhhhhHHHHHHHHHLLL---LEELLLLLLLLLLLH-HHHHHHHHL-------------


DSSP  lhhhhHHHHHHHHLHHHHHHHL--------------------------------------
Query pikeaRELVKHVSYDGPKALFF--------------------------------------  451
ident                                                             
Sbjct -ggmtPLEAIKAATANAPLSVGpqapltgqlregyeadvialeenpledikvfqepkavt  410
DSSP  -llllHHHHHHHHLLLHHHHHHhhlllllllllllllleeeelllllllhhhhhlhhhee


DSSP  --------------------------
Query --------------------------  451
ident                           
Sbjct hvwkggklfkgpgigpwgedarnpfl  436
DSSP  eeeelleeeellllllllllllllll


No 42: Query=1j5sA Sbjct=3e74A Z-score=10.2

back to top
DSSP  -----------------------------llllllllllllhhhhhhhHHHLllLEEELL
Query -----------------------------hmflgedylltnraavrlfNEVKdlPIVDPH   31
ident                                                         || |
Sbjct sfdliikngtvilenearvvdiavkggkiaaigqdlgdakevxdasglVVSP--GXVDAH   58
DSSP  leeeeeelleeelllleeeleeeeelleeeeeellllleeeeeellllEEEE--LEEEEE


DSSP  LLLlhhhhhhllllllhhhhhllllhhhhhhhhhllllhhhllllllhhhhhhhhhhhhh
Query NHLdakdivenkpwndiwevegatdhyvwelmrrcgvseeyitgsrsnkekwlalakvfp   91
ident  |                                                          
Sbjct THI---------------------------------------------------------   61
DSSP  ELL---------------------------------------------------------


DSSP  hhlllhhhhhhhhhhhhhllllllllhhhhhhhhhhhhhhlllllhHHHHHHLL---EEE
Query rfvgnptyewihldlwrrfnikkviseetaeeiweetkkklpemtpQKLLRDMK---VEI  148
ident                                                   |         
Sbjct --------------------------------------------gyETGTRAAAkggITT   77
DSSP  --------------------------------------------lhHHHHHHHHhllEEE


DSSP  EELLL------LLLLL-LHHHHHHHHHLLLLEEELLLLLHHHhllllllhhhhhhhhhhh
Query LCTTD------DPVST-LEHHRKAKEAVEGVTILPTWRPDRAmnvdkegwreyvekmger  201
ident                   |    |                                    
Sbjct XIEXPlnqlpaTVDRAsIELKFDAAKGKLTIDAAQLGGLVSY------------------  119
DSSP  EEELLllllllLLLHHhHHHHHHHHLLLLLLEEEELEELLLL------------------


DSSP  hllllllhhhhhhhHHHHHHHHHLLLLLEEEEEElllllllllhhhhhhhhhhhllllll
Query ygedtstldgflnaLWKSHEHFKEHGCVASDHALlepsvyyvdenraravhekafsgekl  261
ident                        | | |                                
Sbjct --------------NIDRLHELDEVGVVGFXCFV--------------------------  139
DSSP  --------------LLLLHHHHHHHLLLLEEEEL--------------------------


DSSP  lhhhhhhhHHHHHHHHHHHHHHHLLEEEEEELE---ELLL-LHHHHHH-llllllllEEL
Query tqdeindyKAFMMVQFGKMNQETNWVTQLHIGA---LRDY-RDSLFKT-lgpdsggdIST  316
ident                      |       |                              
Sbjct -----rdvNDWQFFKGAQKLGELGQPVLVHCENaliCDELgEEAKREGrvtahdyvaSRP  194
DSSP  -----lllLHHHHHHHHHHHHHHLLLEEEELLLhhhHHHHhHHHHHHLlllhhhhhhLLL


DSSP  LL--LLHHHHHHHHHHHLllLLLEEEEellhhHHHHHHHHHHHLL----LEEELLLlllL
Query NF--LRIAEGLRYFLNEFdgKLKIVLYvldptHLPTISTIARAFP----NVYVGAPwwfN  370
ident  |          |                     |                         
Sbjct VFteVEAIRRVLYLAKVA--GCRLHVC---hvSSPEGVEEVTRARqegqDITCESC--pH  247
DSSP  HHhhHHHHHHHHHHHHHH--LLLEEEL---llLLHHHHHHHHHHHhlllLEEEEEL--lH


DSSP  LLHH----------------------hhhHHHHHHHLlllhHHLLLLLLLLLL-------
Query DSPF----------------------gmeMHLKYLASvdllYNLAGMVTDSRK-------  401
ident                                   |            | |          
Sbjct YFVLdtdqfeeigtlakcsppirdlenqkGXWEKLFN----GEIDCLVSDHSPcppexka  303
DSSP  HHHLlhhhhhhhlhhhllllllllhhhhhHHHHHHHL----LLLLEELLLLLLlllllll


DSSP  ---------lLHHHHHHHHHHHHHHHHHHhhhhlllllhhhHHHHHHHHHLHHHHHHHL-
Query ---------lLSFGSRTEMFRRVLSNVVGemvekgqipikeARELVKHVSYDGPKALFF-  451
ident               |             |                            |  
Sbjct gnixkawggiAGLQSCXDVXFDEAVQKRG-----------xSLPXFGKLXATNAADIFGl  352
DSSP  llllllllllLLHHHHHHHHHHHHLLLLL-----------lLHHHHHHHHLHHHHHHLLl


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  451
ident                                                             
Sbjct qqkgriapgkdadfvfiqpnssyvltnddleyrhkvspyvgrtigaritktilrgdviyd  412
DSSP  llllllllllllleeeeelllleellhhhllllllllllllleelleeeeeeelleeeee


DSSP  -----------------
Query -----------------  451
ident                  
Sbjct ieqgfpvapkgqfilkh  429
DSSP  lllllllllllleelll


No 43: Query=1j5sA Sbjct=2oofA Z-score=10.2

back to top
DSSP  ---llllllllllllhhhhHHHH----------------------------------hhl
Query ---hmflgedylltnraavRLFN----------------------------------evk   23
ident                                                             
Sbjct lncervwlnvtpatlrsdlADYGllephalgvhegrihalvpxqdlkypahwqdxkgklv   60
DSSP  lllleeeeeeeelllllllLLLLlllleeeeeelleeeeeeehhhllllllleellllee


DSSP  LLLEEELLLLLLhhhhhhllllllhhhhhllLLHHHHHHHHHLLLLHHHLLLLllhhhhh
Query DLPIVDPHNHLDakdivenkpwndiwevegaTDHYVWELMRRCGVSEEYITGSrsnkekw   83
ident      | | ||                             |  ||    |          
Sbjct TPGLIDCHTHLI-----------------faGSRAEEFELRQKGVPYAEIARK-------   96
DSSP  EELEEEEEELLL-----------------llLLLHHHHHHHHHLLLHHHHHHL-------


DSSP  hhhhhhhhhhlllhhhhhhhhhhhhhllllllllhhhhhhhhhhhhhhllllLHHHHHHH
Query lalakvfprfvgnptyewihldlwrrfnikkviseetaeeiweetkkklpemTPQKLLRD  143
ident                                                        | |  
Sbjct ----------------------------gggiistvratraasedqlfelalPRVKSLIR  128
DSSP  ----------------------------lllhhhhhhhhhhllhhhhhhhhhHHHHHHHH


DSSP  LLEEEEELLLL------lLLLL-HHHHHHHHHLLlLEEELLLL-LHHHhllllLLHHHHh
Query MKVEILCTTDD------pVSTL-EHHRKAKEAVEgVTILPTWR-PDRAmnvdkEGWREYv  195
ident   |                       |   ||        |               |   
Sbjct EGVTTVEIKSGygltledELKXlRVARRLGEALP-IRVKTTLLaAHAV----pPEYRDD-  182
DSSP  HLEEEEEEELLllllhhhHHHHhHHHHHHHHHLL-LEEEEEEEeELLL----lHHHLLL-


DSSP  hhhhhhhllllllhhhHHHHHHHHHHHHH--LLLLlEEEEEELLlllllllhhhhhhhhh
Query ekmgerygedtstldgFLNALWKSHEHFK--EHGCvASDHALLEpsvyyvdenraravhe  253
ident                                     | |                     
Sbjct ------------pdswVETICQEIIPAAAeaGLAD-AVDVFCEH----------------  213
DSSP  ------------hhhhHHHHHHLHHHHHHhlLLLL-EEEEEELL----------------


DSSP  hhlllllllhhhhhhhHHHHHHHHHHHHHH-HLLEEEEEELEellllhhhhhhlllllll
Query kafsgekltqdeindyKAFMMVQFGKMNQE-TNWVTQLHIGAlrdyrdslfktlgpdsgg  312
ident                       |           |                         
Sbjct -------------igfSLAQTEQVYLAADQyGLAVKGHXDQL------------------  242
DSSP  -------------lllLHHHHHHHHHHHHHlLLEEEEEELLL------------------


DSSP  leelllLLHHhhhhhhhhhllLLLLEEE-EELLhhHHHHHHHHHHHLLlEEELLL-lLLL
Query distnfLRIAeglryflnefdGKLKIVL-YVLDptHLPTISTIARAFPnVYVGAP-wWFN  370
ident                                      |           |        | 
Sbjct ------SNLG-----gstlaaNFGALSVdHLEY--LDPEGIQALAHRG-VVATLLptAFY  288
DSSP  ------LLLL-----hhhhhhHLLLLEEeELLL--LLHHHHHHHHHHL-LEEEELhhHHH


DSSP  LlhhhhhhHHHHHHLLLlhhHLLLLLLL-----LLLLlHHHHHHHHHHH--HHHHhhhhh
Query DspfgmemHLKYLASVDllyNLAGMVTD-----SRKLlSFGSRTEMFRR--VLSNvvgem  423
ident             |              |          |             |       
Sbjct FlketklpPVVALRKAG---VPXAVSSDinpgtAPIV-SLRXAXNXACTlfGLTP-----  339
DSSP  HlllllllLHHHHHHLL---LLEEELLLlllllLLLL-LHHHHHHHHHHhhLLLH-----


DSSP  hhlllllhhhhhHHHHHHHLHHHHHHHL--------------------------------
Query vekgqipikearELVKHVSYDGPKALFF--------------------------------  451
ident                                                             
Sbjct ------------VEAXAGVTRHAARALGeqeqlgqlrvgxladflvwncghpaelsylig  387
DSSP  ------------HHHHHHLLHHHHHHLLllllllllllllllleeeellllllhhhhlll


DSSP  ----------------
Query ----------------  451
ident                 
Sbjct vdqlvsrvvngeetlh  403
DSSP  llleeeeeelleelll


No 44: Query=1j5sA Sbjct=3mtwA Z-score=10.0

back to top
DSSP  ---------------------------------llllllllllllhhhhhhhhhhlLLLE
Query ---------------------------------hmflgedylltnraavrlfnevkDLPI   27
ident                                                             
Sbjct aeikavsaarlldvasgkyvdnplvivtdgritsigkkgdavpagatavdlpgvtlLPGL   60
DSSP  lleeeeeeeeeeelllleeeeleeeeeelleeeeeeellllllllleeeeeeeeeeEELE


