Results: dupa

Query: 1itqA

MOLECULE: RENAL DIPEPTIDASE;

Select neighbours (check boxes) for viewing as multiple structural alignment or 3D superimposition. The list of neighbours is sorted by Z-score. Similarities with a Z-score lower than 2 are spurious. Each neighbour has links to pairwise structural alignment with the query structure, and to the PDB format coordinate file where the neighbour is superimposed onto the query structure.

Expand gaps

Summary

    No:  Chain   Z    rmsd lali nres  %id PDB  Description
   1:  1itq-A 72.4  0.0  369   369  100 PDB  MOLECULE: RENAL DIPEPTIDASE;                                         
   2:  4dlf-A 16.8  3.1  239   287   11 PDB  MOLECULE: AMIDOHYDROLASE 2;                                          
   3:  2ob3-A 16.0  3.3  239   329    8 PDB  MOLECULE: PARATHION HYDROLASE;                                       
   4:  2gwg-A 15.8  3.2  246   329   11 PDB  MOLECULE: 4-OXALOMESACONATE HYDRATASE;                               
   5:  2dvt-A 15.8  3.1  227   325   13 PDB  MOLECULE: THERMOPHILIC REVERSIBLE GAMMA-RESORCYLATE DECARBO          
   6:  4qrn-A 15.8  3.3  234   352   10 PDB  MOLECULE: 5-CARBOXYVANILLATE DECARBOXYLASE;                          
   7:  4b3z-D 15.6  3.2  238   477   12 PDB  MOLECULE: DIHYDROPYRIMIDINASE-RELATED PROTEIN 1;                     
   8:  4hk5-D 15.6  3.4  238   380   11 PDB  MOLECULE: URACIL-5-CARBOXYLATE DECARBOXYLASE;                        
   9:  3irs-A 15.6  3.2  227   281    9 PDB  MOLECULE: UNCHARACTERIZED PROTEIN BB4693;                            
  10:  4dzi-C 15.5  3.5  237   388   14 PDB  MOLECULE: PUTATIVE TIM-BARREL METAL-DEPENDENT HYDROLASE;             
  11:  2ffi-A 15.5  3.4  234   273   14 PDB  MOLECULE: 2-PYRONE-4,6-DICARBOXYLIC ACID HYDROLASE, PUTATIV          
  12:  1yrr-B 15.4  3.0  217   334   13 PDB  MOLECULE: N-ACETYLGLUCOSAMINE-6-PHOSPHATE DEACETYLASE;               
  13:  2vc5-A 15.3  3.0  228   314    8 PDB  MOLECULE: ARYLDIALKYLPHOSPHATASE;                                    
  14:  2qpx-A 15.3  3.3  229   376    8 PDB  MOLECULE: PREDICTED METAL-DEPENDENT HYDROLASE OF THE TIM-BA          
  15:  4ofc-A 15.2  3.6  232   335   14 PDB  MOLECULE: 2-AMINO-3-CARBOXYMUCONATE-6-SEMIALDEHYDE DECARBOX          
  16:  1gkp-A 15.1  3.3  238   458   13 PDB  MOLECULE: HYDANTOINASE;                                              
  17:  1onx-A 15.0  2.9  228   390    9 PDB  MOLECULE: ISOASPARTYL DIPEPTIDASE;                                   
  18:  3cjp-A 14.9  2.9  219   262   12 PDB  MOLECULE: PREDICTED AMIDOHYDROLASE, DIHYDROOROTASE FAMILY;           
  19:  3pnu-A 14.9  3.2  227   338   12 PDB  MOLECULE: DIHYDROOROTASE;                                            
  20:  1bf6-A 14.8  3.5  231   291   12 PDB  MOLECULE: PHOSPHOTRIESTERASE HOMOLOGY PROTEIN;                       
  21:  3k2g-B 14.8  3.3  234   358   12 PDB  MOLECULE: RESINIFERATOXIN-BINDING, PHOSPHOTRIESTERASE-               
  22:  4mup-B 14.8  3.4  230   286   13 PDB  MOLECULE: AMIDOHYDROLASE;                                            
  23:  2vun-A 14.6  3.3  223   385   12 PDB  MOLECULE: ENAMIDASE;                                                 
  24:  2y1h-B 14.6  3.4  228   265   11 PDB  MOLECULE: PUTATIVE DEOXYRIBONUCLEASE TATDN3;                         
  25:  3giq-A 14.0  3.6  235   475   11 PDB  MOLECULE: N-ACYL-D-GLUTAMATE DEACYLASE;                              
  26:  2oof-A 13.9  3.6  223   403    9 PDB  MOLECULE: 4-IMIDAZOLONE-5-PROPANOATE AMIDOHYDROLASE;                 
  27:  2paj-A 13.7  3.3  224   421   14 PDB  MOLECULE: PUTATIVE CYTOSINE/GUANINE DEAMINASE;                       
  28:  3mtw-A 13.7  3.6  227   404   11 PDB  MOLECULE: L-ARGININE CARBOXYPEPTIDASE CC2672;                        
  29:  3gri-A 13.7  3.3  228   422   11 PDB  MOLECULE: DIHYDROOROTASE;                                            
  30:  4cqb-A 13.5  3.8  231   402   11 PDB  MOLECULE: N-ISOPROPYLAMMELIDE ISOPROPYL AMIDOHYDROLASE;              
  31:  1k6w-A 13.4  3.6  231   423   13 PDB  MOLECULE: CYTOSINE DEAMINASE;                                        
  32:  3mkv-A 13.2  3.6  226   414   14 PDB  MOLECULE: PUTATIVE AMIDOHYDROLASE;                                   
  33:  1a4m-A 13.1  3.8  233   349   10 PDB  MOLECULE: ADENOSINE DEAMINASE;                                       
  34:  3e74-A 13.0  3.4  219   429    9 PDB  MOLECULE: ALLANTOINASE;                                              
  35:  3nqb-A 12.9  5.3  227   587    9 PDB  MOLECULE: ADENINE DEAMINASE 2;                                       
  36:  3ls9-A 12.8  3.5  224   453    8 PDB  MOLECULE: TRIAZINE HYDROLASE;                                        
  37:  4c5y-A 12.8  3.8  229   436   12 PDB  MOLECULE: OCHRATOXINASE;                                             
  38:  1j5s-A 12.8  3.3  235   451   11 PDB  MOLECULE: URONATE ISOMERASE;                                         
  39:  3gg7-A 12.6  3.7  220   243    9 PDB  MOLECULE: UNCHARACTERIZED METALLOPROTEIN;                            
  40:  1a5k-C 12.3  3.2  218   566   11 PDB  MOLECULE: UREASE (GAMMA SUBUNIT);                                    
  41:  3iac-A 12.3  3.4  238   469   10 PDB  MOLECULE: GLUCURONATE ISOMERASE;                                     
  42:  3icj-A 12.2  3.9  223   468   12 PDB  MOLECULE: UNCHARACTERIZED METAL-DEPENDENT HYDROLASE;                 
  43:  2ogj-A 12.2  3.4  219   379    9 PDB  MOLECULE: DIHYDROOROTASE;                                            
  44:  1j6p-A 11.3  3.5  215   407   11 PDB  MOLECULE: METAL-DEPENDENT HYDROLASE OF                               
  45:  2imr-A 11.3  3.6  213   380   13 PDB  MOLECULE: HYPOTHETICAL PROTEIN DR_0824;                              
  46:  2uz9-A 11.0  3.7  214   444    8 PDB  MOLECULE: GUANINE DEAMINASE;                                         
  47:  4rdv-B 10.8  3.5  217   451    8 PDB  MOLECULE: N-FORMIMINO-L-GLUTAMATE IMINOHYDROLASE;                    
  48:  3ooq-A  9.9  3.7  196   384    9 PDB  MOLECULE: AMIDOHYDROLASE;                                            
  49:  3qy6-A  9.5  3.5  195   247   10 PDB  MOLECULE: TYROSINE-PROTEIN PHOSPHATASE YWQE;                         
  50:  2a3l-A  8.8  3.9  235   616    6 PDB  MOLECULE: AMP DEAMINASE;                                             
  51:  3au2-A  8.6  4.6  200   575   11 PDB  MOLECULE: DNA POLYMERASE BETA FAMILY (X FAMILY);                     
  52:  1v77-A  8.6  4.2  181   202    8 PDB  MOLECULE: HYPOTHETICAL PROTEIN PH1877;                               
  53:  1m65-A  8.2  3.7  184   234   11 PDB  MOLECULE: HYPOTHETICAL PROTEIN YCDX;                                 
  54:  1bks-A  7.4  3.6  178   255    9 PDB  MOLECULE: TRYPTOPHAN SYNTHASE;                                       
  55:  3dcp-A  7.2  3.7  174   277   14 PDB  MOLECULE: HISTIDINOL-PHOSPHATASE;                                    
  56:  3f2b-A  6.2  4.3  181   994   10 PDB  MOLECULE: DNA-DIRECTED DNA POLYMERASE III ALPHA CHAIN;               
  57:  3e38-A  5.6  3.8  156   342    8 PDB  MOLECULE: TWO-DOMAIN PROTEIN CONTAINING PREDICTED PHP-LIKE           
  58:  2anu-A  5.5  3.7  152   224   14 PDB  MOLECULE: HYPOTHETICAL PROTEIN TM0559;                               
  59:  2yb1-A  4.6  3.7  142   284   15 PDB  MOLECULE: AMIDOHYDROLASE;                                            


Pairwise Structural Alignments

Notation: three-state secondary structure definitions by DSSP (reduced to H=helix, E=sheet, L=coil) are shown above the amino acid sequence. Structurally equivalent residues are in uppercase, structurally non-equivalent residues (e.g. in loops) are in lowercase. Amino acid identities are marked by vertical bars.

No 1: Query=1itqA Sbjct=1itqA Z-score=72.4

back to top
DSSP  LHHHHHHHHHHLLLLEEEEEELHHHHHHHHHLLLLLLHHHLLLLLLLLLLLHHHHHHLLE
Query DFFRDEAERIMRDSPVIDGHNDLPWQLLDMFNNRLQDERANLTTLAGTHTNIPKLRAGFV   60
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct DFFRDEAERIMRDSPVIDGHNDLPWQLLDMFNNRLQDERANLTTLAGTHTNIPKLRAGFV   60
DSSP  LHHHHHHHHHHLLLLEEEEEELHHHHHHHHHLLLLLLHHHLLLLLLLLLLLHHHHHHLLE


DSSP  EEEEEEELLLHHHLLLLHHHHHHHHHHHHHHHHHHLLLLEEELLLHHHHHHHHHLLLEEE
Query GGQFWSVYTPCDTQNKDAVRRTLEQMDVVHRMCRMYPETFLYVTSSAGIRQAFREGKVAS  120
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct GGQFWSVYTPCDTQNKDAVRRTLEQMDVVHRMCRMYPETFLYVTSSAGIRQAFREGKVAS  120
DSSP  EEEEEEELLLHHHLLLLHHHHHHHHHHHHHHHHHHLLLLEEELLLHHHHHHHHHLLLEEE


DSSP  EEEEELHHHLLLLHHHHHHHHHLLEEEEELLLLLLLLLLLLHHHLLLLLLLLLLLLLHHH
Query LIGVEGGHSIDSSLGVLRALYQLGMRYLTLTHSCNTPWADNWLVDTGDSEPQSQGLSPFG  180
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct LIGVEGGHSIDSSLGVLRALYQLGMRYLTLTHSCNTPWADNWLVDTGDSEPQSQGLSPFG  180
DSSP  EEEEELHHHLLLLHHHHHHHHHLLEEEEELLLLLLLLLLLLHHHLLLLLLLLLLLLLHHH


DSSP  HHHHHHHHHHLLEEELLLLLHHHHHHHHHHLLLLLEELLLLLLLLLLLLLLLLHHHHHHH
Query QRVVKELNRLGVLIDLAHVSVATMKATLQLSRAPVIFSHSSAYSVCASRRNVPDDVLRLV  240
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct QRVVKELNRLGVLIDLAHVSVATMKATLQLSRAPVIFSHSSAYSVCASRRNVPDDVLRLV  240
DSSP  HHHHHHHHHHLLEEELLLLLHHHHHHHHHHLLLLLEELLLLLLLLLLLLLLLLHHHHHHH


DSSP  HHHLLEEEELLLHHHHLLLLLLLHHHHHHHHHHHHHHLLHHHEEELLLLLLLLLLLLLLL
Query KQTDSLVMVNFYNNYISCTNKANLSQVADHLDHIKEVAGARAVGFGGDFDGVPRVPEGLE  300
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct KQTDSLVMVNFYNNYISCTNKANLSQVADHLDHIKEVAGARAVGFGGDFDGVPRVPEGLE  300
DSSP  HHHLLEEEELLLHHHHLLLLLLLHHHHHHHHHHHHHHLLHHHEEELLLLLLLLLLLLLLL


DSSP  LLLLHHHHHHHHHHLLLLHHHHHHHHLHHHHHHHHHHHHLLLLLLLLLLLLLLHHHLLLL
Query DVSKYPDLIAELLRRNWTEAEVKGALADNLLRVFEAVEQASNLTQAPEEEPIPLDQLGGS  360
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct DVSKYPDLIAELLRRNWTEAEVKGALADNLLRVFEAVEQASNLTQAPEEEPIPLDQLGGS  360
DSSP  LLLLHHHHHHHHHHLLLLHHHHHHHHLHHHHHHHHHHHHLLLLLLLLLLLLLLHHHLLLL


DSSP  LLLLLLLLL
Query CRTHYGYSS  369
ident |||||||||
Sbjct CRTHYGYSS  369
DSSP  LLLLLLLLL


No 2: Query=1itqA Sbjct=4dlfA Z-score=16.8

back to top
DSSP  lhhhhhhhhhhllLLEEEEEELHHhhhHHHH--llllllhhhlllllllllLLHHHHHHL
Query dffrdeaerimrdSPVIDGHNDLPwqlLDMF--nnrlqderanlttlagthTNIPKLRAG   58
ident                 || |                                  |   | 
Sbjct -------------ALRIDSHQHFW---RYRAadypwigagmgvlardylpdALHPLMHAQ   44
DSSP  -------------LLLEEEEELLL---LLLHhhllllllllhhhlllllhhHHHHHHHHL


DSSP  LEEEEEEEELLLhhhllllHHHHHHHHHHHHHHHHhhlllleeelllhhhhhhhhhlllE
Query FVGGQFWSVYTPcdtqnkdAVRRTLEQMDVVHRMCrmypetflyvtssagirqafregkV  118
ident   |                    |                                    
Sbjct ALGASIAVQARA-------GRDETAFLLELACDEA------------------------R   73
DSSP  LLLEEEEELLLL-------LHHHHHHHHHHHLLLL------------------------L


DSSP  EEEEEEelhhHLLL----LHHHHHHHHHLLEEEEELLLLLLllllllhhhlllllLLLLL
Query ASLIGVegghSIDS----SLGVLRALYQLGMRYLTLTHSCNtpwadnwlvdtgdsEPQSQ  174
ident             |                  |                            
Sbjct IAAVVG----WEDLrapqLAERVAEWRGTKLRGFRHQLQDE--------------ADVRA  115
DSSP  EEEEEE----LLLLllllHHHHHHLLLLLLEEEEEELHHHL--------------LLHHH


DSSP  -LLLHHHHHHHHHHHHHLLEEELLL--lLHHHHHHHHHHL-LLLLEELLLLLLlLLLL--
Query -GLSPFGQRVVKELNRLGVLIDLAH--vSVATMKATLQLS-RAPVIFSHSSAYsVCAS--  228
ident         | |  |       |            |             |       |   
Sbjct fVDDADFARGVAWLQANDYVYDVLVferQLPDVQAFCARHdAHWLVLDHAGKP-ALAEfd  174
DSSP  hHHLHHHHHHHHHHHHLLLEEEELLlhhHHHHHHHHHHHLlLLLEEEHHHHLL-LHHHll


DSSP  -----lllLLHHHHHHHHHHLLEEEELLLHHHhlLLLL-----lLHHHHHHHHHHHHHHL
Query -----rrnVPDDVLRLVKQTDSLVMVNFYNNYisCTNK-----aNLSQVADHLDHIKEVA  278
ident                |                             |      ||      
Sbjct rddtalarWRAALRELAALPHVVCKLSGLVTE--ADWRrglrasDLRHIEQCLDAALDAF  232
DSSP  llllhhhhHHHHHHHHHLLLLEEEEELLLLLL--LLLLllllhhHHHHHHHHHHHHHHHH


DSSP  LHHHEEELLLLLLLLLLllllLLLLL-HHHHHHHHHhLLLLHHHHHHHHLHHHHHHHHhh
Query GARAVGFGGDFDGVPRVpeglEDVSK-YPDLIAELLrRNWTEAEVKGALADNLLRVFEav  337
ident |     || |                                ||          |     
Sbjct GPQRLMFGSDWPVCLLA----ASYDEvASLVERWAE-SRLSAAERSALWGGTAARCYA--  285
DSSP  LHHHEEELLLLLHHHHL----LLHHHhHHHHHHHHH-HHLLHHHHHHHLLHHHHHHLL--


DSSP  hhllllllllllllllhhhlllllllllllll
Query eqasnltqapeeepipldqlggscrthygyss  369
ident                                 
Sbjct ------------------------------lp  287
DSSP  ------------------------------ll


No 3: Query=1itqA Sbjct=2ob3A Z-score=16.0

back to top
DSSP  -lhhhhhhhhhhlllLEEEEEELHHHHhhHHHL------lLLLLhhHLLLlllllllLHH
Query -dffrdeaerimrdsPVIDGHNDLPWQllDMFN------nRLQDerANLTtlagthtNIP   53
ident                     |                                       
Sbjct drintvrgpitiseaGFTLTHEHICGSsaGFLRawpeffgSRKA--LAEK----avrGLR   54
DSSP  lleeelleeelhhhhLLEEEEELLEELllLHHHhlhhhhlLHHH--HHHH----hhhHHH


DSSP  HHHHLLEEEEEEEELLLhhhllllhhhhhhhHHHHHHHHHhhlLLLEeelllhhhhhhhh
Query KLRAGFVGGQFWSVYTPcdtqnkdavrrtleQMDVVHRMCrmyPETFlyvtssagirqaf  113
ident   ||  |                                                     
Sbjct RARAAGVRTIVDVSTFD-----------igrDVSLLAEVS---RAAD-------------   87
DSSP  HHHHLLLLEEEELLLHH-----------hllLHHHHHHHH---HHHL-------------


DSSP  hlllEEEEEEEELHH---------hllLLHHHHHHHHH-------LLEEEEELLllllll
Query regkVASLIGVEGGH---------sidSSLGVLRALYQ-------LGMRYLTLThscntp  157
ident     |                                |                      
Sbjct ----VHIVAATGLWFdpplsmrlrsveELTQFFLREIQygiedtgIRAGIIXVA------  137
DSSP  ----LEEELEEELLLlllhhhhlllhhHHHHHHHHHHHlllllllLLLLEEEEE------


DSSP  lllLHHHlllllllLLLLLlhhHHHHHHHHHHHLLEEELLL-----LLHHHHHHHHH-HL
Query wadNWLVdtgdsepQSQGLspfGQRVVKELNRLGVLIDLAH-----VSVATMKATLQ-LS  211
ident                                  ||                         
Sbjct ---TTGK------aTPFQE-lvLKAAARASLATGVPVTTHTaasqrDGEQQAAIFESeGL  187
DSSP  ---LLLL------lLHHHH-hhHHHHHHHHHHHLLLEEEELlhhhlHHHHHHHHHHHlLL


DSSP  LLL-LEELLLLLLLllllllllLHHHHHHHHHHlLEEEE-LLLHhhhlLLLL--------
Query RAP-VIFSHSSAYSvcasrrnvPDDVLRLVKQTdSLVMV-NFYNnyisCTNK--------  261
ident     |   ||                  |      |                        
Sbjct SPSrVCIGHSDDTD-------dLSYLTALAARG-YLIGLdHIPY----SAIGlednasas  235
DSSP  LHHhEEELLHHHLL-------lHHHHHHHHHLL-LEEEElLLLL----LLLLllllhhhh


DSSP  -----LLHHHHHHHHHHHHHHLLHHHEEELLLLL-------------lLLLLllllLLLL
Query -----ANLSQVADHLDHIKEVAGARAVGFGGDFD-------------gVPRVpeglEDVS  303
ident            |                   |                            
Sbjct allgiRSWQTRALLIKALIDQGYMKQILVSNDWTfgfssyvtnimdvmDRVN---pDGMA  292
DSSP  hhhllLLHHHHHHHHHHHHHLLLHHHEEELLLLLleellllllhhhhhHHHL---lLHHH


DSSP  L-HHHHHHHHHHLLLLHHHHHHHHLHHHHHHHHhHHHLlllllllllllllhhhllllll
Query K-YPDLIAELLRRNWTEAEVKGALADNLLRVFEaVEQAsnltqapeeepipldqlggscr  362
ident       |  |           |    |  |                              
Sbjct FiPLRVIPFLREKGVPQETLAGITVTNPARFLS-PTLR----------------------  329
DSSP  HhHHLHHHHHHHLLLLHHHHHHHHLHHHHHHHL-LLLL----------------------


DSSP  lllllll
Query thygyss  369
ident        
Sbjct -------  329
DSSP  -------


No 4: Query=1itqA Sbjct=2gwgA Z-score=15.8

back to top
DSSP  lhhhhhhhhhhlllLEEEEEELhHHHHhhHHLL------------------------LLL
Query dffrdeaerimrdsPVIDGHNDlPWQLldMFNN------------------------RLQ   36
ident                 || |                                        
Sbjct --------------XIIDIHGH-YTTA--PKALedwrnrqiagikdpsvxpkvselkISD   43
DSSP  --------------LLEEEEEE-LLLL--LHHHhhhhhhhhhhhhlhhhlllhhhllLLH


DSSP  LH-hHLLLLlllllLLHHHHHHLLEEEEEEEELLlhhhLLLLHHHHHHHHHHHHHHHHHh
Query DE-rANLTTlagthTNIPKLRAGFVGGQFWSVYTpcdtQNKDAVRRTLEQMDVVHRMCRm   95
ident ||  |             |           |                        |    
Sbjct DElqASIIE-----NQLKKXQERGSDLTVFSPRA---gDFNVSSTWAAICNELCYRVSQ-   94
DSSP  HHhhHHHHL-----LHHHHHHHHLLLEEEEELLL---lLHHHHHHHHHHHHHHHHHHHH-


DSSP  llllEEELllhhhhhhhhhllleEEEEEEElhHHLL------LLHHHHHHHHH-LLEEEE
Query ypetFLYVtssagirqafregkvASLIGVEggHSID------SSLGVLRALYQ-LGMRYL  148
ident                                                |       |    
Sbjct ----LFPD---------------NFIGAAX--LPQSpgvdpkTCIPELEKCVKeYGFVAI  133
DSSP  ----HLLL---------------LEEEEEE--LLLLllllhhHHHHHHHHHHHlLLLLEE


DSSP  ELLLLLLllllllhhhlllLLLLLLLLLLHHHHHHHHHHHHHLLEEELLL----------
Query TLTHSCNtpwadnwlvdtgDSEPQSQGLSPFGQRVVKELNRLGVLIDLAH----------  198
ident  |                                       |                  
Sbjct NLNPDPS-----------gGHWTSPPLTDRIWYPIYEKXVELEIPAXIHVstgahylnad  182
DSSP  EELLLLL-----------lLLLLLLLLLLHHHHHHHHHHHHHLLLEEELLllllhhhhhh


DSSP  --LLHHH-hHHHHHHL-LLLLEElLLLL-LLLLL-------llllllhHHHHHHHhHLLE
Query --VSVAT-mKATLQLS-RAPVIFsHSSA-YSVCA-------srrnvpdDVLRLVKqTDSL  246
ident                                                      |      
Sbjct ttAFXQCvaGDLFKDFpELKFVI-PHGGgAVPYHwgrfrglaqexkkpLLEDHVL-NNIF  240
DSSP  hhHHHHHhhLLHHHHLlLLLEEE-LHHHlLLHHHhhhhhhhhhhllllLHHHHLL-LLEE


DSSP  EEELLLhhhhllllllLHHHHHHHHHHHHhhllHHHEEELLLLLLLLLLLL----LLLLl
Query VMVNFYnnyisctnkaNLSQVADHLDHIKevagARAVGFGGDFDGVPRVPE----GLEDv  302
ident      |                     |        | |     |  |          | 
Sbjct FDTCVY----------HQPGIDLLNTVIP----VDNVLFASEXIGAVRGIDprtgFYYD-  285
DSSP  EELLLL----------LHHHHHHHHHHLL----HHHEELLLLLLLLLLLEEllllEELL-


DSSP  lLHHHHHHHHhhLLLLHHHHHHHHLHHHHHHHHhhhhllllllllllllllhhhllllll
Query sKYPDLIAELlrRNWTEAEVKGALADNLLRVFEaveqasnltqapeeepipldqlggscr  362
ident       |        |  |       |  ||                             
Sbjct -DTKRYIEAS--TILTPEEKQQIYEGNARRVYP--------------------rldaalk  322
DSSP  -LLHHHHHHL--LLLLHHHHHHHHLHHHHHHLH--------------------hhhhhhh


DSSP  lllllll
Query thygyss  369
ident        
Sbjct akgkleh  329
DSSP  hhhhhll


No 5: Query=1itqA Sbjct=2dvtA Z-score=15.8

back to top
DSSP  lhhhhhhhhhhlLLLEEEEEELHhHHHHhhhllllllhhhllllLLLL-----llLHHHH
Query dffrdeaerimrDSPVIDGHNDLpWQLLdmfnnrlqderanlttLAGT-----htNIPKL   55
ident                                             |               
Sbjct ------------MQGKVALEEHF-AIPEtlqdsagfvpgdywkeLQHRlldiqdtRLKLM   47
DSSP  ------------LLLEEEEEEEE-LLHHhhhhhlllllllhhhhHHHHhhllllhHHHHH


DSSP  HHLLEEEEEEEEL--LLHHHLLL-LHHHHHHHHHHHHHHHHHhllllEEELllhhhhhhh
Query RAGFVGGQFWSVY--TPCDTQNK-DAVRRTLEQMDVVHRMCRmypetFLYVtssagirqa  112
ident  |        |              |        ||    |                   
Sbjct DAHGIETMILSLNapAVQAIPDRrKAIEIARRANDVLAEECA-----KRPD---------   93
DSSP  HHLLEEEEEEEELllHHHHLLLHhHHHHHHHHHHHHHHHHHH-----HLLL---------


DSSP  hhllleEEEEEEELhhHLLLL---HHHHHHHHH-LLEEEEELlLLLL-------LLLLll
Query fregkvASLIGVEGghSIDSS---LGVLRALYQ-LGMRYLTLtHSCN-------TPWAdn  161
ident         |                  |      ||                        
Sbjct ------RFLAFAAL--PLQDPdaaTEELQRCVNdLGFVGALV-NGFSqegdgqtPLYY--  142
DSSP  ------LEEEEELL--LLLLHhhhHHHHHHHHHlLLLLEEEE-ELLLlllllllLLLL--


DSSP  hhhlllllllllllLLHHHHHHHHHHHHHLLEEELLL-----------------------
Query wlvdtgdsepqsqgLSPFGQRVVKELNRLGVLIDLAH-----------------------  198
ident                 |       |   | |   |                         
Sbjct --------------DLPQYRPFWGEVEKLDVPFYLHPrnplpqdsriydghpwllgptwa  188
DSSP  --------------LLHHHHHHHHHHHHHLLLEEEELllllhhhlhhhlllhhhlhhhlh


DSSP  ---LLHHHHHHHHH------HLLLLLEElLLLLllllllllLLLH---------------
Query ---VSVATMKATLQ------LSRAPVIFsHSSAysvcasrrNVPD---------------  234
ident                       |   |                                 
Sbjct faqETAVHALRLMAsglfdeHPRLNIIL-GHMG--------EGLPymmwridhrnawvkl  239
DSSP  hhhHHHHHHHHHHHllhhhhLLLLLEEE-LHHH--------LLHHhhhhhhhhlllllll


DSSP  --------hhhHHHHHHlLEEEELLLhhhhlllllllhhhHHHHHHHHHHHLLHHHEEEL
Query --------dvlRLVKQTdSLVMVNFYnnyisctnkanlsqVADHLDHIKEVAGARAVGFG  286
ident                                             |       ||    | 
Sbjct pprypakrrfmDYFNEN-FHITTSGN-------------fRTQTLIDAILEIGADRILFS  285
DSSP  lllllllllhhHHHHHH-EEEELLLL-------------lLHHHHHHHHLLLLHHHEELL


DSSP  LLLLLLllllllllLLLLHHHHHHHHHhllLLHHHHHHHHLHHHHHHHHhhhhlllllll
Query GDFDGVprvpegleDVSKYPDLIAELLrrnWTEAEVKGALADNLLRVFEaveqasnltqa  346
ident  |                  |           ||        |  | |            
Sbjct TDWPFE--------NIDHASDWFNATS---IAEADRVKIGRTNARRLFK-----------  323
DSSP  LLLLLL--------LHHHHHHHHHHLL---LLHHHHHHHHLHHHHHHLL-----------


DSSP  lllllllhhhlllllllllllll
Query peeepipldqlggscrthygyss  369
ident                        
Sbjct ---------------------ld  325
DSSP  ---------------------ll


No 6: Query=1itqA Sbjct=4qrnA Z-score=15.8

back to top
DSSP  LHHH--hhhHHHHllLLEEEEEELHhhhHHHH------------------hllllllhhh
Query DFFR--deaERIMrdSPVIDGHNDLpwqLLDM------------------fnnrlqdera   40
ident                   |                                         
Sbjct SMTQdlktgGEQG--YLRIATEEAF---ATREiidvylrmirdgtadkgmvslwgfyaqs   55
DSSP  LLLLlllllLLLL--LLLEEEEEEE---LLHHhhhhhhhhhhhllllhhhhhhhhhhhhl


DSSP  llllLLLL--------llLHHHHHHLLEEEEEEEEL--LLHHH-lLLLHHHHHHHHHHHH
Query nlttLAGT--------htNIPKLRAGFVGGQFWSVY--TPCDT-qNKDAVRRTLEQMDVV   89
ident                    |    |                       |        |  
Sbjct pserATQIlerlldlgerRIADMDATGIDKAILALTspGVQPLhdLDEARTLATRANDTL  115
DSSP  llhhHHHHhhhhhlllhhHHHHHHHLLLLEEEEEELllLLLLLllHHHHHHHHHHHHHHH


DSSP  HHHHHhllllEEELllhhhhhhhhhllleEEEEEEElhhHLLLL---HHHHHHHHH-LLE
Query HRMCRmypetFLYVtssagirqafregkvASLIGVEgghSIDSS---LGVLRALYQ-LGM  145
ident    |                                                     || 
Sbjct ADACQ-----KYPD---------------RFIGMGT--vAPQDPewsAREIHRGAReLGF  153
DSSP  HHHHH-----HLLL---------------LEEELLL--lLLLLHhhhHHHHHHHHHlLLL


DSSP  EEEELlLLLL-LLLLllhhhlllllllllllLLHHHHHHHHHHHHHLLEEELLL------
Query RYLTLtHSCN-TPWAdnwlvdtgdsepqsqgLSPFGQRVVKELNRLGVLIDLAH------  198
ident        |                          |       |                 
Sbjct KGIQI-NSHTqGRYL----------------DEEFFDPIFRALVEVDQPLYIHPatspds  196
DSSP  LLEEE-LLLLlLLLL----------------LLHHHHHHHHHHHHHLLLEEELLllllll


DSSP  -----------------------LLHHHHH-HHHHHL-LLLLEElLLLLllllllllLLL
Query -----------------------VSVATMK-ATLQLS-RAPVIFsHSSAysvcasrrNVP  233
ident                                                             
Sbjct midpmleagldgaifgfgvetgmHLLRLITiGIFDKYpSLQIMV-GHMG--------EAL  247
DSSP  llhhhhhhlllllllhhhhhhhhHHHHHHHhLHHHHLlLLLEEE-LHHH--------HLH


DSSP  H---------------------------HHHHHHHHHlLEEEELLLhhhhlllllllhhh
Query D---------------------------DVLRLVKQTdSLVMVNFYnnyisctnkanlsq  266
ident                                   |    ||                   
Sbjct PywlyrldymhqagvrsqryermkplkkTIEGYLKSN-VLVTNSGV-------------a  293
DSSP  HhhhhhhhhhhhhhhhllllllllllllLHHHHHHHL-EEEELLLL-------------l