DSSP  EELLLLLL------------------hHHHHHllllllhhhhhllllhhhhhhhhhllll
Query VDPHNHLD------------------aKDIVEnkpwndiwevegatdhyvwelmrrcgvs   69
ident  | | |||                                                    
Sbjct IDMHVHLDslaevggynsleysdrfwsVVQTA----------------------------   92
DSSP  EEEEELLLllllllhhhhhhllhhhhhHHHHH----------------------------


DSSP  hhhllllllhhhhhhhhhhhhhhhlllhhhhhhhhhhhhhllllllllhhhhhhhhhhhh
Query eeyitgsrsnkekwlalakvfprfvgnptyewihldlwrrfnikkviseetaeeiweetk  129
ident                                                             
Sbjct ------------------------------------------------------------   92
DSSP  ------------------------------------------------------------


DSSP  hhlllllhhhHHHHLLEEEEELLLLLLL-lLHHHHHHHHH-LLLLEEELL-LLLHhhHLL
Query kklpemtpqkLLRDMKVEILCTTDDPVS-tLEHHRKAKEA-VEGVTILPT-WRPDraMNV  186
ident                                          | |  |             
Sbjct -------nakKTLEAGFTTVRNVGAADYddVGLREAIDAGyVPGPRIVTAaISFG--ATG  143
DSSP  -------hhhHHHHLLEEEEEELLLLLLhhHHHHHHHHLLlLLLLEEEELlLLEE--LLL


DSSP  L--------lllhHHHHhhhhhhhllllllhhhhHHHHHHHHHHHhlllLLEEEEEEL--
Query D--------kegwREYVekmgerygedtstldgfLNALWKSHEHFkehgCVASDHALL--  236
ident                                     |                       
Sbjct GhcdstffppsmdQKNP--------fnsdspdeaRKAVRTLKKYG----AQVIXICATgg  191
DSSP  LllllllllhhhlLLLL--------lllllhhhhHHHHHHHHHLL----LLEEEEELLll


DSSP  ----------LLLLllllhhhhhhhhhhhlllllllhhhhhhhhHHHHHHHHHHHHHHLL
Query ----------EPSVyyvdenraravhekafsgekltqdeindykAFMMVQFGKMNQETNW  286
ident                                                |            
Sbjct vfsrgnepgqQQLT------------------------------YEEMKAVVDEAHMAGI  221
DSSP  llllllllllLLLL------------------------------HHHHHHHHHHHHHLLL


DSSP  EEEEEELEellllhhhhhhlllllllleelllllhhhhhhhhhhhllllLLEEEE-ELLH
Query VTQLHIGAlrdyrdslfktlgpdsggdistnflriaeglryflnefdgkLKIVLY-VLDP  345
ident     |                                                       
Sbjct KVAAHAHG-------------------------------asgireavraGVDTIEhASLV  250
DSSP  EEEEEELL-------------------------------hhhhhhhhhlLLLEEEeLLLL


DSSP  hhHHHHHHHHHHLLlEEELLL---------------------llllllHHHHHHHHHHHH
Query thLPTISTIARAFPnVYVGAP---------------------wwfndsPFGMEMHLKYLA  384
ident          |      |                                           
Sbjct --DDEGIKLAVQKG-AYFSMDiyntdytqaegkkngvlednlrkdrdiGELQRENFRKAL  307
DSSP  --LHHHHHHHHHHL-LEEELLlllhhhhhhhhhhhlllhhhhhhhhhhHHHHHHHHHHHH


DSSP  LLLLhhhLLLLLLLLL--LLLHHhhhHHHHhHHHHHHHhhhhhlllllhhhHHHHHHHHH
Query SVDLlynLAGMVTDSR--KLLSFgsrTEMFrRVLSNVVgemvekgqipikeARELVKHVS  442
ident             ||               |  |                           
Sbjct KAGV---KMVYGTDAGiyPHGDN---AKQF-AVMVRYG------------aTPLQAIQSA  348
DSSP  HHLL---EEELLLLLLllLLLLH---HHHH-HHHHHLL------------lLHHHHHHHL


DSSP  LHHHHHHHL-----------------------------------------------
Query YDGPKALFF-----------------------------------------------  451
ident                                                         
Sbjct TLTAAEALGrskdvgqvavgrygdmiavagdpladvttlekpvfvmkggavvkapx  404
DSSP  LHHHHHHHLllllllllllllllleeeelllllllhhhhhllleeeelleeeelll


No 45: Query=1j5sA Sbjct=3icjA Z-score=9.7

back to top
DSSP  -----------------------------------llllllllllllhhhhhhhhhhlLL
Query -----------------------------------hmflgedylltnraavrlfnevkDL   25
ident                                                             
Sbjct cmkalingtiytsfspvkkvsglvisnervlyagdsstalriaelaggeiidlkgkfvMP   60
DSSP  leeeeelleeeeeelleeeeleeeeelleeeeeelhhhhhhhhhhhlleeeelllleeEE


DSSP  LEEELLLLLLhhhhhhllLLLLH-------------hhhhllllhhhHHHHhhLLLL---
Query PIVDPHNHLDakdivenkPWNDI-------------wevegatdhyvWELMrrCGVS---   69
ident    | | |||                                                  
Sbjct AFFDSHLHLD---elgmsLEMVDlrgvksmeelvervkkgrgriifgFGWD--QDELgrw  115
DSSP  LEEEEEELHH---hhhhhHHLEEllllllhhhhhhhhhlllllleeeEEEL--HHHHlll


DSSP  ------------------hhhLLLLLlhhhhhhhhhhhhhhhlllhhhhhhhhhhhhhll
Query ------------------eeyITGSRsnkekwlalakvfprfvgnptyewihldlwrrfn  111
ident                                                             
Sbjct ptredldvidrpvflyrrcfhVAVMN---------skmidllnlkpskdfdestgivrer  166
DSSP  llhhhhlllllleeeeellllEEEEL---------hhhhhhhllllllleelllleeehh


DSSP  llllllhhhhhhhhhhhhhhllllLHHHHHHHLLEEEEEL-LLLLlLLLHHHHHHH--HH
Query ikkviseetaeeiweetkkklpemTPQKLLRDMKVEILCT-TDDPvSTLEHHRKAK--EA  168
ident                           |  |    |             |           
Sbjct aleesrkiinekiltvkdykhyieSAQEHLLSLGVHSVGFmSVGE-KALKALFELEreGR  225
DSSP  hhhhhhhhhhhllllhhhhhhhhhHHHHHHHHLLEEEEEEeEELH-HHHHHHHHHHhlLL


DSSP  LLlLEEELLLLLHhhhllllllhhhhhhhhhhhhllllllhhhhhhhHHHH--hHHHHLL
Query VEgVTILPTWRPDramnvdkegwreyvekmgerygedtstldgflnaLWKS--hEHFKEH  226
ident            |                                   | |       |  
Sbjct LK-MNVFAYLSPE---------------------------------lLDKLeelNLGKFE  251
DSSP  LL-LEEEEEELHH---------------------------------hHHHHhhhLLLLEE


DSSP  ----LLLEEEEEEL------------------------LLLLllllhhhhhhhhhhhlll
Query ----GCVASDHALL------------------------EPSVyyvdenraravhekafsg  258
ident                                                             
Sbjct grrlRIWGVXLFVDgslgartallsepytdnpttsgelVMNK------------------  293
DSSP  llleEEEEEEEELLllllllllllllllllllllllllLLLH------------------


DSSP  llllhhhhhhhhhHHHHHHHHHHHHHLLEEEEEELEellllhhhhhhlllllllleelll
Query ekltqdeindykaFMMVQFGKMNQETNWVTQLHIGAlrdyrdslfktlgpdsggdistnf  318
ident                 |               |                           
Sbjct -------------DEIVEVIERAKPLGLDVAVHAIG------------------------  316
DSSP  -------------HHHHHHHHHHLLLLLEEEEEELL------------------------


DSSP  lLHHHHHHHHHHHLLllLLEEEE-ELLHHhhhhHHHHHHHLLlEEELLLllllLLHHH--
Query lRIAEGLRYFLNEFDgkLKIVLY-VLDPThlptISTIARAFPnVYVGAPwwfnDSPFG--  375
ident             |                              |   |            
Sbjct dKAVDVALDAFEEAE--FSGRIEhASLVR--ddQLERIKELK-VRISAQ--phFIVSDww  369
DSSP  hHHHHHHHHHHHHHL--LLLEEEeLLLLL--hhHHHHHHHHL-LEEEEL--llHHHHLll


DSSP  -----------hhhHHHHHHLLllhhHLLLLLLLLLlllHHHHhhHHHHHHHHHHhhhhh
Query -----------memHLKYLASVdllyNLAGMVTDSRkllSFGSrtEMFRRVLSNVvgemv  424
ident                || | |        |  |||                  |      
Sbjct ivnrvgeerakwayRLKTLSSI----TKLGFSTDSP-iePADP--WVSIDAAVNR-----  417
DSSP  hhhhhhhhhhhhllLHHHHHHH----LLEEELLLLL-llLLLH--HHHHHHHHHL-----


DSSP  hlllllhhhHHHHHHHHHLHHHHHHHL------------------------
Query ekgqipikeARELVKHVSYDGPKALFF------------------------  451
ident           ||   |    |                              
Sbjct yvvdpgervSREEALHLYTHGSAQVTLaedlgklergfraeyiildrdplk  468
DSSP  llllhhhllLHHHHHHHLLHHHHHHLLlllllllllllllleeeellllll


No 46: Query=1j5sA Sbjct=3qy6A Z-score=9.3

back to top
DSSP  llllllllllllhhhhhhhhhhllllEEELLLLLL-----hhHHHHLlllllhhhhhlll
Query hmflgedylltnraavrlfnevkdlpIVDPHNHLD-----akDIVENkpwndiwevegat   55
ident                             | | |                           
Sbjct --------------------------MIDIHCHILpamddgaGDSAD-------------   21
DSSP  --------------------------LEELLLLLLlllllllLLHHH-------------


DSSP  lhhhhhhhhhllllhhhllllllhhhhhhhhhhhhhhhlllhhhhhhhhhhhhhllllll
Query dhyvwelmrrcgvseeyitgsrsnkekwlalakvfprfvgnptyewihldlwrrfnikkv  115
ident                                                             
Sbjct ------------------------------------------------------------   21
DSSP  ------------------------------------------------------------


DSSP  llhhhhhhhhhhhhhhlllllHHHHHHHLLEEEEELLL---------LLLLlLHHHHHHH
Query iseetaeeiweetkkklpemtPQKLLRDMKVEILCTTD---------DPVStLEHHRKAK  166
ident                                     |           |    |      
Sbjct ------------------sieMARAAVRQGIRTIIATPhhnngvyknEPAAvREAADQLN   63
DSSP  ------------------hhhHHHHHHHLLLLEEELLLeelllllllLHHHhHHHHHHHH


DSSP  HHL----LLLEEELLLllhhhhllllllhhhhhhhhhhhhllllllhhhhhhhhhhhhhh
Query EAV----EGVTILPTWrpdramnvdkegwreyvekmgerygedtstldgflnalwksheh  222
ident             ||                                              
Sbjct KRLikedIPLHVLPGQ--------------------------------------------   79
DSSP  HHHhhllLLLEEELLL--------------------------------------------


DSSP  hhllllleeEEEElllllllllhhhhhhhhhhhlllllllhhhhhhhhhhhHHHHHHHHH
Query fkehgcvasDHALlepsvyyvdenraravhekafsgekltqdeindykafmMVQFGKMNQ  282
ident                                                             
Sbjct ---------EIRI--------------------------------------YGEVEQDLA   92
DSSP  ---------EEEL--------------------------------------LLLHHHHHH


DSSP  HH-------lLEEEEEELEellllhhhhhhlllllllleellLLLHhHHHHHHHHHLLL-
Query ET-------nWVTQLHIGAlrdyrdslfktlgpdsggdistnFLRIaEGLRYFLNEFDG-  334
ident                                                             
Sbjct KRqllslndtKYILIEFPF-----------------------DHVP-RYAEQLFYDLQLk  128
DSSP  LLllllhhhlLEEEEELLL-----------------------LLLL-LLHHHHHHHHHHl


DSSP  LLLEEE--EELL---HHHHHHHHHHHHHLllEEELL------llllllLHHHHHHHHHHH
Query KLKIVL--YVLD---PTHLPTISTIARAFpnVYVGA------pwwfndSPFGMEMHLKYL  383
ident     |                                                       
Sbjct GYIPVIahPERNreiRENPSLLYHLVEKG--AASQItsgslagifgkqLKAFSLRLVEAN  186
DSSP  LLEEEEelHHHLhhhHHLLHHHHHHHHLL--LEEEEehhhhlllllhhHHHHHHHHHHLL


DSSP  hllllhhhLLLLLLLLLL--LLHHhhHHHHHHHHHHHHHHhhhhlllllhhhhHHHHHHH
Query asvdllynLAGMVTDSRK--LLSFgsRTEMFRRVLSNVVGemvekgqipikeaRELVKHV  441
ident               |        |   |     ||    |              ||    
Sbjct -------lIHFVASDAHNvkTRNF--HTQEALYVLEKEFG-------------SELPYML  224
DSSP  -------lLLEEELLLLLllLLLL--LHHHHHHHHHHHHL-------------LHHHHHH


DSSP  hLHHHHHHHL--------------
Query sYDGPKALFF--------------  451
ident        |                
Sbjct -TENAELLLRnqtifrqppqpvkr  247
DSSP  -HHHHHHHHLllllllllllllll


No 47: Query=1j5sA Sbjct=2uz9A Z-score=9.1

back to top
DSSP  llllllllllllhhhhHHHH----------------------------------------
Query hmflgedylltnraavRLFN----------------------------------------   20
ident                                                             
Sbjct plahifrgtfvhstwtCPMEvlrdhllgvsdsgkivfleeasqqeklakewcfkpceire   60
DSSP  llleeeeeeeeellllLLLEeeeeeeeeellllleeeeeehhhhhhhhhhhlllhhheee


DSSP  ----hhlLLLEEELLLLLLhhhhhhllllllhhhhhllLLHHHHhhhhhllllhhhllll
Query ----evkDLPIVDPHNHLDakdivenkpwndiwevegaTDHYVWelmrrcgvseeyitgs   76
ident            || | |                                           
Sbjct lshheffMPGLVDTHIHAS--------------qysfaGSSIDL----------------   90
DSSP  llllleeEELEEEEEEEHH--------------hhhhlLLLLLL----------------


DSSP  llhhhhhhhhhhhhhhhlllhhhhhhhhhhhhhllllllllhhhhhhhhhhhhhhlllll
Query rsnkekwlalakvfprfvgnptyewihldlwrrfnikkviseetaeeiweetkkklpemt  136
ident                                                             
Sbjct -------------------------------pllewltkytfpaehrfqnidfaeevytr  119
DSSP  -------------------------------lhhhhhhhlhhhhhhhhhlhhhhhhhhhh


DSSP  HHHHHHHLLEEEEELLLLLLLL--LHHHHHHHHHLllLEEELLLLLHhhHLLLLllHHHH
Query PQKLLRDMKVEILCTTDDPVST--LEHHRKAKEAVegVTILPTWRPDraMNVDKegWREY  194
ident              |          |                           |     ||
Sbjct VVRRTLKNGTTTACYFATIHTDssLLLADITDKFG--QRAFVGKVCM--DLNDT--FPEY  173
DSSP  HHHHHHHLLEEEEEEELLLLHHhhHHHHHHHHHHL--LEEEEELEEL--LLLLL--LLLL


DSSP  HhhhhhhhllllllhhhHHHHHHHHHHHHHLLL--------LLEEE-EEELLlllllllh
Query VekmgerygedtstldgFLNALWKSHEHFKEHG--------CVASD-HALLEpsvyyvde  245
ident                        |  | |                     |         
Sbjct K---------------eTTEESIKETERFVSEMlqknysrvKPIVTpRFSLS--------  210
DSSP  L---------------lLHHHHHHHHHHHHHHHhhhlllleEEEEEeLLHHH--------


DSSP  hhhhhhhhhhlllllllhhhhhhhHHHHHHHHHHHHHHHLLEEEEEELeellllhhhhhh
Query nraravhekafsgekltqdeindyKAFMMVQFGKMNQETNWVTQLHIGalrdyrdslfkt  305
ident                             |   |          | ||             
Sbjct -----------------------cSETLMGELGNIAKTRDLHIQSHIS------------  235
DSSP  -----------------------lLHHHHHHHHHHHHHHLLEEEEEEL------------


DSSP  llllllllEELLLLL-----hHHHHHHHHHHLllllLEEEE-ELLHhhHHHHHHHHHHLL
Query lgpdsggdISTNFLR-----iAEGLRYFLNEFdgklKIVLY-VLDPthLPTISTIARAFP  359
ident                                     | |                     
Sbjct -----enrDEVEAVKnlypsyKNYTSVYDKNNlltnKTVMAhGCYL--SAEELNVFHERG  288
DSSP  -----llhHHHHHHHhhllllLLHHHHHHHLLllllLEEEEeLLLL--LHHHHHHHHHHL


DSSP  lEEELLLllLLLL---hHHHHhhHHHHHLLLlhhHLLLLLLLLL--LLLHHHHHHHHHHH
Query nVYVGAPwwFNDS---pFGMEmhLKYLASVDllyNLAGMVTDSR--KLLSFGSRTEMFRR  414
ident                                      |  ||       |          
Sbjct -ASIAHC-pNSNLslssGFLN--VLEVLKHE---VKIGLGTDVAggYSYSMLDAIRRAVM  341
DSSP  -LEEEEL-hHHHHhlllLLLL--HHHHHHLL---LEEEELLLLLllLLLLHHHHHHHHHH


DSSP  HH---------hHHHHhhhhlllllhhhhhhhHHHHHLHHHHHHHL--------------
Query VL---------sNVVGemvekgqipikearelVKHVSYDGPKALFF--------------  451
ident |                               |      |                    
Sbjct VSnillinkvneKSLT-------------lkeVFRLATLGGSQALGldgeignfevgkef  388
DSSP  HHhhhhhlllllLLLL-------------hhhHHHHHLHHHHHHLLllllllllllllll


DSSP  --------------------------------------------------------
Query --------------------------------------------------------  451
ident                                                         
Sbjct dailinpkasdspidlfygdffgdiseaviqkflylgddrnieevyvggkqvvpfs  444
DSSP  leeeelllllllllllllhhhhlllllhhhhhhhhhllhhheeeeeelleeeelll


No 48: Query=1j5sA Sbjct=4rdvB Z-score=8.7

back to top
DSSP  ------------------------llllllllllllhhhhhhhhhhlLLLEEELLLLLLh
Query ------------------------hmflgedylltnraavrlfnevkDLPIVDPHNHLDa   36
ident                                                       | |   
Sbjct saifaerallpegwarnvrfeisadgvlaeirpdanadgaerlggavLPGMPNLHSHAF-   59
DSSP  leeeeeeeeelleeeeeeeeeellllleeeeelllllllleelllleEELEEEEEELHH-


DSSP  hhhhhllllllhhhhhllLLHHHHhhHHHLlllhhhllllllhhhhhhhhhhhhhhhlll
Query kdivenkpwndiwevegaTDHYVWelMRRCgvseeyitgsrsnkekwlalakvfprfvgn   96
ident                                                             
Sbjct --------------qramAGLAEV--AGNP------------------------------   73
DSSP  --------------hhhhLLLLLL--LLLL------------------------------


DSSP  hhhhhhhhhhhhhllllllllhhhhhhhhhhhhhhllllLHHHHHHHLLEEEEELLLLLL
Query ptyewihldlwrrfnikkviseetaeeiweetkkklpemTPQKLLRDMKVEILCTTDDPV  156
ident                                                             
Sbjct -----------ndsfwtwrelmyrmvarlspeqieviacQLYIEMLKAGYTAVAEFHYVH  122
DSSP  -----------lllhhhhhhhhhhhhllllhhhhhhhhhHHHHHHHHHLEEEEEEEELLL


DSSP  ------------lLLHHHHHHHHHLLlLEEELLLLLhhHHLL-----LLLLHHHHhhhhh
Query ------------sTLEHHRKAKEAVEgVTILPTWRPdrAMNV-----DKEGWREYvekmg  199
ident                     |  |                                    
Sbjct hdldgrsyadpaeLSLRISRAASAAG-IGLTLLPVL--YSHAgfggqPASEGQRR-----  174
DSSP  llllllllllllhHHHHHHHHHHHHL-LEEEEEELL--LLEEellleELLHHHLL-----


DSSP  hhhllllllhhhHHHHHHHHHHHHHLLL-----LLEEE-EEELllllllllhhhhhhhhh
Query erygedtstldgFLNALWKSHEHFKEHG-----CVASD-HALLepsvyyvdenraravhe  253
ident                |                       | |                  
Sbjct ---------finGSEAYLELLQRLRAPLeaaghSLGLCfHSLR-----------------  208
DSSP  ---------lllLHHHHHHHHHHHHHHHhhhllEELEEeLLLL-----------------


DSSP  hhlllllllhhhhhhhHHHHHHHHH-HHHHhhLLEEEEEELEEllllhhhhhhlllllll
Query kafsgekltqdeindyKAFMMVQFG-KMNQetNWVTQLHIGALrdyrdslfktlgpdsgg  312
ident                                       ||                    
Sbjct --------------avTPQQIATVLaAGHD--DLPVHIHIAEQ-----------------  235
DSSP  --------------llLHHHHHHHHlLLLL--LLLEEEEELLL-----------------