DSSP  HHHHHHHHHHHLLHHHEEELLLLLLLllllllllLLLL-HHHHHHHhhhlLLLHHHHHHH
Query VADHLDHIKEVAGARAVGFGGDFDGVprvpegleDVSK-YPDLIAEllrrNWTEAEVKGA  325
ident           | |   |    |             |        |            |  
Sbjct WEPAIKFCQQVMGEDRVMYAMDYPYQ--------YVADeVRAMDAM----DMSAQTKKKF  341
DSSP  LHHHHHHHHHHHLHHHEELLLLLLLL--------LLHHhHHHHHLL----LLLHHHHHHH


DSSP  HLHHHHHHHHhhhhllllllllllllllhhhlllllllllllll
Query LADNLLRVFEaveqasnltqapeeepipldqlggscrthygyss  369
ident    |    |                                   
Sbjct FQTNAEKWFK---------------------------------l  352
DSSP  HLHHHHHHLL---------------------------------l


No 7: Query=1itqA Sbjct=4b3zD Z-score=15.6

back to top
DSSP  ---------------------------------------lhhhhhhhhhhLLLLEEEEEE
Query ---------------------------------------dffrdeaerimRDSPVIDGHN   21
ident                                                        ||   
Sbjct drllikggriinddqslyadvyledglikqigenlivpggvktieangrmVIPGGIDVNT   60
DSSP  leeeeeeeeeelllleeeeeeeeelleeeeeellllllllleeeelllleEEELEEEEEE


DSSP  LHHHhhhhhhllllllhhhllllLLLL---LLLHhHHHHLLEEEEEEEELLLhhhllllH
Query DLPWqlldmfnnrlqderanlttLAGT---HTNIpKLRAGFVGGQFWSVYTPcdtqnkdA   78
ident  |                      |              |        |           
Sbjct YLQK-------------------TAADdffQGTR-AALVGGTTMIIDHVVPE-------P   93
DSSP  LLLL-------------------LLLLlhhHHHH-HHHHLLEEEEEEEELLL-------L


DSSP  HHHHHHHHHHHHHHHHHLllleeelllhhhhhhhhhllLEEEEEEEElHHHLL-lLHHHH
Query VRRTLEQMDVVHRMCRMYpetflyvtssagirqafregKVASLIGVEgGHSID-sSLGVL  137
ident     |      |                                 |    |        |
Sbjct GSSLLTSFEKWHEAADTK-------------------sCCDYSLHVD-ITSWYdgVREEL  133
DSSP  LLLHHHHHHHHHHHHHLL-------------------lLLEEEEEEE-LLLLLllHHHHH


DSSP  HHHHH-LLEEEEELLLLL----LLLLlllhhhlllllllllllllHHHHHHHHHHHHHLL
Query RALYQ-LGMRYLTLTHSC----NTPWadnwlvdtgdsepqsqglsPFGQRVVKELNRLGV  192
ident   | |  |                                              |  || 
Sbjct EVLVQdKGVNSFQVYMAYkdvyQMSD-------------------SQLYEAFTFLKGLGA  174
DSSP  HHHHHlLLLLEEEEELLLllllLLLH-------------------HHHHHHHHHHHHHLL


DSSP  EEELLL-----------------------------------LLHHHHHHHHHHlLLLLEE
Query LIDLAH-----------------------------------VSVATMKATLQLsRAPVIF  217
ident  |                                                      ||  
Sbjct VILVHAengdliaqeqkrilemgitgpeghalsrpeeleaeAVFRAITIAGRI-NCPVYI  233
DSSP  EEEEELllhhhhhhhhhhhhhllllllhhhhhhllhhhhhhHHHHHHHHHHHH-LLLEEE


DSSP  LLLLLLLlllllllLLHHHHHHH-hHHLLEEEELLLhhhHLLLLL---------------
Query SHSSAYSvcasrrnVPDDVLRLV-kQTDSLVMVNFYnnyISCTNK---------------  261
ident       |         |                         |                 
Sbjct TKVMSKS-------AADIIALARkkGPLVFGEPIAAslgTDGTHYwsknwakaaafvtsp  286
DSSP  EEELLHH-------HHHHHHHHHhhLLLEEEEELHHhhhLLLHHHhlllhhhhhhlllll


DSSP  ---llhhHHHHHHHHHHHHLlhhHEEELLLLL-----------------lLLLLlllllL
Query ---anlsQVADHLDHIKEVAgarAVGFGGDFD-----------------gVPRVpegleD  301
ident                            |                                
Sbjct plspdptTPDYLTSLLACGD---LQVTGSGHCpystaqkavgkdnftlipEGVN-----G  338
DSSP  lllllllHHHHHHHHHHHLL---LLLLLLLLLlllhhhhhhhlllhhhllLLLL-----L


DSSP  LLL-HHHHHHHHHHLL-LLHHHHHHHHLHHHHHHH-------------------------
Query VSK-YPDLIAELLRRN-WTEAEVKGALADNLLRVF-------------------------  334
ident                    |         |    |                         
Sbjct IEErMTVVWDKAVATGkMDENQFVAVTSTNAAKIFnlyprkgriavgsdadvviwdpdkl  398
DSSP  LLLhHHHHHHHHLLLLlLLHHHHHHHHLHHHHHHHlllllllllllllllleeeeeeeee


DSSP  ----------------------------------------------------------HH
Query ----------------------------------------------------------EA  336
ident                                                           | 
Sbjct ktitakshksaveynifegmechgsplvvisqgkivfedgninvnkgmgrfiprkafpEH  458
DSSP  eelllllllllllllllllleeeeeeeeeeelleeeeelleellllllllllllllllHH


DSSP  HHHLLLlllllllllllhhhlllllllllllll
Query VEQASNltqapeeepipldqlggscrthygyss  369
ident   |                              
Sbjct LYQRVK--------------irnkvfglqgvsr  477
DSSP  HHHHHH--------------hhhhhllllllll


No 8: Query=1itqA Sbjct=4hk5D Z-score=15.6

back to top
DSSP  lhhhhhhhhhhlLLLEEEEEELHhHHHHHHHL----------------------------
Query dffrdeaerimrDSPVIDGHNDLpWQLLDMFN----------------------------   32
ident                | | |                                        
Sbjct ------------TPVVVDIHTHM-YPPSYIAMlekrqtiplvrtfpqadeprlillssel   47
DSSP  ------------LLLLEEEEEEE-LLHHHHHHhhlllllleeeeelleeeeeeellhhhh


DSSP  ------lllllhhhllllLLLL----lLLHHHHHHLLEEEEEEEEL--LLHHHLLLLHHH
Query ------nrlqderanlttLAGT----hTNIPKLRAGFVGGQFWSVY--TPCDTQNKDAVR   80
ident                   |                        |             |  
Sbjct aaldaaladpaaklpgrpLSTHfaslaQKMHFMDTNGIRVSVISLAnpWFDFLAPDEAPG  107
DSSP  hhhhhhhhlllllllleeLLHHhllhhHHHHHHHHLLLLEEEEEELllLLLLLLLLLHHH


DSSP  HHHHHHHHHHHHHHhlllLEEElllhhhhhhhhhllleEEEEEEElhHHLL----LLHHH
Query RTLEQMDVVHRMCRmypeTFLYvtssagirqafregkvASLIGVEggHSID----SSLGV  136
ident            ||                                               
Sbjct IADAVNAEFSDMCA----QHVG----------------RLFFFAA--LPLSapvdAVKAS  145
DSSP  HHHHHHHHHHHHHH----LLLL----------------LEEEEEE--LLLLllhhHHHHH


DSSP  HHHHHHLL-EEEEELlLLLLLLLLLlhhhllllllllllLLLHhHHHHHHHHHHHLLEEE
Query LRALYQLG-MRYLTLtHSCNTPWADnwlvdtgdsepqsqGLSPfGQRVVKELNRLGVLID  195
ident       |   |   |                                |         |  
Sbjct IERVKNLKyCRGIIL-GTSGLGKGL--------------DDPH-LLPVFEAVADAKLLVF  189
DSSP  HHHHHLLLlEEEEEE-LLLLLLLLL--------------LLHH-HHHHHHHHHHLLLEEE


DSSP  LLL--------------------------------LLHHHH-hHHHHHL-LLLLEElLLL
Query LAH--------------------------------VSVATM-kATLQLS-RAPVIFsHSS  221
ident |                                                          |
Sbjct LHPhyglpnevygprseeyghvlplalgfpmettiAVARMYmaGVFDHVrNLQMLL-AHS  248
DSSP  ELLlllllhhhhlllhhhlllhhhhhlhhhhhhhhHHHHHHhlLHHHHLlLLLEEE-HHH


DSSP  LllllllllLLLH---------------------------HHHHHHHHHlLEEEELllhh
Query AysvcasrrNVPD---------------------------DVLRLVKQTdSLVMVNfynn  254
ident                                               |             
Sbjct G--------GTLPflagriescivhdghlvktgkvpkdrrTIWTVLKEQ-IYLDAV----  295
DSSP  H--------LLHHhhhhhhhhhhhllhhhhhlllllllllLHHHHHHHL-EEEELL----


DSSP  hhlllllllhhhHHHHHHHHHHHLLHHHEEELLLLLlLLLL-----lLLLLlllLHHHHH
Query yisctnkanlsqVADHLDHIKEVAGARAVGFGGDFDgVPRV-----pEGLEdvsKYPDLI  309
ident                 |       ||    || |                          
Sbjct ----------iySEVGLQAAIASSGADRLMFGTDHP-FFPPieedvqGPWD---SSRLNA  341
DSSP  ----------llLHHHHHHHHHHHLHHHEELLLLLL-LLLLllllllLLLH---HHHHHH


DSSP  HHHHhLLLL--HHHHHHHHLHHHHHHHHhhhhllllllllllllllhhhlllllllllll
Query AELLrRNWT--EAEVKGALADNLLRVFEaveqasnltqapeeepipldqlggscrthygy  367
ident                      |  ||                                  
Sbjct QAVI-KAVGegSSDAAAVMGLNAVRVLS----------------------lkaelehhhh  378
DSSP  HHHH-HHHLllLHHHHHHHLHHHHHHLL----------------------lhhhhhhhhh


DSSP  ll
Query ss  369
ident   
Sbjct hh  380
DSSP  hl


No 9: Query=1itqA Sbjct=3irsA Z-score=15.6

back to top
DSSP  lhhhhhhhhhhllLLEEEEEELHhhHHHH--------------------hhllllllhHH
Query dffrdeaerimrdSPVIDGHNDLpwQLLD--------------------mfnnrlqdeRA   40
ident                 ||                                          
Sbjct -------------LKIIDFRLRP--PAMGflnariytrpdirnrftrqlgfepapsaeEK   45
DSSP  -------------LLLEELLLLL--LLHHhhhlhhhhlhhhhhhhhhhhlllllhhhhHL


DSSP  LLLLllllllLHHHHHHLLEEEEEEEELLLHHHLlllhhhHHHHHHHHHHHHHhhlllle
Query NLTTlagthtNIPKLRAGFVGGQFWSVYTPCDTQnkdavrRTLEQMDVVHRMCrmypetf  100
ident  |              |                              |            
Sbjct SLEL------MFEEMAAAGIEQGVCVGRNSSVLG----svSNADVAAVAKAYP-------   88
DSSP  LHHH------HHHHHHHLLLLEEEEELLEELLLE----elLHHHHHHHHHHLL-------


DSSP  eelllhhhhhhhhhlllEEEEEEEElhhHLLL----LHHHHHHHHHLLEEEEELLLLLL-
Query lyvtssagirqafregkVASLIGVEgghSIDS----SLGVLRALYQLGMRYLTLTHSCN-  155
ident                                               || |   |      
Sbjct -----------------DKFHPVGS---IEAAtrkeAMAQMQEILDLGIRIVNLEPGVWa  128
DSSP  -----------------LLEEEEEE---LLLLlhhhHHHHHHHHHHLLLLLEEELHHHLl


DSSP  -LLLLllhhhlllllllllllLLHHHHHHHHHHHHHLLEEELLL----------lLHHHH
Query -TPWAdnwlvdtgdsepqsqgLSPFGQRVVKELNRLGVLIDLAH----------vSVATM  204
ident                                     |                       
Sbjct tPMHV----------------DDRRLYPLYAFCEDNGIPVIMMTggnagpditytNPEHI  172
DSSP  lLLLL----------------LLHHHHHHHHHHHHLLLLEEEELlllllllhhhhLHHHH


DSSP  HHHHHHL-LLLLEELLLlllllllllLLLL-HHHHHHHHHHL-LEEEELLLhhHHLLlll
Query KATLQLS-RAPVIFSHSsaysvcasrRNVP-DDVLRLVKQTD-SLVMVNFYnnYISCtnk  261
ident    |       |  ||                                  |         
Sbjct DRVLGDFpDLTVVSSHG---------NWPWvQEIIHVAFRRPnLYLSPDMY--LYNL---  218
DSSP  HHHHHHLlLLLEEEEHH---------HLLLhHHHHHHHHHLLlEEEELHHH--HLLL---


DSSP  llhhhhHHHHHHHHHHLLHHHEEELLLLLLLllllllllLLLL-HHHHHHHHhhllLLHH
Query anlsqvADHLDHIKEVAGARAVGFGGDFDGVprvpegleDVSK-YPDLIAELlrrnWTEA  320
ident                   |    ||                                   
Sbjct ----pgHADFIQAANSFLADRMLFGTAYPMC--------PLKEyTEWFLTLP----IKPD  262
DSSP  ----llHHHHHHHHLLHHHHLLLLLLLLLLL--------LHHHhHHHHHLLL----LLHH


DSSP  HHHHHHLHHHHHHHHHHHHllllllllllllllhhhlllllllllllll
Query EVKGALADNLLRVFEAVEQasnltqapeeepipldqlggscrthygyss  369
ident      |  |  |                                     
Sbjct AMEKILHGNAERLLAQAGR------------------------------  281
DSSP  HHHHHHLHHHHHHHHHLLL------------------------------


No 10: Query=1itqA Sbjct=4dziC Z-score=15.5

back to top
DSSP  lhhhhhhHHHHlllLEEEEEELHhhHHHH-------------------------------
Query dffrdeaERIMrdsPVIDGHNDLpwQLLD-------------------------------   29
ident                |||  |                                       
Sbjct -------ALNY---RVIDVDNHY--YEPLdsftrhldkkfkrrgvqmlsdgkrtwavigd   48
DSSP  -------LLLL---LEEEEEEEL--LLLLllllllllhhhlllleeeeelllleeeeell


DSSP  ------hhLLLL--------------------------llHHHLllLLLLL---llLHHH
Query ------mfNNRL--------------------------qdERANltTLAGT---htNIPK   54
ident                                         ||               |  
Sbjct rvnhfipnPTFDpiivpgcldllfrgeipdgvdpaslmkvERLA--DHPEYqnrdaRIAV  106
DSSP  eellllllLLLLleelllllhhhhhllllllllhhhllleELHH--HLHHHllhhhHHHH


DSSP  HHHLLEEEEEEEE--LLLHH--------hLLLLHHHHHHHHHHHHHhhhhhllllEEELl
Query LRAGFVGGQFWSV--YTPCD--------tQNKDAVRRTLEQMDVVHrmcrmypetFLYVt  104
ident          |                            |                     
Sbjct MDEQDIETAFMLPtfGCGVEealkhdieaTMASVHAFNLWLDEDWG-------fdRPDH-  158
DSSP  HHHHLEEEEEEELlhHHHHHhhllllhhhHHHHHHHHHHHHHHHLL-------llLLLL-


DSSP  lhhhhhhhhhllleEEEEEEelhhHLLL-----LHHHHHHHHHLLEEEEELLLlLLLLLl
Query ssagirqafregkvASLIGVegghSIDS-----SLGVLRALYQLGMRYLTLTHsCNTPWa  159
ident                                             |            |  
Sbjct --------------RIIAAP----IVSLadptrAVEEVDFVLARGAKLVLVRP-APVPG-  198
DSSP  --------------LEEELL----LLLLllhhhHHHHHHHHHHLLLLLEELLL-LLLLL-


DSSP  llhhhlllllllLLLLLLHHHHHHHHHHHHHLLEEELLL---------------------
Query dnwlvdtgdsepQSQGLSPFGQRVVKELNRLGVLIDLAH---------------------  198
ident                        |   |   ||                           
Sbjct ---------lvkPRSLGDRSHDPVWARLAEAGVPVGFHLsdsgylhiaaawggakdpldq  249
DSSP  ---------lllLLLLLLHHHHHHHHHHHHHLLLEEEELlllllhhhhhhllllllhhhh


DSSP  ---------lLHHHHH--HHHHHL-LLLLEELLLLLLllllllllLLHHH----------
Query ---------vSVATMK--ATLQLS-RAPVIFSHSSAYsvcasrrnVPDDV----------  236
ident             | |                     |                       
Sbjct vllddraihdTMASMIvhGVFTRHpKLKAVSIENGSY--------FVHRLikrlkkaant  301
DSSP  hhhllhhhhhHHHHHHhlLHHHHLlLLLEEEELLLLL--------HHHHHhhhhhhhhhh


DSSP  ---------hHHHHHHlLEEEELllhhhhlllllllhhhHHHHHHHHHHHLLHHHEEELL
Query ---------lRLVKQTdSLVMVNfynnyisctnkanlsqVADHLDHIKEVAGARAVGFGG  287
ident                                          | |     | |     || 
Sbjct qpqyfpedpvEQLRNN-VWIAPY----------------YEDDLPELARVIGVDKILFGS  344
DSSP  lhhhllllhhHHHHHH-EEELLL----------------LLLLHHHHHHHHLHHHLLLLL


DSSP  LLLlLLLLlllLLLLllhHHHHHHHHhlLLLHHHHHHHHLHHHHHHHHHhhhllllllll
Query DFDgVPRVpegLEDVskyPDLIAELLrrNWTEAEVKGALADNLLRVFEAveqasnltqap  347
ident |          |          |||      |        || |                
Sbjct DWP-HGEG---LASP---VSFTAELK--GFSESDIRKIMRDNALDLLGV-----------  384
DSSP  LLL-LLLL---LLLH---HHHHHHHL--LLLHHHHHHHHLHHHHHHHLL-----------


DSSP  llllllhhhlllllllllllll
Query eeepipldqlggscrthygyss  369
ident                       
Sbjct ------------------qvgs  388
DSSP  ------------------llll


No 11: Query=1itqA Sbjct=2ffiA Z-score=15.5

back to top
DSSP  lhhhhhhhhhhlLLLEEEEEELHHhhhHHHHLlllllhhhlllllllllLLHHHHHHLLE
Query dffrdeaerimrDSPVIDGHNDLPwqlLDMFNnrlqderanlttlagthTNIPKLRAGFV   60
ident                 || |           |                      |||   
Sbjct -----------lHLTAIDSHAHVF---SRGLN-lasqrryapnydaplgDYLGQLRAHGF   45
DSSP  -----------lLLLLEELLLLLL---LHHHH-hhllllllllllllhhHHHHHHHHLLL


DSSP  EEEEEEELLLhhhllllhhhHHHHhHHHHHHHHHhllllEEELllhhhhhhhhhllleEE
Query GGQFWSVYTPcdtqnkdavrRTLEqMDVVHRMCRmypetFLYVtssagirqafregkvAS  120
ident                                                             
Sbjct SHGVLVQPSF----------LGTD-NRYLLSALQ-----TVPG---------------QL   74
DSSP  LEELLLLLHH----------HLLL-LHHHHHHHH-----HLLL---------------LL


DSSP  EEEEElhhHLLLLH-HHHHHHHHLLEEEEELLLL-LLLLLLllhhhlllllllllllLLH
Query LIGVEgghSIDSSL-GVLRALYQLGMRYLTLTHS-CNTPWAdnwlvdtgdsepqsqgLSP  178
ident    |             |     || |   |       |                     
Sbjct RGVVX---LERDVEqATLAEXARLGVRGVRLNLXgQDXPDL----------------TGA  115
DSSP  LLLLL---LLLLLLhHHHHHHHLLLLLEEELLLLlLLLLLL----------------LLL


DSSP  HHHHHHHHHHHHLLEEELLL---lLHHHHHHHHhHLLLLLEElLLLLlLLLL--lllllL
Query FGQRVVKELNRLGVLIDLAH---vSVATMKATLqLSRAPVIFsHSSAySVCA--srrnvP  233
ident             |    |            |                             
Sbjct QWRPLLERIGEQGWHVELHRqvadIPVLVRALQ-PYGLDIVI-DHFGrPDARrglgqpgF  173
DSSP  LLHHHHHHHHHHLLEEEELLllllHHHHHHHHL-LLLLLEEE-LHHHlLLLLlllllllH


DSSP  HHHHHHhHHHLLEEEELLLHhHHLLLLLLLHHHHHHHHHHHHHHLLHHHEEELLLLLLLL
Query DDVLRLvKQTDSLVMVNFYNnYISCTNKANLSQVADHLDHIKEVAGARAVGFGGDFDGVP  293
ident    | |       | |             ||      |       ||     | |     
Sbjct AELLTLsGRGKVWVKVSGIY-RLQGSPEENLAFARQALCALEAHYGAERLXWGSDWPHTQ  232
DSSP  HHHLLLlLLLLEEEEEELHH-HLLLLHHHHHHHHHHHHHHHHHHLLHHHEEEELLLLLLL


DSSP  LlllllLLLLLHHHHHHHHHhllLLHHHHHHHHLHHHHHHHHhhhhllllllllllllll
Query RvpeglEDVSKYPDLIAELLrrnWTEAEVKGALADNLLRVFEaveqasnltqapeeepip  353
ident                   |             | |     |                   
Sbjct H--eseVSFGSAVEQFEALG---CSAQLRQALLLDTARALFG------------------  269
DSSP  L--lllLLHHHHHHHHHHHL---LLHHHHHHHHLHHHHHHLL------------------


DSSP  hhhlllllllllllll
Query ldqlggscrthygyss  369
ident                 
Sbjct ------------fele  273
DSSP  ------------llll


No 12: Query=1itqA Sbjct=1yrrB Z-score=15.4

back to top
DSSP  --------------------------------------lhhhhhhhhhhLLLLEEEEEEL
Query --------------------------------------dffrdeaerimRDSPVIDGHND   22
ident                                                       ||    
Sbjct yaltqgriftgheflddhavviadgliksvcpvaelppeieqrslngaiLSPGFIDVQLN   60
DSSP  leeelleeelllleelleeeeeelleeeeeeehhhlllllleeelllleEEELEEEEEEL


DSSP  -----HHHHhhHHHLLllllhhhlllllllllLLHHHHHHLLEEEEEEEELLLhhhllll
Query -----LPWQllDMFNNrlqderanlttlagthTNIPKLRAGFVGGQFWSVYTPcdtqnkd   77
ident                                                    |        
Sbjct gcggvQFND--TAEAV----------svetleIMQKANEKSGCTNYLPTLITT-------  101
DSSP  eelleELLL--LLLLL----------lhhhhhHHHHHHHLLLEEEEEEEELLL-------


DSSP  HHHHHHHHHHHHHHHHHHLLlleeelllhhhhhhhhhllLEEEEEEEELHHhlLLLHHHH
Query AVRRTLEQMDVVHRMCRMYPetflyvtssagirqafregKVASLIGVEGGHsiDSSLGVL  137
ident           |        |                     |     ||          |
Sbjct SDELMKQGVRVMREYLAKHP-------------------NQALGLHLEGPWlnAALVDFL  142
DSSP  LHHHHHHHHHHHHHHHHHLL-------------------LLLLLEEEELLLllLHHHHHH


DSSP  HHHHhLLEEEEELLllllllllllhhhllllllllllLLLHhhHHHHHHHHHHLLEEELL
Query RALYqLGMRYLTLThscntpwadnwlvdtgdsepqsqGLSPfgQRVVKELNRLGVLIDLA  197
ident            ||                           |    |   |   |      
Sbjct CENA-DVITKVTLA----------------------pEMVP--AEVISKLANAGIVVSAG  177
DSSP  HHLH-HHEEEEEEL----------------------hHHLL--HHHHHHHHHHLLEEEEL


DSSP  LLLH--HHHHHHHHHLlllLEELLLLlllllllLLLL---------LHHHHHHHhhhLLE
Query HVSV--ATMKATLQLSrapVIFSHSSaysvcasRRNV---------PDDVLRLVkqtDSL  246
ident |        ||            |                          |      |  
Sbjct HSNAtlKEAKAGFRAG--iTFATHLY-------NAMPyitgrepglAGAILDEA---DIY  225
DSSP  LLLLlhHHHHHHHHHL--eEEELLLL-------LLLLlllllllhhHHHHHHLL---LLE


DSSP  EEELllHHHHlllllllhhhHHHHHHHHHHHLLhHHEEELLLLLllLLLLlllllllLHH
Query VMVNfyNNYIsctnkanlsqVADHLDHIKEVAGaRAVGFGGDFDgvPRVPegledvsKYP  306
ident                             |   |        |                  
Sbjct CGIIadGLHV----------DYANIRNAKRLKG-DKLCLVTDAT--SGSS------lTMI  266
DSSP  EEEEllLLLL----------LHHHHHHHHHHHH-HHEEEELLLL--LLLL------lLHH


DSSP  HHHHHHHHL-LLLHHHHHHHHLHHHHHHHH----hhhhllllllllllllllhhhlllll
Query DLIAELLRR-NWTEAEVKGALADNLLRVFE----aveqasnltqapeeepipldqlggsc  361
ident      |         ||         |                                 
Sbjct EGVRNLVEHcGIALDEVLRMATLYPARAIGvekrlgtlaagkvanltaftpdfkitktiv  326
DSSP  HHHHHHHHHhLLLHHHHHHHHLHHHHHHLLllllllllllllllleeeellllleeeeee


DSSP  llllllll
Query rthygyss  369
ident         
Sbjct ngnevvtq  334
DSSP  lleeeeel


No 13: Query=1itqA Sbjct=2vc5A Z-score=15.3

back to top
DSSP  --lhhhhhhhhhhlllLEEEEEELHHHH-----hhhhhlLLLLlhHHLLllllllllLHH
Query --dffrdeaerimrdsPVIDGHNDLPWQ-----lldmfnNRLQdeRANLttlagthtNIP   53
ident                      |  |                                   
Sbjct mriplvgkdsieskdiGFTLIHEHLRVFseavrqqwphlYNED--EEFR----navnEVK   54
DSSP  llllllllllllhhhlLLEELLLLLLLLlhhhhhhlhhhLLHH--HHHH----hhhhHHH


DSSP  HHHHLLEEEEEEEELLLhhhllllhhhhhhhHHHHHHHHHhhlLLLEeelllhhhhhhhh
Query KLRAGFVGGQFWSVYTPcdtqnkdavrrtleQMDVVHRMCrmyPETFlyvtssagirqaf  113
ident       |                                      |              
Sbjct RAMQFGVKTIVDPTVMG-----------lgrDIRFMEKVV---KATG-------------   87
DSSP  HHHHLLLLEEEELLLLL-----------lllLHHHHHHHH---HLLL-------------


DSSP  hlllEEEEEEEELHH-----------hllLLHHHHHHHHH-------LLEEEEELLllll
Query regkVASLIGVEGGH-----------sidSSLGVLRALYQ-------LGMRYLTLThscn  155
ident          |                                                  
Sbjct ----INLVAGTGIYIyidlpfyflnrsidEIADLFIHDIKegiqgtlNKAGFVXIA----  139
DSSP  ----LEEEELEELLLlllllhhhllllhhHHHHHHHHHHHlllllllLLLLLEEEE----


DSSP  lllllLHHHLllllllLLLLLLhhHHHHHHHHHHHLLEEELLL-----LLHHHHHHHHHH
Query tpwadNWLVDtgdsepQSQGLSpfGQRVVKELNRLGVLIDLAH-----VSVATMKATLQL  210
ident                                     | |                     
Sbjct -----ADEPG-----iTKDVEK-vIRAAAIANKETKVPIITHSnahnnTGLEQQRILTEE  188
DSSP  -----LLLLL-----lLHHHHH-hHHHHHHHHHHHLLLEEEELlllllHHHHHHHHHHHL


DSSP  -LLLL-LEELLLL-LLLLlllllllLHHHHHHHhhhlLEEEELL--LHHHHLllllllHH
Query -SRAP-VIFSHSS-AYSVcasrrnvPDDVLRLVkqtdSLVMVNF--YNNYISctnkanLS  265
ident           |                          |                      
Sbjct gVDPGkILIGHLGdTDNI-----dyIKKIADKG----SFIGLDRygLDLFLP------VD  233
DSSP  lLLHHhEEELLHHhLLLH-----hhHHHHHHLL----LEEEELLllLLLLLL------HH


DSSP  HHHHHHHHHHHHlLHHHEEELLLLL------------lllLLLLllLLLLLHH-HHHHHH
Query QVADHLDHIKEVaGARAVGFGGDFD------------gvpRVPEglEDVSKYP-DLIAEL  312
ident                       |                   |           | |  |
Sbjct KRNETTLRLIKDgYSDKIMISHDYCctidwgtakpeykpkLAPR--WSITLIFeDTIPFL  291
DSSP  HHHHHHHHHHHLlLLLLEEELLLLLlllllllllhhhhhhHLLL--LLLLHHHhLHHHHH


DSSP  HHLLLLHHHHHHHHLHHHHHHHHhhhhllllllllllllllhhhlllllllllllll
Query LRRNWTEAEVKGALADNLLRVFEaveqasnltqapeeepipldqlggscrthygyss  369
ident  |    |         |    |                                   
Sbjct KRNGVNEEVIATIFKENPKKFFS----------------------------------  314
DSSP  HLLLLLHHHHHHHHLHHHHHHLL----------------------------------


No 14: Query=1itqA Sbjct=2qpxA Z-score=15.3

back to top
DSSP  --lHHHHHHHHhhllLLEEEEEELhHHHHhhhhlllLLLHH-------------------
Query --dFFRDEAERimrdSPVIDGHNDlPWQLldmfnnrLQDER-------------------   39
ident                 |  | |                                      
Sbjct gxdDLSEFVDQ----VPLLDHHCH-FLID-------GKVPNrddrlaqvsteadkdypla   48
DSSP  lllLLHHHHHH----LLEEEEEEL-LLLL-------LLLLLhhhhhhhhlllllllllhh


DSSP  --------------------------------hLLLLllllllLHHHHHHLLEEEEEEEE
Query --------------------------------aNLTTlagthtNIPKLRAGFVGGQFWSV   67
ident                                    |       |                
Sbjct dtknrlayhgflalakefaldannplaaxndpgYATY------NHRIFGHFHFKELLIDT  102
DSSP  hhlllhhhhhhhhhhhhhllllllllllllhhhHHHH------HHHHHHHLLEEEEEEEL


DSSP  LLLhhhllllhhhhhhhhhhHHHHHHhhlLLLEeelllhhhhhhhhhlllEEEEEEEElH
Query YTPcdtqnkdavrrtleqmdVVHRMCrmyPETFlyvtssagirqafregkVASLIGVEgG  127
ident                                                             
Sbjct GFV------------pddpiLDLDQT--aELVG-----------------IPVKAIYR-L  130
DSSP  LLL------------lllllLLHHHH--hHHHL-----------------LLEEEEEE-H


DSSP  HHLL---------------lLHHHHHHHHHLLEEEEELL-LLLL-------------lll
Query HSID---------------sSLGVLRALYQLGMRYLTLT-HSCN-------------tpw  158
ident                                |                            
Sbjct ETHAedfxlehdnfaawwqaFSNDVKQAKAHGFVGFXSIaAYRVglhlepvnvieaaagf  190
DSSP  HHHHhhhhlllllhhhhhhhHHHHHHLLLLLLLLLEEELhHHHLllllllllhhhhhhhh


DSSP  lllhhhlllllLLLLlllLHHHHHHHHHHHHHLLEEELLL------------lLHHHhHH
Query adnwlvdtgdsEPQSqglSPFGQRVVKELNRLGVLIDLAH------------vSVATmKA  206
ident                         |                                   
Sbjct dtwkhsgekrlTSKP-liDYXLYHVAPFIIAQDXPLQFHVgygdadtdxylgnPLLX-RD  248
DSSP  hhhhhhlllllLLHH-hhHHHHHHHHHHHHHHLLLEEEEEllllllllhhhllHHHH-HH