DSSP  lEELL------LLLH-HHHHHHHHhhlllllLEEE-EELLhhHHHHHHHHHHHLLlEEEL
Query dISTN------FLRI-AEGLRYFLnefdgklKIVL-YVLDptHLPTISTIARAFPnVYVG  364
ident              |                    |         |              |
Sbjct qKEVDdcqawsGRRPlQWLYENVA----vdqRWCLvHATH--ADPAEVAAMARSG-AVAG  288
DSSP  hHHHHhhhhhhLLLHhHHHHHHLL----lllLEEEeELLL--LLHHHHHHHHHHL-LEEE


DSSP  L-----llLLLLlhhhhhhHHHHHHLLLLhhhLLLLLLLLLlllHHHHhHHHHHHHHHHH
Query A-----pwWFNDspfgmemHLKYLASVDLlynLAGMVTDSRkllSFGSrTEMFRRVLSNV  419
ident                                   |   ||       |      | |   
Sbjct LclsteanLGDG-----ifPATDFLAQGG---RLGIGSDSH---VSLS-VVEELRWLEYG  336
DSSP  ElhhhhhhLLLL-----llLHHHHHHLLL---EEEELLLLL---LLLL-HHHHHHHHHHH


DSSP  HHHhhhLLLL-----lhHHHHHHHHHHHLHHHHHHHL-----------------------
Query VGEmveKGQI-----piKEARELVKHVSYDGPKALFF-----------------------  451
ident                               |                             
Sbjct QRL-rdRKRNrlyrddqPMIGRTLYDAALAGGAQALGqpigslavgrradllvldgndpy  395
DSSP  HHH-hhLLLLlllllllLLHHHHHHHHHHHHHHHHHLllllllllllllleeeellllhh


DSSP  --------------------------------------------------------
Query --------------------------------------------------------  451
ident                                                         
Sbjct lasaegdallnrwlfaggdrqvrdvmvagrwvvrdgrhageersarafvqvlgell  451
DSSP  hhllllhhhhhhhhhhllhhheeeeeelleeeelllllllhhhhhhhhhhhhhhhl


No 49: Query=1j5sA Sbjct=3au2A Z-score=8.0

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct mrnqelarifeeiglmseflgdnpfrvrayhqaartlydldtpieeiaekgkealmelpg   60
DSSP  llhhhhhhhhhhhhhhhhhllllhhhhhhhhhhhhhhhhllllhhhhhlllhhhhlllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct vgpdlaekileflrtgkvrkheelsrkvprgvlevmevpgvgpktarllyeglgidslek  120
DSSP  llhhhhhhhhhhhhhlllhhhhhhhhhllhhhhhhhllllllhhhhhhhhhhhllllhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct lkaaldrgdltrlkgfgpkraerireglalaqaagkrrplgavlslarslleairalpgv  180
DSSP  hhhhhhhlhhhhlllllhhhhhhhhhhhhhhhhlllleehhhhhhhhhhhhhhhhlllll


DSSP  --LLLLL-LLLL------------------------------------------------
Query --HMFLG-EDYL------------------------------------------------    9
ident       |                                                     
Sbjct erAELCGsARRYkdtvgdldflvasregeravegfvrlpqvkevyakgkeratvflkngl  240
DSSP  leEEELHhHHLLlleelleeeeeelllhhhhhhhhhlllleeeeeeellleeeeeellll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    9
ident                                                             
Sbjct qvdlrvvppesygaglqyltgskahsirlralaqekglklseygvfrgekriageteeev  300
DSSP  eeeeeeelhhhhhhhhhhhhllhhhhhhhhhhhhhllleeelleeeelleeeelllhhhh


DSSP  -----------LLLHH---------hhhhhhhHLLLLEEELLLLL------LHHHHhhll
Query -----------LTNRA---------avrlfneVKDLPIVDPHNHL------DAKDIvenk   43
ident                                        |   |                
Sbjct yaalglpwippPLREDqgeveaalegrlpkllELPQVKGDLQVHStysdgqNTLEE----  356
DSSP  hhhlllllllhHHLLLllhhhhhhllllllllLHHHLLEEEEELLllllllLLHHH----


DSSP  llllhhhhhllllhhhhhhhhhllllhhhllllllhhhhhhhhhhhhhhhlllhhhhhhh
Query pwndiwevegatdhyvwelmrrcgvseeyitgsrsnkekwlalakvfprfvgnptyewih  103
ident                                                             
Sbjct ------------------------------------------------------------  356
DSSP  ------------------------------------------------------------


DSSP  hhhhhhllllllllhhhhhhhhhhhhhhlllllhhHHHHHLLEEEEELLLllllllhhhh
Query ldlwrrfnikkviseetaeeiweetkkklpemtpqKLLRDMKVEILCTTDdpvstlehhr  163
ident                                         |    |  ||          
Sbjct ---------------------------------lwEAAKTMGYRYLAVTD----------  373
DSSP  ---------------------------------hhHHHHHHLLLEEEEEE----------


DSSP  hhhhhlllleeellLLLH-HHHLlllllhhhhhhhhhhhhllllllhhhhhhhHHHHHHH
Query kakeavegvtilptWRPD-RAMNvdkegwreyvekmgerygedtstldgflnaLWKSHEH  222
ident                 |  |                                        
Sbjct --------------HSPAvRVAG----------------------------gpSPEEALK  391
DSSP  --------------ELHHhHLLL----------------------------llLHHHHHH


DSSP  HHLLL------------lLEEEEEELLLLLllllhhhhhhhhhhhlllllllhhhhhhhh
Query FKEHG------------cVASDHALLEPSVyyvdenraravhekafsgekltqdeindyk  270
ident                                                             
Sbjct RVGEIrrfnethgppyllAGAEVDIHPDGT------------------------------  421
DSSP  HHHHHhhhhhhhllleeeEEEEEELLLLLL------------------------------


DSSP  hhhhhhHHHHHHhHLLEEEEEELEEllllhhhhhhlllllllleELLLL-LHHHHHHHHH
Query afmmvqFGKMNQeTNWVTQLHIGALrdyrdslfktlgpdsggdiSTNFL-RIAEGLRYFL  329
ident                                                        |   |
Sbjct ---ldyPDWVLR-ELDLVLVSVHSR-------------------FNLPKaDQTKRLLKAL  458
DSSP  ---lllLHHHHL-LLLEEEEELLLL-------------------LLLLHhHHHHHHHHHH


DSSP  HHLlllLLEEE--EELL--------hHHHHHHHHHHHHLLlEEELL-lllLLLLhhhHHH
Query NEFdgkLKIVL--YVLD--------pTHLPTISTIARAFPnVYVGA-pwwFNDSpfgMEM  378
ident          ||                        |     | |                
Sbjct ENP---FVHVLahPTARllgrrapieADWEAVFQKAKEKG-VAVEIdgyyDRMD--lPDD  512
DSSP  LLL---LLLEEllLLLLlllllllllLLHHHHHHHHHHHL-LEEEEelllLLLL--lLHH


DSSP  HHHHHHLLLLhhHLLLlLLLLLLLLHHHhHHHHHHHHHHHHHhhhhhlllllhhhhhhhH
Query HLKYLASVDLlyNLAGmVTDSRKLLSFGsRTEMFRRVLSNVVgemvekgqipikearelV  438
ident          |        ||           |                            
Sbjct LARMAYGMGL--WISL-STDAHQTDHLR-FMELAVGTAQRAW----------------iG  552
DSSP  HHHHHHHLLL--LEEE-ELLLLLHHHHH-HHHHHHHHHHHLL----------------lL


DSSP  HHHhlhHHHH------------hhl
Query KHVsydGPKA------------lff  451
ident                          
Sbjct PER--vLNTLdyedllswlkarrgv  575
DSSP  LLL--lHHHLlhhhhhhhhhlllll


No 50: Query=1j5sA Sbjct=3ooqA Z-score=7.6

back to top
DSSP  ---------------------------llllllllllllhhhhhhhhhhlLLLEEELLLL
Query ---------------------------hmflgedylltnraavrlfnevkDLPIVDPHNH   33
ident                                                       || | |
Sbjct kilfknatvfpitsrpfkgdvlvsngkvekvgeniedpdaeivdltgkflFPGFVDAHSH   60
DSSP  leeeeeeeellllllleeeeeeeelleeeeeelllllllleeeelllleeEELEEEEEEL


DSSP  LL-----------------------------HHHHhhllllllhhhhhllllhhhhhhhh
Query LD-----------------------------AKDIvenkpwndiwevegatdhyvwelmr   64
ident                                                             
Sbjct IGlfeegvgyyysdgneatdpvtphvkaldgFNPQ-------------------------   95
DSSP  LLlllllllhhhlllllllllllllllhhhhLLLL-------------------------


DSSP  hllllhhhllllllhhhhhhhhhhhhhhhlllhhhhhhhhhhhhhllllllllhhhhhhh
Query rcgvseeyitgsrsnkekwlalakvfprfvgnptyewihldlwrrfnikkviseetaeei  124
ident                                                             
Sbjct ------------------------------------------------------------   95
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhllllLHHHHHHHLLEEEEELLL-----------llllllhHHHHHHhhlllle
Query weetkkklpemTPQKLLRDMKVEILCTTD-----------dpvstleHHRKAKeavegvt  173
ident                      |                                      
Sbjct ----------dPAIERALAGGVTSVXIVPgsanpvggqgsvikfrsiIVEECI-------  138
DSSP  ----------lHHHHHHHLLLEEEEEELLllllleeeeeeeeellllLHHHHE-------


DSSP  eelllllhhhhllllllhhhhhhhhhhhhllllllhhhhhhhhhhhhhhhhlLLLLEEEE
Query ilptwrpdramnvdkegwreyvekmgerygedtstldgflnalwkshehfkeHGCVASDH  233
ident                                                             
Sbjct ---------------------------------------------------vKDPAGLKX  147
DSSP  ---------------------------------------------------eEEEEEEEE


DSSP  EELLlllllllhhhhhhhhhhhlllllllhhHHHH---hHHHHHHH--------------
Query ALLEpsvyyvdenraravhekafsgekltqdEIND---yKAFMMVQ--------------  276
ident |  |                                    |                   
Sbjct AFGE-----------------npkrvygerkQTPStrxgTAGVIRDyftkvknyxkkkel  190
DSSP  ELLH-----------------hhhhhhhhllLLLLlhhhHHHHHHHhhhhhhhhhhhhhh


DSSP  ----------------hHHHHHHHLLEEEEEELeellllhhhhhhlllllllleellllL
Query ----------------fGKMNQETNWVTQLHIGalrdyrdslfktlgpdsggdistnflR  320
ident                  |            |                             
Sbjct aqkegkeftetdlkxevGEXVLRKKIPARXHAH------------------------raD  226
DSSP  hhhlllllllllhhhhhHHHHHLLLLLEEEEEL------------------------lhH