DSSP  HHHHL---LLLLEElLLLLLlllllllLLLHhHHHHHHH-HLLEEEEL--LLHHhhllll
Query TLQLS---RAPVIFsHSSAYsvcasrrNVPDdVLRLVKQ-TDSLVMVN--FYNNyisctn  260
ident  |         |                       |                        
Sbjct YLKAFtkkGLKVVL-LHCYP-------YHRE-AGYLASVfPNLYFDISllDNLG------  293
DSSP  HHHHHhhhLLLEEE-EELLL-------LHHH-HHHHHHHlLLEEEELLlhHHHL------


DSSP  lllHHHHHHHHHHHHHHLLHHHEEELLLLLlllllllllLLLLL-HHHHHHHHHHLL---
Query kanLSQVADHLDHIKEVAGARAVGFGGDFDgvprvpeglEDVSK-YPDLIAELLRRN---  316
ident     |          | |      |  |           |            |       
Sbjct ---PSGASRVFNEAVELAPYTRILFASDAS------typEXYGLaARQFKQALVAHFnql  344
DSSP  ---HHHHHHHHHHHLLLLLHHHEELLLLLL------llhHHHHHhHHHHHHHHHHHHhll


DSSP  ------lLHHHHHHHHLHHHHHHHHhhhhllllllllllllllhhhlllllllllllll
Query ------wTEAEVKGALADNLLRVFEaveqasnltqapeeepipldqlggscrthygyss  369
ident          |                                                 
Sbjct pfvdlaqKKAWINAICWQTSAKLYH---------------------------qerelrv  376
DSSP  llllhhhHHHHHHHHHLHHHHHHLL---------------------------lhhhhll


No 15: Query=1itqA Sbjct=4ofcA Z-score=15.2

back to top
DSSP  lhhhhhhhhhhlllLEEEEEELHHhhhhHHHL------------lLLLL---HHHL----
Query dffrdeaerimrdsPVIDGHNDLPwqllDMFN------------nRLQD---ERAN----   41
ident                 || |                          ||      |     
Sbjct --------------MKIDIHSHIL----PKEWpdlkkrfgyggwvQLQHhskGEAKllkd   42
DSSP  --------------LLEEEEEELL----LLLLllhhhhhllllleEEEEeelLEEEeeel


DSSP  ---lllLLLL----lLLHHHHHHLLEEEEEEEE---LLLHHHLLLLHHHHHHHHHHHHHH
Query ---lttLAGT----hTNIPKLRAGFVGGQFWSV---YTPCDTQNKDAVRRTLEQMDVVHR   91
ident                  |       |  |  |             |              
Sbjct gkvfrvVRENcwdpeVRIREMDQKGVTVQALSTvpvMFSYWAKPEDTLNLCQLLNNDLAS  102
DSSP  leeeeeEEHHhllhhHHHHHHHHHLLLEEEEELlhhHHLLLLLHHHHHHHHHHHHHHHHH


DSSP  HHHhllllEEELllhhhhhhhhhllleEEEEEEElhhHLLLL---HHHHHHHHH-LLEEE
Query MCRmypetFLYVtssagirqafregkvASLIGVEgghSIDSS---LGVLRALYQ-LGMRY  147
ident                                                        ||   
Sbjct TVV-----SYPR---------------RFVGLGT--lPMQAPelaVKEMERCVKeLGFPG  140
DSSP  HHH-----HLLL---------------LEEEEEL--lLLLLHhhhHHHHHHHHHlLLLLE


DSSP  EELLLlLLLLLLLlhhhlllllllllllLLHHHHHHHHHHHHHLLEEELLL---------
Query LTLTHsCNTPWADnwlvdtgdsepqsqgLSPFGQRVVKELNRLGVLIDLAH---------  198
ident           |                        |     ||                 
Sbjct VQIGT-HVNEWDL---------------NAQELFPVYAAAERLKCSLFVHPwdmqmdgrm  184
DSSP  EEEEL-EELLEEL---------------LLHHHHHHHHHHHHHLLEEEEELllllllhhh


DSSP  ----------------lLHHHHH--HHHHHL-LLLLEElLLLLllllllllLLLH-----
Query ----------------vSVATMK--ATLQLS-RAPVIFsHSSAysvcasrrNVPD-----  234
ident                      |             | |                      
Sbjct akywlpwlvgmpaettiAICSMImgGVFEKFpKLKVCF-AHGG--------GAFPftvgr  235
DSSP  hlllhhhhlhhhhhhhhHHHHHHllLHHHHLlLLLEEE-LHHH--------LLHHhhhhh


DSSP  ------------------hhhhHHHHhlLEEEELLlhhhhlllllllhhHHHHHHHHHHH
Query ------------------dvlrLVKQtdSLVMVNFynnyisctnkanlsQVADHLDHIKE  276
ident                                                       |     
Sbjct ishgfsmrpdlcaqdnpmnpkkYLGS--FYTDALV--------------HDPLSLKLLTD  279
DSSP  hhhhhhhlhhhhlllllllhhhHLLL--LEEELLL--------------LLHHHHHHHHH


DSSP  HLLHHHEEELLLLLlLLLLllllllllLHHHHHHHHhhLLLLHHHHHHHHLHHHHHHHHh
Query VAGARAVGFGGDFDgVPRVpegledvsKYPDLIAELlrRNWTEAEVKGALADNLLRVFEa  336
ident | |   |  | |    |              ||         |       | | |     
Sbjct VIGKDKVILGTDYP-FPLG------elEPGKLIESM--EEFDEETKNKLKAGNALAFLG-  329
DSSP  HHLLLLEELLLLLL-LLLL------llLLLHHHHHL--LLLLHHHHHHHHLHHHHHHHL-


DSSP  hhhllllllllllllllhhhlllllllllllll
Query veqasnltqapeeepipldqlggscrthygyss  369
ident                                  
Sbjct ---------------------------lerkqf  335
DSSP  ---------------------------llhhhl


No 16: Query=1itqA Sbjct=1gkpA Z-score=15.1

back to top
DSSP  --------------------------------------lhhhhhhhhhhlLLLEEEEEEL
Query --------------------------------------dffrdeaerimrDSPVIDGHND   22
ident                                                       || |  
Sbjct pllikngeiitadsrykadiyaegetitrigqnleappgtevidatgkyvFPGFIDPHVH   60
DSSP  leeeelleeeelleeeeleeeelllllleeellllllllleeeelllleeEELEEEEEEL


DSSP  HHHhhHHHHLLllllhhhllllllllllLHHHHHHLLEEEEEEEELLLhhhllllHHHHH
Query LPWqlLDMFNNrlqderanlttlagthtNIPKLRAGFVGGQFWSVYTPcdtqnkdAVRRT   82
ident        |                           |                        
Sbjct IYL--PFMATF----------akdthetGSKAALMGGTTTYIEMCCPS-------RNDDA  101
DSSP  LLL--EELLEE----------llllhhhHHHHHHHLLEEEEEEEELLL-------LLLLH


DSSP  HHHHHHHHHHHHhLLLLeeelllhhhhhhhhhlllEEEEEEEElHHHLL-lLHHHHHHHH
Query LEQMDVVHRMCRmYPETflyvtssagirqafregkVASLIGVEgGHSID-sSLGVLRALY  141
ident ||                                              |    | ||   
Sbjct LEGYQLWKSKAE-GNSY------------------CDYTFHMA-VSKFDekTEGQLREIV  141
DSSP  HHHHHHHHHHHL-LLLL------------------LEEEEEEE-LLLLLllHHHHHHHHH


DSSP  HLLEEEEELLLLL----LLLLlllhhhlllllllllllllHHHHHHHHHHHHHLLEEELL
Query QLGMRYLTLTHSC----NTPWadnwlvdtgdsepqsqglsPFGQRVVKELNRLGVLIDLA  197
ident   |        |                                        |||     
Sbjct ADGISSFXIFLSYknffGVDD-------------------GEMYQTLRLAKELGVIVTAH  182
DSSP  HLLLLEEEEEELLllllLLLH-------------------HHHHHHHHHHHHHLLEEEEE


DSSP  LL----------------------------------LHHHHHHHHHHLLLLLEELLLLLL
Query HV----------------------------------SVATMKATLQLSRAPVIFSHSSAY  223
ident                                       |     |    |     | |  
Sbjct CEnaelvgrlqqkllsegktgpewhepsrpeaveaeGTARFATFLETTGATGYVVHLSCK  242
DSSP  ELlhhhhhhhhhhhhhlllllhhhllllllhhhhhhHHHHHHHHHHHHLLEEEELLLLLH


DSSP  LlllllllLLHHHHHHHH-HHLLEEEELLLhhhHLLLLL----------------llhhH
Query SvcasrrnVPDDVLRLVK-QTDSLVMVNFYnnyISCTNK----------------anlsQ  266
ident           |                         |                       
Sbjct P-------ALDAAMAAKArGVPIYIESVIPhflLDKTYAerggveamkyimspplrdkrN  295
DSSP  H-------HHHHHHHHHHlLLLEEEEEEHHhhhLLHHHHhllhhhhhlllllllllllhH


DSSP  HHHHHHHHHHhllHHHEEELLLLL-----------------lLLLLlllllLLLL-HHHH
Query VADHLDHIKEvagARAVGFGGDFD-----------------gVPRVpegleDVSK-YPDL  308
ident      |             | |                                     |
Sbjct QKVLWDALAQ---GFIDTVGTDHCpfdteqkllgkeaftaipNGIP-----AIEDrVNLL  347
DSSP  HHHHHHHHHL---LLLLEEELLLLlllhhhhhhhlllhhhllLLLL-----LLLLhHHHH


DSSP  HHHHH-HLLLLHHHHHHHHLHHHHHHHH--------------------------------
Query IAELL-RRNWTEAEVKGALADNLLRVFE--------------------------------  335
ident       |          |        |                                 
Sbjct YTYGVsRGRLDIHRFVDAASTKAAKLFGlfprkgtiavgsdadlvvydpqyrgtisvktq  407
DSSP  HHHHLlLLLLLHHHHHHHHLHHHHHHLLllllllllllllllleeeeelllleellhhhl


DSSP  ---------------------------------------------hhHHLLlllllllll
Query ---------------------------------------------avEQASnltqapeee  350
ident                                                             
Sbjct hvnndyngfegfeidgrpsvvtvrgkvavrdgqfvgekgwgkllrrePMYF---------  458
DSSP  lllllllllllleelleeeeeeelleeeeelleelllllllllllllLLLL---------


DSSP  lllhhhlllllllllllll
Query pipldqlggscrthygyss  369
ident                    
Sbjct -------------------  458
DSSP  -------------------


No 17: Query=1itqA Sbjct=1onxA Z-score=15.0

back to top
DSSP  ------------------------------------------------lhhhhhhhhhhL
Query ------------------------------------------------dffrdeaerimR   12
ident                                                             
Sbjct midytaagftllqgahlyapedrgicdvlvangkiiavasnipsdivpnctvvdlsgqiL   60
DSSP  llllhhhlleeeeeeeeellleeeeeeeeeelleeeeeellllllllllleeeelllleE


DSSP  LLLEEEEEELHHHHhhhhhllllllhhhlllllllllLLHHHHHHLLEEEEEEEELLLHH
Query DSPVIDGHNDLPWQlldmfnnrlqderanlttlagthTNIPKLRAGFVGGQFWSVYTPCD   72
ident     || |  |                               |    |        |   
Sbjct CPGFIDQHVHLIGG-----------ggeagpttrtpeVALSRLTEAGVTSVVGLLGTDSI  109
DSSP  EELEEEEEELLLLL-----------lllllhhhllllLLHHHHHHLLEEEEEELLLLLLL


DSSP  HllllhhhHHHHHHHHHHHHHhhlLLLEeelllhhhhhhhhhllleEEEEEE-ELHHHLL
Query TqnkdavrRTLEQMDVVHRMCrmyPETFlyvtssagirqafregkvASLIGV-EGGHSID  131
ident                          |                                  
Sbjct S------rHPESLLAKTRALN---EEGI------------------SAWMLTgAYHVPSR  142
DSSP  L------lLHHHHHHHHHHHH---HHLL------------------EEEEEEeLLLLLLL


DSSP  llhHHHHHHH--HLLEEEEELL---lLLLLLLlllhhhllllllllllllLHHHHHHHHH
Query sslGVLRALY--QLGMRYLTLT---hSCNTPWadnwlvdtgdsepqsqglSPFGQRVVKE  186
ident    |                          |                            |
Sbjct titGSVEKDVaiIDRVIGVXCAisdhRSAAPD------------------VYHLANMAAE  184
DSSP  lllLLHHHHHhhLLLEEEEEEEelllLLLLLL------------------HHHHHHHHHH


DSSP  HHHHL------LEEELLL----lLHHHHHHHH--HHLL-LLLEElLLLLLllLLLLlllL
Query LNRLG------VLIDLAH----vSVATMKATL--QLSR-APVIFsHSSAYsvCASRrnvP  233
ident     |                          |                            
Sbjct SRVGGllggkpGVTVFHMgdskkALQPIYDLLenCDVPiSKLLP-THVNR--NVPL---F  238
DSSP  HHHHHhhhlllLEEEEEElllllLLHHHHHHHhlLLLLhHHEEE-ELHHH--LHHH---H


DSSP  HHHHHHHHHHlLEEEELLLhhHHLLlllllhhHHHHHHHHHHHH-LLHHHEEELLLLLLL
Query DDVLRLVKQTdSLVMVNFYnnYISCtnkanlsQVADHLDHIKEV-AGARAVGFGGDFDGV  292
ident    |                              |               |    |  | 
Sbjct EQALEFARKG-GTIDITSS--IDEP------vAPAEGIARAVQAgIPLARVTLSSDGNGS  289
DSSP  HHHHHHHHLL-LLEEEELL--LLLL------lLHHHHHHHHHHLlLLHHHEEEELLLLLE


DSSP  LL--------llllllLLLLHHHHHHHHHH-LLLLHHHHHHHHLHHHHHHHH--------
Query PR--------vpegleDVSKYPDLIAELLR-RNWTEAEVKGALADNLLRVFE--------  335
ident                            |              |                 
Sbjct QPffddegnlthigvaGFETLLETVQVLVKdYDFSISDALRPLTSSVAGFLNltgkgeil  349
DSSP  EEeellllleeeeeelLLHHHHHHHHHHHHhHLLLHHHHHHHHLHHHHHHLLllllllll


DSSP  -------hhhhllllllllllllllhhhlllllllllllll
Query -------aveqasnltqapeeepipldqlggscrthygyss  369
ident                                          
Sbjct pgndadllvmtpelrieqvyargklmvkdgkacvkgtfetd  390
DSSP  lllllleeeellllleeeeeelleeeeelleelllllllll


No 18: Query=1itqA Sbjct=3cjpA Z-score=14.9

back to top
DSSP  lhhhhhhhhhhlllLEEEEEELHHhhhhhhhllllllhhhLLLLllllllLHHHHHHLLE
Query dffrdeaerimrdsPVIDGHNDLPwqlldmfnnrlqderaNLTTlagthtNIPKLRAGFV   60
ident                 ||||                               |       |
Sbjct --------------LIIDGHTHVI---------------lPVEK------HIKIMDEAGV   25
DSSP  --------------LLEEEEEELL---------------lLHHH------HHHHHHHHLL


DSSP  EEEEEEELL-----------------------lHHHLLllHHHHHHHHHHHHHHHHHhll
Query GGQFWSVYT-----------------------pCDTQNkdAVRRTLEQMDVVHRMCRmyp   97
ident                                    |                        
Sbjct DKTILFSTSihpetavnlrdvkkemkklndvvnGKTNS--MIDVRRNSIKELTNVIQ---   80
DSSP  LEEEEELLLllhhhlllhhhhhhhhhhhhhhhlLLLLL--LHHHHHHHHHHHHHHHH---


DSSP  lLEEElllhhhhhhhhhllleEEEEEEELHH--hllLLHHHHHHH-HHLLEEEEELLLll
Query eTFLYvtssagirqafregkvASLIGVEGGH--sidSSLGVLRAL-YQLGMRYLTLTHsc  154
ident                                                             
Sbjct -AYPS----------------RYVGFGNVPVglsenDTNSYIEENiVNNKLVGIGELT--  121
DSSP  -HLLL----------------LEEEEELLLLlllhhHHHHHHHHHlLLLLLLEEEEEL--


DSSP  llllllLHHHlllllllllLLLLhhHHHHHHHHHHH-LLEEELLL------lLHHHHHHH
Query ntpwadNWLVdtgdsepqsQGLSpfGQRVVKELNRL-GVLIDLAH------vSVATMKAT  207
ident                    |  |       |         |                   
Sbjct ------PASG---------QIKS--LKPIFKYSMDSgSLPIWIHAfnplvlqDIKEIAEL  164
DSSP  ------LLLL---------LHHH--HHHHHHHHHHLlLLLEEELLlllllhhHHHHHHHH


DSSP  HHHL-LLLLEELlLLLLLlllllllLLHHHHHHHHHHL-LEEEELLlhhhhlllllllhh
Query LQLS-RAPVIFShSSAYSvcasrrnVPDDVLRLVKQTD-SLVMVNFynnyisctnkanls  265
ident        |||       |              | |                         
Sbjct CKAFpKVPVILG-HMGGS-------NWMTAVELAKEIQnLYLDTSA-------------y  203
DSSP  HHHLlLLLEEEH-HHHHH-------HHHHHHHHHHHLLlEEEELLL-------------l


DSSP  HHHHHHHHHHHHlLHHHEEELLLLLLLllllllllLLLLHHHHHHHHHhllLLHHHHHHH
Query QVADHLDHIKEVaGARAVGFGGDFDGVprvpegleDVSKYPDLIAELLrrnWTEAEVKGA  325
ident      |             || |            |       |                
Sbjct FSTFVLKIVINE-LPLKCIFGTDMPFG--------DLQLSIEAIKKMS---NDSYVANAV  251
DSSP  LLHHHHHHHHHH-LLLLEELLLLLLLL--------LHHHHHHHHHHHL---LLHHHHHHH


DSSP  HLHHHHHHHHhhhhllllllllllllllhhhlllllllllllll
Query LADNLLRVFEaveqasnltqapeeepipldqlggscrthygyss  369
ident | ||  |                                     
Sbjct LGDNISRLLN---------------------------------i  262
DSSP  HLHHHHHHHL---------------------------------l


No 19: Query=1itqA Sbjct=3pnuA Z-score=14.9

back to top
DSSP  -lhhhhhhhHHHLllLEEEEEELHHhhhhhhhllllllhhHLLLLllllllLHHHHHHlL
Query -dffrdeaeRIMRdsPVIDGHNDLPwqlldmfnnrlqderANLTTlagthtNIPKLRAgF   59
ident                   | |  |                  |          |      
Sbjct enlyfqsnaMKLK--NPLDMHLHLR-------------dnQMLEL------IAPLSAR-D   38
DSSP  lllllllllEEEE--LLEEEEELLL-------------lhHHHHH------HHHHHHL-L


DSSP  EEEEEEEELLLhhhllllhhhHHHHHHHHHHHH-HHHLLLLeeelllhhhhhhhhhllLE
Query VGGQFWSVYTPcdtqnkdavrRTLEQMDVVHRM-CRMYPETflyvtssagirqafregKV  118
ident                        ||                                   
Sbjct FCAAVIMPNLI-------pplCNLEDLKAYKMRiLKACKDE-----------------NF   74
DSSP  LLEEEELLLLL-------lllLLHHHHHHHHHHhHHHHLLL-----------------LL


DSSP  EEEEEEELHhhlLLLHHHHHHHHHlLEEEEElLLLL--------LLLLLllhhhllllll
Query ASLIGVEGGhsiDSSLGVLRALYQlGMRYLTlTHSC--------NTPWAdnwlvdtgdse  170
ident   |               |                                         
Sbjct TPLMTLFFK---NYDEKFLYSAKD-EIFGIX-LYPAgittnsngGVSSF-----------  118
DSSP  EEEEEEELL---LLLHHHHHHHLL-LLLEEE-ELLLllllllllLLLLL-----------


DSSP  lllllLLHHHHHHHHHHHHHLLEEELLLL-----------LHHHHHHHHHHL-LLLLEEL
Query pqsqgLSPFGQRVVKELNRLGVLIDLAHV-----------SVATMKATLQLS-RAPVIFS  218
ident                    |                                 |      
Sbjct -----DIEYLKPTLEAMSDLNIPLLVHGEtndfvmdresnFAKIYEKLAKHFpRLKIVME  173
DSSP  -----LHHHHHHHHHHHHHLLLLEEELLLllllhhhllhhHHHHHHHHHHHLlLLLEEEL


DSSP  lLLLLLllllllLLLHhHHHHhhHHLLEEEELLLhhhHLLLLLL---------------l
Query hSSAYSvcasrrNVPDdVLRLvkQTDSLVMVNFYnnyISCTNKA---------------n  263
ident                   |                  |                      
Sbjct -HITTK------TLCE-LLKD--YENLYATITLH-hlIITLDDViggkmnphlfckpiak  222
DSSP  -LLLLH------HHHH-HHHH--LLLEEEEELLH-hhLLLHHHHhlllllhhhlllllll


DSSP  hhhhhHHHHHHHhhllHHHEEELLLLL-----lLLLLllllLLLLLHHHHHHHHHHLLLL
Query lsqvaDHLDHIKevagARAVGFGGDFD-----gVPRVpeglEDVSKYPDLIAELLRRNWT  318
ident        |           | || |           |              |||   |  
Sbjct ryedkEALCELA-fsgYEKVMFGSDSAphpkgcAAGV----FSAPVILPVLAELFKQNSS  277
DSSP  lhhhhHHHHHHH-hllLLLEEELLLLLllllllLLLL----LLHHHHHHHHHHHHHHHLL


DSSP  HHHHHHHHLHHHHHHHH----------hhhhllllllllllllllhhhllllllllllll
Query EAEVKGALADNLLRVFE----------aveqasnltqapeeepipldqlggscrthygys  368
ident |      | ||                                                 
Sbjct EENLQKFLSDNTCKIYDlkfkedkiltleekewqvpnvyedkynqvvpymageilkfqlk  337
DSSP  HHHHHHHHLHHHHHHHLllllllleeeeellleelllleelllleellllllleelleel


DSSP  l
Query s  369
ident  
Sbjct h  338
DSSP  l


No 20: Query=1itqA Sbjct=1bf6A Z-score=14.8

back to top
DSSP  lhhhhhhhhhhllLLEEEEEELHHhHHHH-----HHLLllllhhhLLLLllllllLHHHH
Query dffrdeaerimrdSPVIDGHNDLPwQLLD-----MFNNrlqderaNLTTlagthtNIPKL   55
ident                    |  |    |                                
Sbjct ---------sfdpTGYTLAHEHLH-IDLSgfknnVDCR-----ldQYAF------ICQEM   39
DSSP  ---------llllLLEEEEEELLL-EELHhhhllHHHE-----elLHHH------HHHHH


DSSP  HHL---LEEEEEEEELllhhhllllhhhhHHHHHhhHHHHHHHL-LLLEeelllhhhhhh
Query RAG---FVGGQFWSVYtpcdtqnkdavrrTLEQMdvVHRMCRMY-PETFlyvtssagirq  111
ident        |                                      ||            
Sbjct NDLmtrGVRNVIEMTN-------------RYMGR--NAQFMLDVmRETG-----------   73
DSSP  HHHhhlLEEEEEELLL-------------HHHLL--LHHHHHHHhHHHL-----------


DSSP  hhhlllEEEEEEEELHH-----------hllLLHHHHHHHHHL-------LEEEE-ELLL
Query afregkVASLIGVEGGH-----------sidSSLGVLRALYQL-------GMRYL-TLTH  152
ident                                                             
Sbjct ------INVVACTGYYQdaffpehvatrsvqELAQEMVDEIEQgidgtelKAGIIaEIGT  127
DSSP  ------LEEEEEELLLLhhhlllhhhhllhhHHHHHHHHHHHLlllllllLEEEEeEEEL


DSSP  LL--lLLLLllhhhllllllllllllLHHHHHHHHHHHHHLLEEELLL----LLHHHHHH
Query SC--nTPWAdnwlvdtgdsepqsqglSPFGQRVVKELNRLGVLIDLAH----VSVATMKA  206
ident |    ||                              |  |  |                
Sbjct SEgkiTPLE-----------------EKVFIAAALAHNQTGRPISTHTsfstMGLEQLAL  170
DSSP  LLlllLHHH-----------------HHHHHHHHHHHHHHLLLEEEELhhhlLHHHHHHH


DSSP  HHH-HLLL-LLEELLLLlllLLLLlllLLHHHHHHHhhhlLEEEEL-LLHHhhlllLLLL
Query TLQ-LSRA-PVIFSHSSaysVCASrrnVPDDVLRLVkqtdSLVMVN-FYNNyisctNKAN  263
ident           |   |                   |       |       |         
Sbjct LQAhGVDLsRVTVGHCD--lKDNL--dNILKMIDLG----AYVQFDtIGKN-----SYYP  217
DSSP  HHHlLLLHhHEEELLLL--lLLLH--hHHHHHHHLL----LEEEELlLLLL-----LLLL


DSSP  HHHHHHHHHHHHHHLLHHHEEELLLLL-lllllllllLLLLLHH-HHHHHHHHLLLLHHH
Query LSQVADHLDHIKEVAGARAVGFGGDFD-gvprvpeglEDVSKYP-DLIAELLRRNWTEAE  321
ident        |           |    |                      |  |       | 
Sbjct DEKRIAMLHALRDRGLLNRVMLSMDITrrshlkanggYGYDYLLtTFIPQLRQSGFSQAD  277
DSSP  HHHHHHHHHHHHHLLLHHHEEELLLLLlhhhlhhhllLLLLHHHhLHHHHHHHLLLLHHH


DSSP  HHHHHLHHHHHHHHhhhhllllllllllllllhhhlllllllllllll
Query VKGALADNLLRVFEaveqasnltqapeeepipldqlggscrthygyss  369
ident |   |  |    |                                   
Sbjct VDVMLRENPSQFFQ----------------------------------  291
DSSP  HHHHHLHHHHHHLL----------------------------------


No 21: Query=1itqA Sbjct=3k2gB Z-score=14.8

back to top
DSSP  -------------lhhhhhhhhhhlllLEEEEEELHHH----------------------
Query -------------dffrdeaerimrdsPVIDGHNDLPW----------------------   25
ident                                 |  |                        
Sbjct slselspchvrsgrixtvdgpipssalGHTLXHEHLQNdcrcwwnppqeperqylaeapi   60
DSSP  llllllllllllleeeelleeeehhhlLLEELLLLLLEelhhhllllllhhhhhhhhlll


DSSP  -------------------HHHHhhllllllhhHLLLlllllllLHHHHHHLLEEEEEEE
Query -------------------QLLDmfnnrlqderANLTtlagthtNIPKLRAGFVGGQFWS   66
ident                     | |                           |         
Sbjct sieilselrqdpfvnkhniALDD---------lDLAI------aEVKQFAAVGGRSIVDP  105
DSSP  lhhhhhhhhllhhhlllllEELL---------hHHHH------hHHHHHHHLLLLEEEEL


DSSP  ELLLHhhllllhhhhhhhHHHHHHHHHhhlLLLEeelllhhhhhhhhhlllEEEEEeEEL
Query VYTPCdtqnkdavrrtleQMDVVHRMCrmyPETFlyvtssagirqafregkVASLIgVEG  126
ident                         |      ||                  |       |
Sbjct TCRGI-----------grDPVKLRRIS---AETG-----------------VQVVX-GAG  133
DSSP  LLLLL-----------llLHHHHHHHH---HHHL-----------------LEEEE-LLL


DSSP  HH------------hllLLHHHHHHHHH-------LLEEE-EELLlllllllllLHHHll
Query GH------------sidSSLGVLRALYQ-------LGMRY-LTLThscntpwadNWLVdt  166
ident                         |                                   
Sbjct YYlassxpetaarlsadDIADEIVAEALegtdgtdARIGLiGEIG---------VSSD--  182
DSSP  LLlhhhllhhhhlllhhHHHHHHHHHHHlllllllLLLLLeEEEL---------LLLL--


DSSP  llllLLLLLLLhhHHHHHHHHHHHLLEEELLL-----lLHHHHHHHHHH-LLLL-LEELl
Query gdsePQSQGLSpfGQRVVKELNRLGVLIDLAH-----vSVATMKATLQL-SRAP-VIFSh  219
ident                       | |                                   
Sbjct ----FTAEEEK-sLRGAARAQVRTGLPLXVHLpgwfrlAHRVLDLVEEEgADLRhTVLC-  236
DSSP  ----LLHHHHH-hHHHHHHHHHHHLLLEEELLllllllHHHHHHHHHHLlLLHHhEEEL-


DSSP  LLLLLLLLllllllHHHHHHHHHHlLEEEELL--LHHH--hllLLLLLHHHHHHHHHHHH
Query SSAYSVCAsrrnvpDDVLRLVKQTdSLVMVNF--YNNY--iscTNKANLSQVADHLDHIK  275
ident     |              |                               ||       
Sbjct HXNPSHXD-----pVYQATLAQRG-AFLEFDXigXDFFyadqgVQCPSDDEVARAILGLA  290
DSSP  LLHHHLLL-----hHHHHHHHHHL-LEEEELLllLLLEellllEELLLHHHHHHHHHHHH


DSSP  HHLLHHHEEELLLLlLLLLL--llllLLLLL-HHHHHHHHHHLLLLHHHHHHHHLHHHHH
Query EVAGARAVGFGGDFdGVPRV--peglEDVSK-YPDLIAELLRRNWTEAEVKGALADNLLR  332
ident             |   |                      | |     |        |  |
Sbjct DHGYLDRILLSHDV-FVKXXltryggNGYAFvTKHFLPRLRRHGLDDAALETLXVTNPRR  349
DSSP  HLLLHHHEEELLLL-LLHHHlhhhllLLLLHhHHLHHHHHHHLLLLHHHHHHHHLHHHHH


DSSP  HHHHhhhllllllllllllllhhhlllllllllllll
Query VFEAveqasnltqapeeepipldqlggscrthygyss  369
ident || |                                 
Sbjct VFDA----------------------------siegh  358
DSSP  HHLL----------------------------lllll


No 22: Query=1itqA Sbjct=4mupB Z-score=14.8

back to top
DSSP  ---lhhhhhhHHHHlLLLEEEEEELHHhhhhhhHLLLlllhhhllllLLLL--lLLHHHH
Query ---dffrdeaERIMrDSPVIDGHNDLPwqlldmFNNRlqderanlttLAGT--hTNIPKL   55
ident                     |                           |           
Sbjct lvrklsgtapNPAF-PRGAVDTQMHMY-----lPGYPalpggpglppGALPgpeDYRRLM   54
DSSP  llllllllllLLLL-LLLLEELLLLLL-----lLLLLllllllllllLLLLlhhHHHHHH


DSSP  HHLLEEEEEEEELLLhhhllllhhhHHHHHHHHHHHhhhhllllEEELllhhhhhhhhhl
Query RAGFVGGQFWSVYTPcdtqnkdavrRTLEQMDVVHRmcrmypetFLYVtssagirqafre  115
ident                                  |                          
Sbjct QWLGIDRVIITQGNA-------hqrDNGNTLACVAE--------MGEA------------   87
DSSP  HHHLLLEEEEELLHH-------hllLLHHHHHHHHH--------HHHH------------


DSSP  lleeEEEEEelhhHLLLLHH--HHHHHHHLLEEEEELLLLL----LLLLlllhhhlllll
Query gkvaSLIGVegghSIDSSLG--VLRALYQLGMRYLTLTHSC----NTPWadnwlvdtgds  169
ident         |     ||          |   |              |              
Sbjct ----AHAVV----IIDATTTekDMEKLTAAGTVGARIMDLPggavNLSE-----------  128
DSSP  ----EEEEE----LLLLLLLhhHHHHHHHLLEEEEEEELLLllllLHHH-----------


DSSP  llllllllhhHHHHHHHHHHHLLEEELLL---lLHHHhHHHHHHLLLLLEElLLLLllLL
Query epqsqglspfGQRVVKELNRLGVLIDLAH---vSVATmKATLQLSRAPVIFsHSSAysVC  226
ident              |                           ||  |    |         
Sbjct ----------LDAVDERAHAADWMVAVQFdgngLLDH-LPRLQKIRSRWVF-DHHG-kFF  175
DSSP  ----------HHHHHHHHHHLLLEEEEELlhhhHHHH-HHHHHLLLLEEEE-LHHH-hLL