DSSP  HHHHHHHHHHHLllLLLEEE-EELLhhHHHHhHHHHHHLLlEEELLLL------lllllh
Query IAEGLRYFLNEFdgKLKIVL-YVLDptHLPTiSTIARAFPnVYVGAPW------wfndsp  373
ident           ||      |             |          |                
Sbjct DILTAIRIAEEF--GFNLVIeHGTE--AYKI-SKVLAEKK-IPVVVGPlltfrtklelkd  280
DSSP  HHHHHHHHHHHH--LLLEEEeELLL--HHHH-HHHHHHHL-LLEEELLlllllllhhhll


DSSP  HHHHhHHHHHHLLLLhhhLLLLLLLLLlllHHHHHHHHHHHHhHHHHhhhhhlllllhhh
Query FGMEmHLKYLASVDLlynLAGMVTDSRkllSFGSRTEMFRRVlSNVVgemvekgqipike  433
ident    |     |        |     |          |                        
Sbjct LTXE-TIAKLLKDGV---LIALXCDHP-viPLEFATVQAATA-XRYG------------a  322
DSSP  LLLL-HHHHHHHLLL---LEEELLLLL-llLHHHHHHHHHHH-HHHL------------l


DSSP  HHHHHHHHHLHHHHHHHL------------------------------------------
Query ARELVKHVSYDGPKALFF------------------------------------------  451
ident   |         |                                               
Sbjct KEEDLLKILTVNPAKILGledrigsiepgkdadlvvwsghpfdxksvvervyidgvevfr  382
DSSP  LHHHHHHLLLHHHHHHLLllllllllllllllleeeelllllllllleeeeeelleeeee


DSSP  --
Query --  451
ident   
Sbjct re  384
DSSP  ll


No 51: Query=1j5sA Sbjct=2a3lA Z-score=7.3

back to top
DSSP  llllllllllllHHHHH-------------------------------------------
Query hmflgedylltnRAAVR-------------------------------------------   17
ident                                                             
Sbjct ------------QPDPIaadilrkepeqetfvrlnvplevptsdeveaykclqeclelrk   48
DSSP  ------------LLLLLlllllllllllllllllllllllllllllllhhhhhhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------   17
ident                                                             
Sbjct ryvfqetvapwekeepfahypqgksdhcfemqdgvvhvfankdakedlfpvadatafftd  108
DSSP  lllllllllllllllllllllllllllllllllllllllllllllllllllllhhhhhhh


DSSP  ----------------------------------------------hhhHHLLLLEEELL
Query ----------------------------------------------lfnEVKDLPIVDPH   31
ident                                                         || |
Sbjct lhhvlkviaagnirtlchrrlvlleqkfnlhlmlnadkeflaqksaphrDFYNVRKVDTH  168
DSSP  hhhhhhhlllhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhllllLLLLLLEEEEE


DSSP  LLLLhhhhhhllllllhhHHHLL-----------llhhhhhhhhhllLLHHhllLLLLHH
Query NHLDakdivenkpwndiwEVEGA-----------tdhyvwelmrrcgVSEEyitGSRSNK   80
ident  |                                                          
Sbjct VHHS---------acmnqKHLLRfiksklrkepdevvifrdgtyltlREVF-esLDLTGY  218
DSSP  EELL---------llllhHHHHHhhhhhhhllllllleeelleeelhHHHH-hhHLLLLL


DSSP  HHHhhhhhhhhhhlllhhhhhhhhhhhhhllllllllhhhhhhhhhhhhhhllllLHHHH
Query EKWlalakvfprfvgnptyewihldlwrrfnikkviseetaeeiweetkkklpemTPQKL  140
ident                                                             
Sbjct DLNvdlldvhadkstfhrfdkfnlkynpcgqsrlreiflkqdnliqgrflgeitkQVFSD  278
DSSP  LLLlllllllllllllllllllhhhhllllllhhhhhhlllllllllllhhhhhhHHHHH


DSSP  HHHLLEEEEELLLLL--------lLLLHHH--HHHHhhllLLEEELLLLLHhhHLLLllL
Query LRDMKVEILCTTDDP--------vSTLEHH--RKAKeaveGVTILPTWRPDraMNVDkeG  190
ident |   |                                                       
Sbjct LEASKYQMAEYRISIygrkmsewdQLASWIvnNDLY----SENVVWLIQLP--RLYN--I  330
DSSP  HLLLLLEEEEEEEELllllllhhhHHHHHHhlLLLL----LLLEEEEEEEE--LLHH--H


DSSP  HHHhhhhhhhhhllllLLHHHHHHHHHHHHH------------hhhLLLLLEEEEEELL-
Query WREyvekmgerygedtSTLDGFLNALWKSHE------------hfkEHGCVASDHALLE-  237
ident                       |                           |  |    | 
Sbjct YKD---------mgivTSFQNILDNIFIPLFeatvdpdshpqlhvfLKQVVGFDLVDDEs  381
DSSP  HLL---------llllLLLHHHHHHHLLHHHhhhhlhhhllllhhhHLLEEEEEEELLLl


DSSP  -lllLLLL-HHHHHHhHHHHlllllllhhHHHHhHHHHHHHHHHHHHH-----------H
Query -psvYYVD-ENRARAvHEKAfsgekltqdEINDyKAFMMVQFGKMNQE-----------T  284
ident                    |                                       |
Sbjct kperRPTKhMPTPAQ-WTNA---------FNPA-FSYYVYYCYANLYVlnklreskgmtT  430
DSSP  llllLLLLlLLLLLL-LLLL---------LLLL-HHHHHHHHHHHHHHhhhhhllllllL


DSSP  LLEEEEEELEellllhhhhhhlllllllleelllLLHHhHHHHHHHHllllLLEEEEELl
Query NWVTQLHIGAlrdyrdslfktlgpdsggdistnfLRIAeGLRYFLNEfdgkLKIVLYVLd  344
ident          |                          |   |                   
Sbjct ITLRPHSGEA------------------------GDID-HLAATFLT----CHSIAHGI-  460
DSSP  LEELLLLLLL------------------------LLLH-HHHHHHHH----LLLLLLLH-


DSSP  hhHHHH---HHHHHHHLLlEEELLL--LLLL--lLHHHhhHHHHHHHLllLHHHLlLLLL
Query ptHLPT---ISTIARAFPnVYVGAP--WWFN--dSPFGmeMHLKYLASvdLLYNLaGMVT  397
ident    |                                                 |     |
Sbjct --NLRKspvLQYLYYLAQ-IGLAMSplSNNSlflDYHR--NPFPVFFL--RGLNV-SLST  512
DSSP  --HHHHlhhHHHHHHHHL-LLEEELhhHHLLlllLLLL--LLHHHHHH--LLLLE-EELL


DSSP  LLLL-llhhhHHHHHHHHHHHHHHHhhhhlllllhhhhHHHHHHHhLHHHHHHHL-----
Query DSRK-llsfgSRTEMFRRVLSNVVGemvekgqipikeaRELVKHVsYDGPKALFF-----  451
ident |                     |                                     
Sbjct DDPLqihltkEPLVEEYSIAASVWK-----------lsACDLCEI-ARNSVYQSGfshal  560
DSSP  LLHHhhllllLHHHHHHHHHHHHHL-----------llHHHHHHH-HHHHHHHLLllhhh


DSSP  --------------------------------------------------------
Query --------------------------------------------------------  451
ident                                                         
Sbjct kshwigkdyykrgpdgndihktnvphirvefrdtiwkeemqqvylgkavisdevvp  616
DSSP  hhhhlllllllllhhhllhhhhlllhhhhhhhhhhhhhhhhhhlllllllllllll


No 52: Query=1j5sA Sbjct=1v77A Z-score=7.1

back to top
DSSP  llllllllllllhhhhhhhhhhllLLEEELLLLLLhhhhhhllllllhhhhhllllhhhh
Query hmflgedylltnraavrlfnevkdLPIVDPHNHLDakdivenkpwndiwevegatdhyvw   60
ident                                                             
Sbjct ------------------------VKFIEMDIRDK-------------------------   11
DSSP  ------------------------LLLEEEEELLH-------------------------


DSSP  hhhhhllllhhhllllllhhhhhhhhhhhhhhhlllhhhhhhhhhhhhhllllllllhhh
Query elmrrcgvseeyitgsrsnkekwlalakvfprfvgnptyewihldlwrrfnikkviseet  120
ident                                                             
Sbjct ------------------------------------------------------------   11
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhhhhhlllllhhhhhhhLLEEEEELLL---------LLLLlLHHHhhhhhhlll
Query aeeiweetkkklpemtpqkllrdMKVEILCTTD---------DPVStLEHHrkakeaveg  171
ident                                                             
Sbjct ----------------eayelakEWFDEVVVSIkfneevdkeKLREaRKEY---------   46
DSSP  ----------------hhhhhhhHHLLEEEEEEeelllllhhHHHHhHHHH---------


DSSP  leeELLLllhhhhllllllhhhhhhhhhhhhllllllhhhhhhhhhhhhhhhhllllleE
Query vtiLPTWrpdramnvdkegwreyvekmgerygedtstldgflnalwkshehfkehgcvaS  231
ident                                                             
Sbjct ---GKVA----------------------------------------------------I   51
DSSP  ---LLEE----------------------------------------------------E


DSSP  EEEElllllllllhhhhhhhhhhhlllllllhhhhhhhHHHHHHHHHHHHHhhLLEEEEE
Query DHALlepsvyyvdenraravhekafsgekltqdeindyKAFMMVQFGKMNQetNWVTQLH  291
ident                                       |                     
Sbjct LLSN---------------------------------pKPSLVRDTVQKFK--SYLIYVE   76
DSSP  EEEL---------------------------------lLHHHHHHHHHHLL--LLEEEEE


DSSP  ELeellllhhhhhhlllllllleelllllHHHHHHHHHHHLllllLEEEEE--LLHHHHh
Query IGalrdyrdslfktlgpdsggdistnflrIAEGLRYFLNEFdgklKIVLYV--LDPTHLp  349
ident                                   ||                        
Sbjct SN---------------------------DLRVIRYSIEKG----VDAIISpwVNRKDP-  104
DSSP  LL---------------------------LHHHHHHHHHLL----LLEEELllLLLLLL-


DSSP  HHHHHHHHL---LLEEELLLLLLL------lLHHHhHHHHHHHHLLLL-hHHLLLLLLLL
Query TISTIARAF---PNVYVGAPWWFN------dSPFGmEMHLKYLASVDL-lYNLAGMVTDS  399
ident  |           ||  |                                          
Sbjct GIDHVLAKLmvkKNVALGFSLRPLlysnpyeRANL-LRFMMKAWKLVEkyKVRRFLTSSA  163
DSSP  LLLHHHHHHhhhHLLEEEEELHHHhhllhhhHHHH-HHHHHHHHHHHHhhLLLEEEELLL


DSSP  LLLLHHHhHHHHHHHHHHHHHhhhhhlllllhhhHHHHHHHHHLHHHHHHHL
Query RKLLSFGsRTEMFRRVLSNVVgemvekgqipikeARELVKHVSYDGPKALFF  451
ident                                        |      |     
Sbjct QEKWDVR-YPRDLISLGVVIG------------mEIPQAKASISMYPEIILK  202
DSSP  LLHHHLL-LHHHHHHHHHHLL------------lLHHHHHHLLLHHHHHHHL


No 53: Query=1j5sA Sbjct=3dcpA Z-score=6.1

back to top
DSSP  llllllllllllhhhhhhhhhhlllLEEELLLLLLhhhhhhllllllhhhhhllllhhhh
Query hmflgedylltnraavrlfnevkdlPIVDPHNHLDakdivenkpwndiwevegatdhyvw   60
ident                             | | |                           
Sbjct -------------------------XKRDGHTHTE-------------------------   10
DSSP  -------------------------LLEEEEELLL-------------------------


DSSP  hhhhhllllhhhllllllhhhhhhhhhhhhhhhlllhhhhhhhhhhhhhllllllllhhh
Query elmrrcgvseeyitgsrsnkekwlalakvfprfvgnptyewihldlwrrfnikkviseet  120
ident                                                             
Sbjct ------------------------------------------------------------   10
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhhhhhllllLHHHHHHHLLEEEEELLL-------------------------lL
Query aeeiweetkkklpemTPQKLLRDMKVEILCTTD-------------------------dP  155
ident                                                             
Sbjct ----fcphgthddveEXVLKAIELDFDEYSIVEhaplssefxkntagdkeavttasxaxS   66
DSSP  ----lllllllllhhHHHHHHHHLLLLEEEEEEellllhhhhhllllllhhhhlllllhH


DSSP  LLL--LHHHHHHHHHL-LLLEEELLLllhhhhllllllhhhhhhhhhhhhllllllhhhh
Query VST--LEHHRKAKEAV-EGVTILPTWrpdramnvdkegwreyvekmgerygedtstldgf  212
ident             |        |                                      
Sbjct DLPyyFKKXNHIKKKYaSDLLIHIGF----------------------------------   92
DSSP  HHHhhHHHHHHHHHHLlLLLEEEEEE----------------------------------


DSSP  hhhhhhhhhhhhllllleeEEEElllllllllhhhhhhhhhhhlllllllhhhhhhhhHH
Query lnalwkshehfkehgcvasDHALlepsvyyvdenraravhekafsgekltqdeindykAF  272
ident                                                             
Sbjct -------------------EVDY----------------------------------lIG   99
DSSP  -------------------EEEL----------------------------------lLL


DSSP  HHHHHHHHHHHHL---leeEEEEL----------eELLLLHhhhhhlllllllleeLLLL
Query MMVQFGKMNQETN---wvtQLHIG----------aLRDYRDslfktlgpdsggdisTNFL  319
ident           |         |                   |                   
Sbjct YEDFTRDFLNEYGpqtddgVLSLHflegqggfrsiDFSAED-ynegivqfyggfeqAQLA  158
DSSP  LHHHHHHHHHHHHhhlleeEEELLeeeelleeeelLLLHHH-hhhhlhhhhllhhhHHHH


DSSP  LHHHHHHhhHHHLlllLLEEE--EELL------------------hhHHHHHHHHHHHLL
Query RIAEGLRyfLNEFdgkLKIVL--YVLD------------------ptHLPTISTIARAFP  359
ident                          |                         |        
Sbjct YLEGVKQsiEADLglfKPRRXghISLCqkfqqffgedtsdfseevxeKFRVILALVKKRD  218
DSSP  HHHHHHHhhHLLLlllLLLEEllLLHHhllhhhhlllhhhllhhhhhHHHHHHHHHHHHL


DSSP  lEEELL-------lllLLLLhhHHHHHHHHHHLLllhHHLLLLLLLLLLLLHHHHHHHHH
Query nVYVGA-------pwwFNDSpfGMEMHLKYLASVdllYNLAGMVTDSRKLLSFGSRTEMF  412
ident                                              ||      |      
Sbjct -YELDFntaglfkplcGETY--PPKKIVTLASEL---QIPFVYGSDSHGVQDIGRGYSTY  272
DSSP  -LEEEEelhhhhllllLLLL--LLHHHHHHHHHL---LLLEEEELLLLLHHHLLLLHHHH


DSSP  HHHHHhhhhhhhhlllllhhhhhhhhhhhhlhhhhhhhl
Query RRVLSnvvgemvekgqipikearelvkhvsydgpkalff  451
ident    |                                   
Sbjct CQKLE----------------------------------  277
DSSP  HHHLL----------------------------------


No 54: Query=1j5sA Sbjct=1m65A Z-score=6.1

back to top
DSSP  llllllllllllhhhhhhhhhhlllLEEELLLLL--------LHHHhhhllllllhhhhh
Query hmflgedylltnraavrlfnevkdlPIVDPHNHL--------DAKDivenkpwndiweve   52
ident                            || | |            |              
Sbjct -------------------------YPVDLHMHTvasthaysTLSD--------------   21
DSSP  -------------------------LLEELLLLLllllllllLHHH--------------


DSSP  llllhhhhhhhhhllllhhhllllllhhhhhhhhhhhhhhhlllhhhhhhhhhhhhhlll
Query gatdhyvwelmrrcgvseeyitgsrsnkekwlalakvfprfvgnptyewihldlwrrfni  112
ident                                                             
Sbjct ------------------------------------------------------------   21
DSSP  ------------------------------------------------------------


DSSP  lllllhhhhhhhhhhhhhhlllllhHHHHHHLLEEEEELL------------lLLLLllh
Query kkviseetaeeiweetkkklpemtpQKLLRDMKVEILCTT------------dDPVStle  160
ident                                        |                    
Sbjct ------------------------yIAQAKQKGIKLFAITdhgpdmedaphhwHFIN--m   55
DSSP  ------------------------hHHHHHHHLLLEEEEEeellllllllllhHHHH--h


DSSP  hhHHHHhhLLLLEEELLLllhhhhllllllhhhhhhhhhhhhllllllhhhhhhhhhhhh
Query hhRKAKeaVEGVTILPTWrpdramnvdkegwreyvekmgerygedtstldgflnalwksh  220
ident         | || ||                                             
Sbjct riWPRV--VDGVGILRGI------------------------------------------   71
DSSP  hhLLLE--ELLEEEEEEE------------------------------------------


DSSP  hhhhllllleeEEEElllllllllhhhhhhhhhhhlllllllhhhhhhhhhhhHHHHhhh
Query ehfkehgcvasDHALlepsvyyvdenraravhekafsgekltqdeindykafmMVQFgkm  280
ident                                                             
Sbjct -----------EANI---------------------------------knvdgEIDC---   84
DSSP  -----------EEEL---------------------------------lllllLLLL---


DSSP  hHHHL---lEEEEEElEELLllhhhhhhlllllllleeLLLL-LHHHHHHHHHHHLlllL
Query nQETN---wVTQLHIgALRDyrdslfktlgpdsggdisTNFL-RIAEGLRYFLNEFdgkL  336
ident                                                             
Sbjct sGKMFdsldLIIAGF-HEPV----------------faPHDKaTNTQAMIATIASG---N  124
DSSP  lHHHHhhllEEEEEL-LLLL----------------llLLLHhHHHHHHHHHHHLL---L


DSSP  LEEEE-ELLH---HHHHHHHHHHHHLlLEEELLLllllllhhHHHHHHHHHHLLLLhhhL
Query KIVLY-VLDP---THLPTISTIARAFpNVYVGAPwwfndspfGMEMHLKYLASVDLlynL  392
ident          |            |     |                               
Sbjct VHIIShPGNPkyeIDVKAVAEAAAKH-QVALEIN-----nssNCREVAAAVRDAGG---W  175
DSSP  LLEELlLLLLlllLLHHHHHHHHHHH-LLEEEEE-----lllLHHHHHHHHHHHLL---L


DSSP  LLLLLLLLLLLHHHhHHHHHHHHHHHHHhhhhhlllllhhhhhhHHHHHHLH---HHHHH
Query AGMVTDSRKLLSFGsRTEMFRRVLSNVVgemvekgqipikeareLVKHVSYD---GPKAL  449
ident      ||      |   |     |  |                                 
Sbjct VALGSDSHTAFTMG-EFEECLKILDAVD---------------fPPERILNVsprRLLNF  219
DSSP  EEEELLLLLHHHLL-LLHHHHHHHHHLL---------------lLHHHLHHHlhhHHHHH


DSSP  HL-------------
Query FF-------------  451
ident                
Sbjct LEsrgmapiaefadl  234
DSSP  HHhllllllhhhlll


No 55: Query=1j5sA Sbjct=3f2bA Z-score=5.1

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct vrrletiveeerrvvvqgyvfdaevselksgrtlltmkitdytnsilvkmfsrdkedael   60
DSSP  lllhhhlllleeeeeeeeeeeeeeeeellllleeeeeeeelllleeeeeeelllhhhhhh


DSSP  ---------------------llllllllllllhhhhhhhhhHLLL--LEEELLLLLL--
Query ---------------------hmflgedylltnraavrlfneVKDL--PIVDPHNHLD--   35
ident                                                   |  | |    
Sbjct msgvkkgmwvkvrgsvqndtfvrdlviiandlneiaanerqdTAPEgeKRVELHLHTPms  120
DSSP  hhlllllleeeeeeeeeeelllleeeeeeeeeeeelllllllLLLLllLLLLLLLLLLll


DSSP  -------HHHHhhllllllhhhhhllllhhhhhhhhhllllhhhllllllhhhhhhhhhh
Query -------AKDIvenkpwndiwevegatdhyvwelmrrcgvseeyitgsrsnkekwlalak   88
ident                                                             
Sbjct qmdavtsVTKL-------------------------------------------------  131
DSSP  lllllllHHHH-------------------------------------------------


DSSP  hhhhhlllhhhhhhhhhhhhhllllllllhhhhhhhhhhhhhhlllllhhhHHHHLLEEE
Query vfprfvgnptyewihldlwrrfnikkviseetaeeiweetkkklpemtpqkLLRDMKVEI  148
ident                                                             
Sbjct -------------------------------------------------ieQAKKWGHPA  142
DSSP  -------------------------------------------------hhHHHHLLLLL


DSSP  EELLLLLLLL-LHHHHHHHHHLLlLEEELLLLLHhhHLLLlllhhhhhhhhhhhhlllll
Query LCTTDDPVST-LEHHRKAKEAVEgVTILPTWRPDraMNVDkegwreyvekmgerygedts  207
ident    ||  |         |                     |                    
Sbjct IAVTDHAVVQsFPEAYSAAKKHG-MKVIYGLEAN--IVDD----------------pfhv  183
DSSP  EEELLLLLLLlHHHHHHHHHHHL-LLEEEEEEEE--EELL----------------leee