DSSP  LL---llllLHHHHHHHHHHLLEEEELLLHhHHLLLlLLLHHHHHHHHHHHHHHlLHHHE
Query AS---rrnvPDDVLRLVKQTDSLVMVNFYNnYISCTnKANLSQVADHLDHIKEVaGARAV  283
ident              | |                 |         ||     |         
Sbjct KGirtdgpeMAALLKLIDRGNLWFKFAGVY-ESSRK-SWPYADVAAFSRVIAAH-APERI  232
DSSP  LLlllllhhHHHHHHHHHHLLEEEEELLHH-HLLLL-LLLLHHHHHHHHHHHHH-LHHHE


DSSP  EELLLLLLLLL-lllllLLLLL-HHHHHHHHhhllLLHHHHHHHHLHHHHHHHHhhhhll
Query GFGGDFDGVPR-vpeglEDVSK-YPDLIAELlrrnWTEAEVKGALADNLLRVFEaveqas  341
ident   |               |           |      ||    ||  |    |       
Sbjct VWGTNWPHNSVretaayPDDARlAELTLGWL----PDEAARHRALVENPEALFK------  282
DSSP  EELLLLLLLLLllhhhlLLHHHhHHHHHLLL----LLHHHHHHHHLHHHHHHHL------


DSSP  llllllllllllhhhlllllllllllll
Query nltqapeeepipldqlggscrthygyss  369
ident                             
Sbjct ------------------------lspv  286
DSSP  ------------------------llll


No 23: Query=1itqA Sbjct=2vunA Z-score=14.6

back to top
DSSP  ----------------------------------------------lhhhhhhhhhhLLL
Query ----------------------------------------------dffrdeaerimRDS   14
ident                                                             
Sbjct sktiiknigkivsgdikspvlqadtivvedgliaaiggeelmkdagdatiidaagstVTP   60
DSSP  leeeeellleeellllllleellleeeeelleeeeeelhhhhlllllleeeelllleEEE


DSSP  LEEEEEELhHHHHhhhhllllllhhhllllLLLLlLLHHhHHHLLEEEEEEEELLL--hH
Query PVIDGHNDlPWQLldmfnnrlqderanlttLAGThTNIPkLRAGFVGGQFWSVYTP--cD   72
ident    | |                                     | |              
Sbjct GLLDTHVH-VSGG-----------dyaprqKTMD-FISS-ALHGGVTTMISAGSPHfpgR  106
DSSP  LEEEEEEL-LLLL-----------leehhhLEEL-HHHH-HHLLLEEEEEELLLLLlllL


DSSP  HLL-lLHHHHHHHHHHHHHHHHhhlllleeelllhhhhhhhhhllLEEEEEeEELHHhlL
Query TQN-kDAVRRTLEQMDVVHRMCrmypetflyvtssagirqafregKVASLIgVEGGHsiD  131
ident                                               |             
Sbjct PKDaaGTKALAITLSKSYYNAR---------------------paGVKVHGgAVILE-kG  144
DSSP  LLLhhHHHHHHHHHHHHHHHLL---------------------hhHLEEELlEELLL-lL


DSSP  LLHHHHHHHHHLLEEEE-ELLLlllLLLLllhhhllllllllllLLLHhHHHHHHHHHHH
Query SSLGVLRALYQLGMRYL-TLTHscnTPWAdnwlvdtgdsepqsqGLSPfGQRVVKELNRL  190
ident             |                                        |      
Sbjct LTEEDFIEMKKEGVWIVgEVGL---GTIK---------------NPED-AAPMVEWAHKH  185
DSSP  LLHHHHHHHHHLLLLEEeEELL---LLLL---------------LHHH-HHHHHHHHHHL


DSSP  LLEEELLL----------LLHHHHHHHHhhllllLEELLLL----LLLLLllllllLHHH
Query GVLIDLAH----------VSVATMKATLqlsrapVIFSHSS----AYSVCasrrnvPDDV  236
ident |                 |       |          ||      | ||        |  
Sbjct GFKVQMHTggtsipgsstVTADDVIKTK-----pDVVSHINggptAISVQ-----eVDRI  235
DSSP  LLEEEEELllllllllllLLHHHHHHHL-----lLEEELLLllllLLLHH-----hHHHH


DSSP  HHHhhhHLLEEEELLLhhhhlllllllhhhHHHHHHHHHHHL----LHHHEEELLLLLlL
Query LRLvkqTDSLVMVNFYnnyisctnkanlsqVADHLDHIKEVA----GARAVGFGGDFDgV  292
ident       ||                           |     |        | || |    
Sbjct MDE---TDFAMEIVQC-------------gNPKIADYVARRAaekgQLGRVIFGNDAP-S  278
DSSP  HHH---LLLEEEEELL-------------lLHHHHHHHHHHHhhhlLHHHEEEELLLL-L


DSSP  LLLllllLLLLLHHHHHHHHHHL-LLLHHHHHHHHLHHHHHHHH----------------
Query PRVpeglEDVSKYPDLIAELLRR-NWTEAEVKGALADNLLRVFE----------------  335
ident                                      |   |                  
Sbjct GTG----LIPLGILRNMCQIASMsDIDPEVAVCMATGNSTAVYGlntgviapgkeadlii  334
DSSP  LLL----LLLLHHHHHHHHHHHHlLLLHHHHHHHHLHHHHHHHLllllllllllllleee


DSSP  -----------------hhhhllllllllllllllhhhlllllllllllll
Query -----------------aveqasnltqapeeepipldqlggscrthygyss  369
ident                                                    
Sbjct mdtplgsvaedamgaiaagdipgisvvlidgeavvtksrntppakraakil  385
DSSP  eelllllllllhhhhhhhlllleeeeeeelleeeellllllllllllleel


No 24: Query=1itqA Sbjct=2y1hB Z-score=14.6

back to top
DSSP  lhhhhhhhhhhlLLLEEEEEELHHHHHhhhhllllllhhHLLLLllllllLHHHHHHLLE
Query dffrdeaerimrDSPVIDGHNDLPWQLldmfnnrlqderANLTTlagthtNIPKLRAGFV   60
ident                  | |  |                  |           |     |
Sbjct ------------GVGLVDCHCHLSAPD----------fdRDLDD------VLEKAKKANV   32
DSSP  ------------LLLEEEEEELLLLHH----------hlLLHHH------HHHHHHHLLE


DSSP  EEEEEEELLlhhhllllhHHHHHHHHHHHHHhhhhllllEEELllhhhhhhhhhllleeE
Query GGQFWSVYTpcdtqnkdaVRRTLEQMDVVHRmcrmypetFLYVtssagirqafregkvaS  120
ident                          |    |                             
Sbjct VALVAVAEH---------SGEFEKIMQLSER--------YNGF----------------V   59
DSSP  EEEEELLLL---------HHHHHHHHHHHHH--------LLLL----------------E


DSSP  EEEEELH------------hhLLLLHHHHHHHHHlLEEE-EELLlllllllllLHHHlLL
Query LIGVEGG------------hsIDSSLGVLRALYQlGMRY-LTLThscntpwadNWLVdTG  167
ident |                     |  |                                  
Sbjct LPCLGVHpvqgldqrsvtlkdLDVALPIIENYKD-RLLAiGEVG---------LDFS-PR  108
DSSP  EEEELLLleelllleellhhhHHHHHHHHHHHLL-LLLEeEEEE---------EELL-LL


DSSP  LLL---LLLLllLHHHHHHHHHHHHHLLEEELLLLL--HHHHHHHHHHLLLLLEElLLLL
Query DSE---PQSQglSPFGQRVVKELNRLGVLIDLAHVS--VATMKATLQLSRAPVIFsHSSA  222
ident                  |      ||         |    |           |   |   
Sbjct FAGtgeQKEE-qRQVLIRQIQLAKRLNLPVNVHSRSagRPTINLLQEQGAEKVLL-HAFD  166
DSSP  LLLlhhHHHH-hHHHHHHHHHHHHHHLLLEEEEEELlhHHHHHHHHHLLLLLEEE-ELLL


DSSP  lllllllllLLHHHHHHHHHHLLEEEELLL-HHHHlllllllhhhHHHHHHHHHhhllHH
Query ysvcasrrnVPDDVLRLVKQTDSLVMVNFY-NNYIsctnkanlsqVADHLDHIKevagAR  281
ident              |                                              
Sbjct ---------GRPSVAMEGVRAGYFFSIPPSiIRSG---------qKQKLVKQLP----LT  204
DSSP  ---------LLHHHHHHHHHLLLEEEELHHhHLLH---------hHHHHHHHLL----HH


DSSP  HEEELLLLLLLllLLLL--llLLLLHHHHHHHHHH-LLLL-HHHHHHHhLHHHHHHHHhh
Query AVGFGGDFDGVprVPEG--leDVSKYPDLIAELLR-RNWT-EAEVKGAlADNLLRVFEav  337
ident       |       ||                         |         | |  |   
Sbjct SICLETDSPAL--GPEKqvrnEPWNISISAEYIAQvKGISvEEVIEVT-TQNALKLFP--  259
DSSP  HEEELLLLLLL--LLLLllllLHHHHHHHHHHHHHhHLLLhHHHHHHH-HHHHHHHLL--


DSSP  hhllllllllllllllhhhlllllllllllll
Query eqasnltqapeeepipldqlggscrthygyss  369
ident                                 
Sbjct --------------------------klrhll  265
DSSP  --------------------------lhhhhl


No 25: Query=1itqA Sbjct=3giqA Z-score=14.0

back to top
DSSP  ------------------------------------------lhhhhhhhhhhLLLLEEE
Query ------------------------------------------dffrdeaerimRDSPVID   18
ident                                                           ||
Sbjct ekldfkitggwiidgtgaprrradlgvrdgriaaigelgahparhawdasgkiVAPGFID   60
DSSP  lleeeeeelleelllllllleeleeeeelleeeeeelllllleeeeeelllleEEELEEE


DSSP  EEELHHHHhhhhhllllllhhHLLLlllllllLHHHHHHLLEEEEEEE---ELLL-----
Query GHNDLPWQlldmfnnrlqderANLTtlagthtNIPKLRAGFVGGQFWS---VYTP-----   70
ident  |                                                 |        
Sbjct VHGHDDLM------------fVEKP-------DLRWKTSQGITTVVVGncgVSAApaplp  101
DSSP  LLLLLLLH------------hHHLL-------LLHHHHLLLEEEEEELlllLLLLlllll


DSSP  hHHLL---llhhhhhhHHHHHHHHHHHHLLlleeelllhhhhhhhhhllLEEEEEEEElH
Query cDTQN---kdavrrtlEQMDVVHRMCRMYPetflyvtssagirqafregKVASLIGVEgG  127
ident   |                                                     |   
Sbjct gNTAAalallgetplfADVPAYFAALDAQR------------------pMINVAALVG-H  142
DSSP  lLLLHhhhhhllllllLLHHHHHHHHHHLL------------------lLLEEEEEEE-H


DSSP  HHLL-----------------lLHHHHHHHHHLLEEEEELLL-LLLLLLLllhhhlllll
Query HSID-----------------sSLGVLRALYQLGMRYLTLTH-SCNTPWAdnwlvdtgds  169
ident                           | |    |               |          
Sbjct ANLRlaamrdpqaaptaaeqqaMQDMLQAALEAGAVGFSTGLaYQPGAVA----------  192
DSSP  HHHHhhhlllllllllhhhhhhHHHHHHHHHHHLLLEEEEELlLLLHHHL----------


DSSP  llllllLLHHHHHHHHHHHHHLLEEELlLLLH------HHHHHHHHHL---LLLLEELlL
Query epqsqgLSPFGQRVVKELNRLGVLIDLaHVSV------ATMKATLQLS---RAPVIFShS  220
ident                        |    |         |     |            |  
Sbjct ------QAAELEGLARVAAERRRLHTS-HIRNeadgveAAVEEVLAIGrgtGCATVVS-H  244
DSSP  ------LHHHHHHHHHHHHHLLLEEEE-ELLLllllhhHHHHHHHHHHhhhLLEEEEL-L


DSSP  LLL----LLLLlllllLHHHHHHHHHHL-----LEEEELLLHHH----------------
Query SAY----SVCAsrrnvPDDVLRLVKQTD-----SLVMVNFYNNY----------------  255
ident                     |                   |                   
Sbjct HKCmmpqNWGR-----SRATLANIDRAReqgveVALDIYPYPGSstiliperaetiddir  299
DSSP  LLLllhhHLLL-----HHHHHHHHHHHHhllllEEEEELLLLEEeeellhhhllllllle


DSSP  -----------------------------------hllLLLLlhhHHHHHHHHHHhhllH
Query -----------------------------------iscTNKAnlsQVADHLDHIKevagA  280
ident                                          |                  
Sbjct itwstphpecsgeyladiaarwgcdkttaarrlapagaIYFA--mDEDEVKRIFQ----H  353
DSSP  eeeelllhhhllllhhhhhhhhlllhhhhhhhhlleeeEEEL--lLHHHHHHHHH----L


DSSP  HHEEELLLLL--llLLLLllllLLLL-HHHHHHHHH-HLLL-LHHHHHHHHLHHHHHHHH
Query RAVGFGGDFD--gvPRVPegleDVSK-YPDLIAELL-RRNW-TEAEVKGALADNLLRVFE  335
ident      | |         |                        |             ||| 
Sbjct PCCMVGSDGLpndaRPHP----RLWGsFTRVLGRYVrEARLmTLEQAVARMTALPARVFG  409
DSSP  LLEEELLLLLllllLLLL----HHHHhHHHHHHHHHhHLLLlLHHHHHHHHLHHHHHHHL


DSSP  --------------------------------hhhhllllllllllllllhhhlllllll
Query --------------------------------aveqasnltqapeeepipldqlggscrt  363
ident                                                             
Sbjct faergvlqpgawadvvvfdpdtvadratwdeptlasvgiagvlvngaevfpqppadgrpg  469
DSSP  lllllllllllllleeeelllllllllllllllllllleeeeeelleeeellllllllll


DSSP  llllll
Query hygyss  369
ident       
Sbjct qvlrax  475
DSSP  llllll


No 26: Query=1itqA Sbjct=2oofA Z-score=13.9

back to top
DSSP  ------------------------------------------------lhhhhhhhhhhL
Query ------------------------------------------------dffrdeaerimR   12
ident                                                             
Sbjct lncervwlnvtpatlrsdladygllephalgvhegrihalvpxqdlkypahwqdxkgklV   60
DSSP  lllleeeeeeeellllllllllllllleeeeeelleeeeeeehhhllllllleelllleE


DSSP  LLLEEEEEELHHHH-------------------------------hhhHHLLLLllhhhl
Query DSPVIDGHNDLPWQ-------------------------------lldMFNNRLqderan   41
ident     || |  |                                                 
Sbjct TPGLIDCHTHLIFAgsraeefelrqkgvpyaeiarkgggiistvratrAASEDQ------  114
DSSP  EELEEEEEELLLLLlllhhhhhhhhhlllhhhhhhllllhhhhhhhhhHLLHHH------


DSSP  llllllllLLHHhHHHLLEEEEEEEELLLhhhllllHHHHHHHHHHHHHHHHHHLlllee
Query lttlagthTNIPkLRAGFVGGQFWSVYTPcdtqnkdAVRRTLEQMDVVHRMCRMYpetfl  101
ident              |    |                      |    |  |          
Sbjct -lfelalpRVKS-LIREGVTTVEIKSGYG------lTLEDELKXLRVARRLGEAL-----  161
DSSP  -hhhhhhhHHHH-HHHHLEEEEEEELLLL------lLHHHHHHHHHHHHHHHHHL-----


DSSP  elllhhhhhhhhhllLEEEEEEEELH-------------hhlLLLHHHHHHHHH-LLEEE
Query yvtssagirqafregKVASLIGVEGG-------------hsiDSSLGVLRALYQ-LGMRY  147
ident                                                   |         
Sbjct ---------------PIRVKTTLLAAhavppeyrddpdswveTICQEIIPAAAEaGLADA  206
DSSP  ---------------LLEEEEEEEEEllllhhhlllhhhhhhHHHHLHHHHHHHlLLLLE