DSSP  lhhhhhhhhhHHHHHhhllllleeeeeelllllllllhhhhhhhhhhhlllllllhhhhh
Query tldgflnalwKSHEHfkehgcvasdhallepsvyyvdenraravhekafsgekltqdein  267
ident           |                                                 
Sbjct tllaqnetglKNLFK----------------------------------lvslshiqyfh  209
DSSP  eeeellhhhhHHHHH----------------------------------hhhhhhlllll


DSSP  hhhhhHHHHHHHHHhhHLLEEEEE-----ELEEllllhhhhhhlllllllleelllllHH
Query dykafMMVQFGKMNqeTNWVTQLH-----IGALrdyrdslfktlgpdsggdistnflrIA  322
ident            |                                                
Sbjct rvpriPRSVLVKHR--DGLLVGSGcdkgeLFDN-------------------------VE  242
DSSP  lllleEHHHHHHLL--LLEEEELLlllllLLLL-------------------------LL


DSSP  HHHhhhhhhllllllEEEE------------------elLHHHH-HHHHHHHhhllleEE
Query EGLryflnefdgklkIVLY------------------vlDPTHL-PTISTIArafpnvYV  363
ident                  |                                          
Sbjct DIA---------rfyDFLEvhppdvykplyvkdeemiknIIRSIvALGEKLD------IP  287
DSSP  LLH---------hhlLLEEellhhhhlllllllhhhhhhHHHHHhHHHHHLL------LL


DSSP  LLlllllllhhhhhhhhhhhhllllhhhlllLLLLLLLLL--------------------
Query GApwwfndspfgmemhlkylasvdllynlagMVTDSRKLL--------------------  403
ident                                       |                     
Sbjct VV-----------------------------ATGNVHYLNpedkiyrkilihsqgganpl  318
DSSP  EE-----------------------------ELLLLLLLLhhhhhhhhhhhhllhhhlll


DSSP  --------HHHHhHHHHHHHHHHHHhhhhhlllllhhhhhhhhhHHHLHHHHHHHL----
Query --------SFGSrTEMFRRVLSNVVgemvekgqipikearelvkHVSYDGPKALFF----  451
ident          |   |       |                          |           
Sbjct nrhelpdvYFRT-TNEMLDCFSFLG--------------pekakEIVVDNTQKIASligd  363
DSSP  llllllllLLLL-HHHHHHHHHHHH--------------hhhhhHHHLHHHHHHHHllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  451
ident                                                             
Sbjct vkpikdelytpriegadeeiremsyrrakeiygdplpklveerlekelksiighgfaviy  423
DSSP  lllllllllllllllhhhhhhhhhhhhhhhhhlllllhhhhhhhhhhhhhhhhlllhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  451
ident                                                             
Sbjct lishklvkkslddgylvgsrgsvgssfvatmteitevnplpphyvcpnckhseffndgsv  483
DSSP  hhhhhhhhhhhhllllleelhhhhhlhhhhhllllllllllleeelllllleeellllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  451
ident                                                             
Sbjct gsgfdlpdkncprcgtkykkdghdipfetflgfkgdkvpdidlnfsgeyqprahnytkvl  543
DSSP  llhhhllllllllllllleeellllllhhhhllllllllleeeeeelllhhhhhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  451
ident                                                             
Sbjct fgednvyragtigtvadktaygfvkayasdhnlelrgaeidrlaagctgvkrttgqhpgg  603
DSSP  hlllleeeeeeeeellhhhhhhhhhhhhhhllllllhhhhhhhhhhhllleeeeeeeeee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  451
ident                                                             
Sbjct iivvpdymeiydftpiqypaddtssewrtthfdfhsihdnllkldilghddptvirmlqd  663
DSSP  eeellllllhhhllleelhhhllllllleeeeehhhhllllleeeeeeehhhhhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  451
ident                                                             
Sbjct lsgidpktiptddpdvmgifssteplgvtpeqimcnvgtigipefgtrfvrqmleetrpk  723
DSSP  hhlllhhhlllllhhhhhlllllhhhlllhhhhllllllllllllllhhhhhhhhhhlll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  451
ident                                                             
Sbjct tfselvqisglshgtdvwlgnaqeliqngtctlsevigcrddimvyliyrglepslafki  783
DSSP  lhhhhhhhhhhllllllllllhhhhhhlllllhhhllllhhhhhhhhhhllllhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  451
ident                                                             
Sbjct mesvrkgkgltpefeaemrkhdvpewyidsckkikymfpkahaaayvlmavriayfkvhh  843
DSSP  hhhhlllllllhhhhhhhhhllllhhhhhhhhhllllllhhhhhhhhhhhhhhhhhhhhl


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  451
ident                                                             
Sbjct pllyyasyftvraedfdldamikgsaairkrieeinakgiqatakekslltvlevalemc  903
DSSP  hhhhhhhhhhhllllllhhhhhhlhhhhhhhhhhhhhlhhhllhhhhhhhhhhhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  451
ident                                                             
Sbjct ergfsfknidlyrsqatefvidgnslippfnaipglgtnvaqaivrareegeflskedlq  963
DSSP  hllleellllllllllllleeelleeellhhhlllllhhhhhhhhhhhhllllllhhhhh


DSSP  -------------------------------
Query -------------------------------  451
ident                                
Sbjct qrgklsktlleylesrgcldslpdhnqlslf  994
DSSP  hhhlllhhhhhhhhhllllllllllllllll


No 56: Query=1j5sA Sbjct=1bksA Z-score=4.7

back to top
DSSP  llllllllllllhhhhhhhhhhlllleeellllllhhhhhhllllllhhhhhllllhhhh
Query hmflgedylltnraavrlfnevkdlpivdphnhldakdivenkpwndiwevegatdhyvw   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhhhhllllhhhllllllhhhhhhhhhhhhhhhlllhhhhhhhhhhhhhllllllllhhh
Query elmrrcgvseeyitgsrsnkekwlalakvfprfvgnptyewihldlwrrfnikkviseet  120
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhhhhhhhhhhlllllhhhhhhhllEEEEELLLllllllhhhhhhhhhlllleeelllLL
Query aeeiweetkkklpemtpqkllrdmkVEILCTTDdpvstlehhrkakeavegvtilptwRP  180
ident                           |                                 
Sbjct -----------meryenlfaqlndrREGAFVPF-------------------------VT   24
DSSP  -----------lhhhhhhhhhhhhlLLLEEEEE-------------------------EE


DSSP  HHHhllllllhhhhhhhhhhhhllllllhhhHHHHHHHHHHHHHLLLLLEEEEEElllll
Query DRAmnvdkegwreyvekmgerygedtstldgFLNALWKSHEHFKEHGCVASDHALlepsv  240
ident                                      |        |  |          
Sbjct LGD---------------------------pGIEQSLKIIDTLIDAGADALELGV-----   52
DSSP  LLL---------------------------lLHHHHHHHHHHHHHLLLLLEEEEL-----


DSSP  llllhhhhhhhhhhhlllllllhhhhhhHHHHHHHHHHHHHHHHL-LEEEEEELeellll
Query yyvdenraravhekafsgekltqdeindYKAFMMVQFGKMNQETN-WVTQLHIGalrdyr  299
ident                               |                   |         
Sbjct ----pfsdpladgptiqnanlrafaagvTPAQCFEMLALIREKHPtIPIGLLMY------  102
DSSP  ----lllllllllhhhhhhhhhhhhhllLHHHHHHHHHHHHHHLLlLLEEEEEL------


DSSP  hhhhhhlllllllleellLLLH----HHHHHHHHHHLlllLLEEEEEL--LHHHHHHHHH
Query dslfktlgpdsggdistnFLRI----AEGLRYFLNEFdgkLKIVLYVL--DPTHLPTIST  353
ident                                               |             
Sbjct ------------------ANLVfnngIDAFYARCEQV---GVDSVLVAdvPVEESAPFRQ  141
DSSP  ------------------HHHHhlllHHHHHHHHHHH---LLLEEEELllLHHHLHHHHH


DSSP  HHHHLLlEEELlLLLL-lLLHHHHHHHHHHhhllllhhhLLLLLLLlllllHHHHHHHHH
Query IARAFPnVYVGaPWWF-nDSPFGMEMHLKYlasvdllynLAGMVTDsrkllSFGSRTEMF  412
ident  |                           |                           |  
Sbjct AALRHN-IAPI-FICPpnADDDLLRQVASY--------gRGYTYLL---alPLHHLIEKL  188
DSSP  HHHHLL-LEEE-EEELllLLHHHHHHHHHH--------lLLLEEEL---llLHHHHHHHH


DSSP  HHHH----------------------------hhhhhhhhhlllllhhhhhhhhhhhhlh
Query RRVL----------------------------snvvgemvekgqipikearelvkhvsyd  444
ident                                                             
Sbjct KEYHaapalqgfgisspeqvsaavragaagaisgsaivkiieknlaspkqmlaelrsfvs  248
DSSP  HHHLllleeellllllhhhhhhhhhhllleeeellhhhhhhhhllllhhhhhhhhhhhhh


DSSP  hhhhhhl
Query gpkalff  451
ident        
Sbjct amkaasr  255
DSSP  hhhhlll


No 57: Query=1j5sA Sbjct=2anuA Z-score=4.3

back to top
DSSP  llllllllllllhhhhhhhhhhllllEEELLLLL-------LHHHHhhllllllhhhhhl
Query hmflgedylltnraavrlfnevkdlpIVDPHNHL-------DAKDIvenkpwndiweveg   53
ident                             | | |                           
Sbjct ----------------------tewlLCDFHVHTnxsdghlPLGEV--------------   24
DSSP  ----------------------leeeEEEEEELLlllllllLHHHH--------------


DSSP  lllhhhhhhhhhllllhhhllllllhhhhhhhhhhhhhhhlllhhhhhhhhhhhhhllll
Query atdhyvwelmrrcgvseeyitgsrsnkekwlalakvfprfvgnptyewihldlwrrfnik  113
ident                                                             
Sbjct ------------------------------------------------------------   24
DSSP  ------------------------------------------------------------


DSSP  llllhhhhhhhhhhhhhhlllllhhhHHHHLLEEEEELLLLL------------------
Query kviseetaeeiweetkkklpemtpqkLLRDMKVEILCTTDDP------------------  155
ident                           |     |     ||                    
Sbjct ------------------------vdLFGKHGVDVVSITDHIvdrrtleqrkrngeplga   60
DSSP  ------------------------hhHHHHLLLLEEEEEEEEelhhhhhhhhhlllllll


DSSP  -----LLLL-HHHHHHHHHLL---LLEEELLLLLHhhHLLLlllhhhhhhhhhhhhllll
Query -----VSTL-EHHRKAKEAVE---GVTILPTWRPDraMNVDkegwreyvekmgerygedt  206
ident                         |    |        | |                   
Sbjct itedkFQDYlKRLWREQKRAWeeyGXILIPGVEIT--NNTD-------------------   99
DSSP  lllllHHHHhHHHHHHHHHHHhhhLLEEEEEEEEE--ELLL-------------------


DSSP  llhhhhhhhhhHHHHhhhllllleeeeeelllllllllhhhhhhhhhhhlllllllhhhh
Query stldgflnalwKSHEhfkehgcvasdhallepsvyyvdenraravhekafsgekltqdei  266
ident                                                             
Sbjct -lyhivavdvkEYVD---------------------------------------------  113
DSSP  -leeeeeelllLLLL---------------------------------------------


DSSP  hhhhhHHHHHHHHHHHHHLLEEEEEEL-EELLllhhhhhhlllllllleelllllhhHHH
Query ndykaFMMVQFGKMNQETNWVTQLHIG-ALRDyrdslfktlgpdsggdistnflriaEGL  325
ident                 | |                                         
Sbjct ---psLPVEEIVEKLKEQNALVIAAHPdRKKL--------------------swylwANX  150
DSSP  ---llLLHHHHHHHHHHLLLEEEELLLlLLLL--------------------llhhhHLL


DSSP  HHHHHhlllllLEEEEE-llhhHHHHHHHHHhhlllEEELLlllllllhhhhhhhhhhhh
Query RYFLNefdgklKIVLYV-ldptHLPTISTIArafpnVYVGApwwfndspfgmemhlkyla  384
ident   |                                     |                   
Sbjct ERFKD-----tFDAWEIanrddLFNSVGVKK-----YRYVA-------------------  181
DSSP  LLLLL-----lLLEEEEeelleELHHHHHLL-----LLEEE-------------------


DSSP  llllhhhllllLLLLLLLLHHHhhhhhhhhhhhhhhhhhhhlllllhhhhhhhhhhhHLH
Query svdllynlagmVTDSRKLLSFGsrtemfrrvlsnvvgemvekgqipikearelvkhvSYD  444
ident              |   |                                          
Sbjct -----------NSDFHELWHVY-------------------------------swktLVK  199
DSSP  -----------ELLLLLHHHHL-------------------------------leeeEEE


DSSP  H---hhHHHL---------------
Query G---pkALFF---------------  451
ident       |                  
Sbjct SeknieAIKEairkntdvaiylxrk  224
DSSP  ElllhhHHHHhhhhllleeeeelll


No 58: Query=1j5sA Sbjct=2yb1A Z-score=3.8

back to top
DSSP  llllllllllllhhhhhhhhhhllllEEELLLLL-------LHHHHhhllllllhhhhhl
Query hmflgedylltnraavrlfnevkdlpIVDPHNHL-------DAKDIvenkpwndiweveg   53
ident                             | | |                           
Sbjct -------------------------aNIDLHFHSrtsdgalTPTEV--------------   21
DSSP  -------------------------lLEELLLLLlllllllLHHHH--------------


DSSP  lllhhhhhhhhhllllhhhllllllhhhhhhhhhhhhhhhlllhhhhhhhhhhhhhllll
Query atdhyvwelmrrcgvseeyitgsrsnkekwlalakvfprfvgnptyewihldlwrrfnik  113
ident                                                             
Sbjct ------------------------------------------------------------   21
DSSP  ------------------------------------------------------------


DSSP  llllhhhhhhhhhhhhhhlllllhhhhhhhlleeeeeLLLLLLLL-LHHHHHHHHHLLlL
Query kviseetaeeiweetkkklpemtpqkllrdmkveilcTTDDPVST-LEHHRKAKEAVEgV  172
ident                                       ||      |     |       
Sbjct ------------------------idraaarapallaLTDHDCTGgLAEAAAAAARRG-I   56
DSSP  ------------------------hhhhhllllleeeELLLLLLLlHHHHHHHHHHLL-L


DSSP  EEELLLLLH-----------------------hhhlllllLHHH----------------
Query TILPTWRPD-----------------------ramnvdkeGWRE----------------  193
ident   |                                     |  |                
Sbjct PFLNGVEVSvswgrhtvhivglgidpaepalaaglksireGRLErarqmgasleaagiag  116
DSSP  LEEEEEEEEeeelleeeeeeeellllllhhhhhhhhhhhlLHHHhhhhhhhhhhhlllll


DSSP  ---------hhHHHHhhhllllllhhhhhhhhhhhhhhhhllllleeeeeelllllllll
Query ---------yvEKMGerygedtstldgflnalwkshehfkehgcvasdhallepsvyyvd  244
ident              |                                              
Sbjct cfdgamrwcdnPEMI-----------------------------srthfarhlvdsgavk  147
DSSP  hhhhhhlllllHHHL-----------------------------lhhhhhhhhhhlllll


DSSP  hhhhhhhhhhhlllLLLLhhhHHHHhhHHHHHHHHHHHHHLLEEEE-EELEellllhhhh
Query enraravhekafsgEKLTqdeINDYkaFMMVQFGKMNQETNWVTQL-HIGAlrdyrdslf  303
ident                                                | |          
Sbjct dmrtvfrkyltpgkPGYV---SHQW--ASLEDAVGWIVGAGGMAVIaHPGR---------  193
DSSP  lhhhhhhhllllllLLLL---LLLL--LLHHHHHHHHHHLLLEEEElLHHH---------


DSSP  hhlllllllleelllLLHHHHHHHHHHHLLLLLLEEEE----eLLHHHHHHHHHHHHHLL
Query ktlgpdsggdistnfLRIAEGLRYFLNEFDGKLKIVLY----vLDPTHLPTISTIARAFP  359
ident                             |                          |    
Sbjct --------------yDMGRTLIERLILDFQAAGGQGIEvasgsHSLDDMHKFALHADRHG  239
DSSP  --------------lLLLHHHHHHHHHHHHHLLLLEEEeeellLLHHHHHHHHHHHHHHL


DSSP  lEEELLlllllllhhhhhhhhhhHHLLLlhhHLLLlllllllllhhhhhhhhhhhhhhhh
Query nVYVGApwwfndspfgmemhlkyLASVDllyNLAGmvtdsrkllsfgsrtemfrrvlsnv  419
ident   |                    |                                    
Sbjct -LYASS-gsdfhapgedvghtedLPPIC---RPIW-------------------------  269
DSSP  -LEEEE-elllllllllllllllLLLLL---LLHH-------------------------


DSSP  hhhhhhlllllhhhhhhhhhhhhlhhhhHHHL-----------
Query vgemvekgqipikearelvkhvsydgpkALFF-----------  451
ident                                            
Sbjct ----------------------------RELEarilrpadaen  284
DSSP  ----------------------------HHLHhhlllllhhhl


No 59: Query=1j5sA Sbjct=3e38A Z-score=2.3

back to top
DSSP  llllllllllllhhhhhHHHHH---------------------------llLLEEELL--
Query hmflgedylltnraavrLFNEV---------------------------kdLPIVDPH--   31
ident                  |                                          
Sbjct ------aqrrneiqvpdLDGYTtlkcdfhxhsvfsdglvwptvrvdeayrdGLDAISLte   54
DSSP  ------lllllllllllLLLLEeeeeelllllllllllllhhhhhhhhhhlLLLEELLee


DSSP  ----------------lLLLHhhhhhllllllhhhhhllllhhhhhhhhhllllhhhlll
Query ----------------nHLDAkdivenkpwndiwevegatdhyvwelmrrcgvseeyitg   75
ident                    |                                        
Sbjct hieyrphkqdvvsdhnrSFDL---------------------------------------   75
DSSP  elllllllllllllllhHHHH---------------------------------------


DSSP  lllhhhhhhhhhhhhhhhlllhhhhhhhhhhhhhllllllllhhhhhhhhhhhhhhllll
Query srsnkekwlalakvfprfvgnptyewihldlwrrfnikkviseetaeeiweetkkklpem  135
ident                                                             
Sbjct ------------------------------------------------------------   75
DSSP  ------------------------------------------------------------


DSSP  lhhhhHHHLleEEEELllllllllhhhhhhhhhlllleeelLLLLHhhhllllllhhhhh
Query tpqklLRDMkvEILCTtddpvstlehhrkakeavegvtilpTWRPDramnvdkegwreyv  195
ident              |                                              
Sbjct creqaEKLG--ILLIK-------------------------GSEIT--------------   94
DSSP  hhhhhHHHL--LEELL-------------------------EEEEE--------------


DSSP  hhhhhhhllllllhhhhhhhhhhhhhhhhllllleeeeeelLLLLllllhhhhhhhhhhh
Query ekmgerygedtstldgflnalwkshehfkehgcvasdhallEPSVyyvdenraravheka  255
ident                                                             
Sbjct ---------------------------------------raXAPG---------------  100
DSSP  ---------------------------------------llLLLL---------------


DSSP  lllllllhhhhhhhhhHHHHHHHHHHHHHLLEEEEE-ELEELlllhhhhhhlllllllle
Query fsgekltqdeindykaFMMVQFGKMNQETNWVTQLH-IGALRdyrdslfktlgpdsggdi  314
ident                                       |                     
Sbjct -hfnaiflsdsnpleqKDYKDAFREAKKQGAFXFWNhPGWDS-----------------q  142
DSSP  -eeeeelllllhhhllLLHHHHHHHHHHLLLEEEELlLLLLL-----------------l


DSSP  eLLLLLHHHHHHHHHHHLlllLLEEEE--elLHHHhHHHHHHHHHLLlEEELLLLL----
Query sTNFLRIAEGLRYFLNEFdgkLKIVLY--vlDPTHlPTISTIARAFPnVYVGAPWW----  368
ident                 |                   |                       
Sbjct qPDTTKWWPEHTALYQEG---CXHGIEvangHLYX-PEAIQWCLDKN-LTXIGTSDihqp  197
DSSP  lLLLLLLLHHHHHHHHLL---LLLEEEeeelLEEL-LHHHHHHHHHL-LEEEEELLllll


DSSP  ----------------------------------llllhhHHHHhhHHHHLlllhhhlll
Query ----------------------------------fndspfGMEMhlKYLASvdllynlag  394
ident                                           |                 
Sbjct iqtdydfekgehrtxtfvfakerslqgirealdnrrtaayFHEL--LIGRE---------  246
DSSP  hhhhllhhhllllleeeeeellllhhhhhhhhhllleeeeELLE--EELLH---------


DSSP  lllllllllhhhhhhhhhhhhhhHHHHHhHHLLL------------lLHHH---------
Query mvtdsrkllsfgsrtemfrrvlsNVVGEmVEKGQ------------iPIKE---------  433
ident                                |                            
Sbjct -------------------dllrPFFEK-CVKIEevsrneqgvtlsiTNVTdlvlklkkt  286
DSSP  -------------------hhhhHHHHH-HEEEEeeeeelleeeeeeEELLllleeeeel


DSSP  --------------------------------------hhhhhhhhhlhhhhhhhl
Query --------------------------------------arelvkhvsydgpkalff  451
ident                                                         
Sbjct ahdtllvyfrdxtlkphtrytvrigfkqgikggdvnfevtnfivapdkglkytisl  342
DSSP  llllleellleeeellleeeeeeeeellllllleeeeeeeeeeeelleeeeeeeel