DSSP  EELLlllllllllLHHHlllllllllLLLLhhHHHHHHHHHHHLLEEELLL---lLHHHH
Query LTLThscntpwadNWLVdtgdsepqsQGLSpfGQRVVKELNRLGVLIDLAH---vSVATM  204
ident                                    |       |                
Sbjct VDVF---------CEHI-------gfSLAQ--TEQVYLAADQYGLAVKGHXdqlsNLGGS  248
DSSP  EEEE---------ELLL-------llLHHH--HHHHHHHHHHLLLEEEEEEllllLLLHH


DSSP  HHHHHHllLLLEElLLLLLllllllllLLHHHHHHHHHHLLEEEEL-LLHHhHLLLllll
Query KATLQLsrAPVIFsHSSAYsvcasrrnVPDDVLRLVKQTDSLVMVN-FYNNyISCTnkan  263
ident                   |                                    |    
Sbjct TLAANF--GALSV-DHLEY--------LDPEGIQALAHRGVVATLLpTAFYfLKET----  293
DSSP  HHHHHL--LLLEE-EELLL--------LLHHHHHHHHHHLLEEEELhHHHHhLLLL----


DSSP  hhhhhhHHHHHHHHLLhhHEEELLLLlLLLLLllllLLLLlHHHHHHH-hhhlLLLHHHH
Query lsqvadHLDHIKEVAGarAVGFGGDFdGVPRVpeglEDVSkYPDLIAE-llrrNWTEAEV  322
ident                         |             ||               |  | 
Sbjct ---klpPVVALRKAGV--PXAVSSDI-NPGTA----PIVS-LRXAXNXactlfGLTPVEA  342
DSSP  ---lllLHHHHHHLLL--LEEELLLL-LLLLL----LLLL-HHHHHHHhhhhhLLLHHHH


DSSP  HHHHLHHHHHH-HHHH-------------hhllllllllllllllhhhllllllllllll
Query KGALADNLLRV-FEAV-------------eqasnltqapeeepipldqlggscrthygys  368
ident          |   |                                              
Sbjct XAGVTRHAARAlGEQEqlgqlrvgxladflvwncghpaelsyligvdqlvsrvvngeetl  402
DSSP  HHHLLHHHHHHlLLLLlllllllllllleeeellllllhhhhlllllleeeeeelleell


DSSP  l
Query s  369
ident  
Sbjct h  403
DSSP  l


No 27: Query=1itqA Sbjct=2pajA Z-score=13.7

back to top
DSSP  -----------------------------------------------lhhhhhhhhhhLL
Query -----------------------------------------------dffrdeaerimRD   13
ident                                                             
Sbjct pstlirnaaaimtggrgtaddpsrvpgpdirivgdtidaigalaprpgetivdatdcvIY   60
DSSP  leeeeellleelllllllllllllllllleeeelleeeeellllllllleeeelllleEE


DSSP  LLEEEEEELHHHH------hHHHHLLLLllhhhlllllllllLLHHhHHHLLEEEEEEEE
Query SPVIDGHNDLPWQ------lLDMFNNRLqderanlttlagthTNIPkLRAGFVGGQFWSV   67
ident       |  |             |  |                 |  |            
Sbjct PAWVNTHHHLFQSllkgepfRALFDERR-------frlaariGLIE-LARSGCATVADHN  112
DSSP  ELEELLLLLHHHHhllllllHHHLLHHH-------hhhhhhhHHHH-HHLLLEEEEEELL


DSSP  LLLhhhllllHHHHhhHHHHHHHHHHhhlLLLEeelllhhhhhhhhhlllEEEEEEEELH
Query YTPcdtqnkdAVRRtlEQMDVVHRMCrmyPETFlyvtssagirqafregkVASLIGVEGG  127
ident |                                                         | 
Sbjct YVY-------YPGMpfDSSAILFEEA---EKLG-----------------LRFVLLRGGA  145
DSSP  LLL-------LLLLllLHHHHHHHHH---HHLL-----------------LEEEEEELLL


DSSP  H--------------hLLLL--HHHHHHHHHLLE---------EEEELLLllLLLLlllh
Query H--------------sIDSS--LGVLRALYQLGM---------RYLTLTHscNTPWadnw  162
ident                             |                   |           
Sbjct TqtrqleadlptalrpETLDayVADIERLAARYHdaspramrrVVMAPTTvlYSIS----  201
DSSP  LllllllllllhhhllLLHHhhHHHHHHHHHHLLllllllleeEEELLLLllLLLL----


DSSP  hhllllllllllllLHHHHHHHHHHHHHLLEEELLLL---LHHHHHHHhhHLLL-LLEEl
Query lvdtgdsepqsqglSPFGQRVVKELNRLGVLIDLAHV---SVATMKATlqLSRA-PVIFs  218
ident                           |||            ||             |   
Sbjct --------------PREMRETAAVARRLGLRMHSHLSgksPVAFCGEH--DWLGsDVWY-  244
DSSP  --------------HHHHHHHHHHHHHLLLEEEEELLlllHHHHHHHL--LLLLlLEEE-


DSSP  LLLLLllllllllLLHHHHHHHHHHLLEEEEL--LLHHHhlllllllhhhhhhHHHHHHH
Query HSSAYsvcasrrnVPDDVLRLVKQTDSLVMVN--FYNNYisctnkanlsqvadHLDHIKE  276
ident              |  |   |  ||   |                               
Sbjct AHLVK--------VDADEIALLAQTGTGVAHCpqSNGRL--------------PVREMAD  282
DSSP  ELLLL--------LLHHHHHHHHHHLLEEEELhhHHHLL--------------LLLLHHH


DSSP  HLLhhHEEELLLLLLLlllllllLLLL-LHHHH-HHHHHHLLLLHHHHHHHHLHHHHHHH
Query VAGarAVGFGGDFDGVprvpeglEDVS-KYPDL-IAELLRRNWTEAEVKGALADNLLRVF  334
ident       |  | |                            |    |||         || 
Sbjct AGV--PVSIGVDGAAS-----neAADMiSEVHMtWLAQRARLASIAEVIHWGTAGGARVM  335
DSSP  HLL--LEEELLLHHHH-----llLLLHhHHHHHhHHHHHHLLLLHHHHHHHHLHHHHHHH


DSSP  H---------------------------------------------------hhhhllll
Query E---------------------------------------------------aveqasnl  343
ident                                                             
Sbjct Gldevgkvavgyaadiavyrlddpryfglhdpaigpvasggrpsvmalfsagkrvvvddl  395
DSSP  Llllllllllllllleeeeelllhhhlllllhhhhhhhllllleeeeeeelleeeeelll


DSSP  llllllllllhhhlllllllllllll
Query tqapeeepipldqlggscrthygyss  369
ident                           
Sbjct iegvdikelggearrvvrellrevvv  421
DSSP  lllllhhhhhhhhhhhhhhhhhhhhl


No 28: Query=1itqA Sbjct=3mtwA Z-score=13.7

back to top
DSSP  --------------------------------------------lhhhhhhhhhhlLLLE
Query --------------------------------------------dffrdeaerimrDSPV   16
ident                                                             
Sbjct aeikavsaarlldvasgkyvdnplvivtdgritsigkkgdavpagatavdlpgvtlLPGL   60
DSSP  lleeeeeeeeeeelllleeeeleeeeeelleeeeeeellllllllleeeeeeeeeeEELE


DSSP  EEEEELHHHH-------hhhHHLLLlllhhHLLLlllllllLHHHHHHLLEEEEEEEELl
Query IDGHNDLPWQ-------lldMFNNRlqderANLTtlagthtNIPKLRAGFVGGQFWSVYt   69
ident || |  |                          |       |  |               
Sbjct IDMHVHLDSLaevggynsleYSDRF---wsVVQT------aNAKKTLEAGFTTVRNVGA-  110
DSSP  EEEEELLLLLllllhhhhhhLLHHH---hhHHHH------hHHHHHHHLLEEEEEELLL-


DSSP  lhhhllllhhhhhhhHHHHHHHHHHHL---LLLEeelllhhhhhhhhhlllEEEEEE-EE
Query pcdtqnkdavrrtleQMDVVHRMCRMY---PETFlyvtssagirqafregkVASLIG-VE  125
ident                                                             
Sbjct ---------------ADYDDVGLREAIdagYVPG-----------------PRIVTAaIS  138
DSSP  ---------------LLLHHHHHHHHHhllLLLL-----------------LEEEELlLL


DSSP  LHH-------------------HLLL----LHHHHHHHHHLLEEEEELLlllllllLLLH
Query GGH-------------------SIDS----SLGVLRALYQLGMRYLTLThscntpwADNW  162
ident  |                                 | |   |              |   
Sbjct FGAtgghcdstffppsmdqknpFNSDspdeARKAVRTLKKYGAQVIXIC-------ATGG  191
DSSP  EELlllllllllllhhhlllllLLLLlhhhHHHHHHHHHHLLLLEEEEE-------LLLL


DSSP  ------HHLLlllllllllLLHHHHHHHHHHHHHLLEEELLLlLHHHHHHHHHHLlllLE
Query ------LVDTgdsepqsqgLSPFGQRVVKELNRLGVLIDLAHvSVATMKATLQLSrapVI  216
ident                           || |    |                         
Sbjct vfsrgnEPGQ------qqlTYEEMKAVVDEAHMAGIKVAAHAhGASGIREAVRAG--vDT  243
DSSP  llllllLLLL------lllLHHHHHHHHHHHHHLLLEEEEEElLHHHHHHHHHLL--lLE


DSSP  ELlLLLLllllllllLLHHHHHHHHHHLLEEEEL-LLHHhhllLLLL-------------
Query FShSSAYsvcasrrnVPDDVLRLVKQTDSLVMVN-FYNNyiscTNKA-------------  262
ident                | |    |  |                                  
Sbjct IE-HASL--------VDDEGIKLAVQKGAYFSMDiYNTD--ytQAEGkkngvlednlrkd  292
DSSP  EE-ELLL--------LLHHHHHHHHHHLLEEELLlLLHH--hhHHHHhhhlllhhhhhhh


DSSP  --lhhhhHHHHHHHHHHLLhhHEEELLLLLLLllllllllLLLLHHHHHHHHHHLLLLHH
Query --nlsqvADHLDHIKEVAGarAVGFGGDFDGVprvpegleDVSKYPDLIAELLRRNWTEA  320
ident                          | |                     |   |   |  
Sbjct rdigelqRENFRKALKAGV--KMVYGTDAGIY--------PHGDNAKQFAVMVRYGATPL  342
DSSP  hhhhhhhHHHHHHHHHHLL--EEELLLLLLLL--------LLLLHHHHHHHHHHLLLLHH


DSSP  HHHHHHLHHHHHHHH-------------hhhhllllllllllllllhhhlllllllllll
Query EVKGALADNLLRVFE-------------aveqasnltqapeeepipldqlggscrthygy  367
ident                                                             
Sbjct QAIQSATLTAAEALGrskdvgqvavgrygdmiavagdpladvttlekpvfvmkggavvka  402
DSSP  HHHHHLLHHHHHHHLllllllllllllllleeeelllllllhhhhhllleeeelleeeel


DSSP  ll
Query ss  369
ident   
Sbjct px  404
DSSP  ll


No 29: Query=1itqA Sbjct=3griA Z-score=13.7

back to top
DSSP  --------------------------------------lhhhhhhhhhhLLLLEEEEEEL
Query --------------------------------------dffrdeaerimRDSPVIDGHND   22
ident                                                        | |  
Sbjct xklikngkvlqngelqqadilidgkvikqiapaiepsngvdiidakghfVSPGFVDVHVH   60
DSSP  leeeelleeeelleeeeleeeeelleeeeeellllllllleeeelllleEEELEEEEEEL


DSSP  HhHHHHHhhllllllhhhllllLLLL--lLLHHHHHHLLEEEEEEEELLLhhhllllhhh
Query LpWQLLDmfnnrlqderanlttLAGT--hTNIPKLRAGFVGGQFWSVYTPcdtqnkdavr   80
ident |                            |       |          |           
Sbjct L-REPGG---------------EYKEtieTGTKAAARGGFTTVCPXPNTR-------pvp   97
DSSP  L-LLLLL---------------LLLLlhhHHHHHHHHLLEEEEEELLLLL-------lll


DSSP  hHHHHHHHHHHHHHHLllleeelllhhhhhhhhhllLEEEEEEEELHHH--lLLLHhHHH
Query rTLEQMDVVHRMCRMYpetflyvtssagirqafregKVASLIGVEGGHS--iDSSLgVLR  138
ident    |                                 |  |                   
Sbjct dSVEHFEALQKLIDDN-------------------aQVRVLPYASITTRqlgKELV-DFP  137
DSSP  lLHHHHHHHHHHHHHH-------------------lLLEELLLEELLHHhllLLLL-LHH


DSSP  HHHHLLEEEEELlLLLLLLLlllhhhllllllllllllLHHHHHHHHHHHHHLLEEELLL
Query ALYQLGMRYLTLtHSCNTPWadnwlvdtgdsepqsqglSPFGQRVVKELNRLGVLIDLAH  198
ident ||   |    |                                    |       |    
Sbjct ALVKEGAFAFTD-DGVGVQT------------------ASXXYEGXIEAAKVNKAIVAHC  178
DSSP  HHHLLLLLLEEE-LLLLLLL------------------HHHHHHHHHHHHHHLLLEEELL


DSSP  L-------------------------------LHHHHHHHHHHLLLLLEElLLLLLLlll
Query V-------------------------------SVATMKATLQLSRAPVIFsHSSAYSvca  227
ident                                   |                         
Sbjct EdnsliyggaxhegkrskelgipgipnicesvQIARDVLLAEAAGCHYHV-CHVSTK---  234
DSSP  LlhhhllllleellhhhhhhllleellhhhhhHHHHHHHHHHHHLLLEEE-LLLLLH---


DSSP  llllLLHHHHHHH-hHHLLEEEELLL-----------------HHHHLLlllllhhhhhH
Query srrnVPDDVLRLV-kQTDSLVMVNFY-----------------NNYISCtnkanlsqvaD  269
ident                       |                     |               
Sbjct ---eSVRVIRDAKraGIHVTAEVTPHhlllteddipgnnaiykXNPPLR----stedreA  287
DSSP  ---hHHHHHHHHHhlLLLEEEEELHHhhhllhhhlllllhhhlLLLLLL----lhhhhhH


DSSP  HHHHHHHHLlhhHEEELLLLL-------------lLLLLllllLLLLLHHHHH-HHHH-H
Query HLDHIKEVAgarAVGFGGDFD-------------gVPRVpeglEDVSKYPDLI-AELL-R  314
ident  |                |                                |        
Sbjct LLEGLLDGT---IDCIATDHAphardekaqpxekaPFGI----VGSETAFPLLyTHFVkN  340
DSSP  HHHHHHLLL---LLEELLLLLlllhhhhlllllllLLLL----LLLLLHHHHHhHHHLlL


DSSP  LLLLHHHHHHHHLHHHHHHHH---------------------------hhhhllllllll
Query RNWTEAEVKGALADNLLRVFE---------------------------aveqasnltqap  347
ident   ||       |       |                                        
Sbjct GDWTLQQLVDYLTIKPCETFNleygtlkengyadltiidldseqeikgedflskadntpf  400
DSSP  LLLLHHHHHHHHLHHHHHHLLllllllllllllleeeeelllleellhhhllllllllll


DSSP  llllllhhhlllllllllllll
Query eeepipldqlggscrthygyss  369
ident                       
Sbjct igykvygnpiltxvegevkfeg  422
DSSP  llleelleeeeeeelleeeeel


No 30: Query=1itqA Sbjct=4cqbA Z-score=13.5

back to top
DSSP  ---------------------------------------lhhhhhhhhhhLLLLEEEEEE
Query ---------------------------------------dffrdeaerimRDSPVIDGHN   21
ident                                                         | | 
Sbjct skdfdliirnaylsekdsvydigivgdriikieakiegtvkdeidakgnlVSPGFVDAHT   60
DSSP  llleeeeeeeeeelllleeeeeeeelleeeeeelllllleeeeeelllllEEELEEEEEE


DSSP  LHHHH---------------------------hhhhHLLLLllhhhllllllllLLLHhH
Query DLPWQ---------------------------lldmFNNRLqderanlttlagtHTNIpK   54
ident                                                             
Sbjct HMDKSftstgerlpkfwsrpytrdaaiedglkyyknATHEE-------ikrhviEHAH-M  112
DSSP  LHHHLlllllllllllllllllhhhhhhhhhhhhhhLLHHH-------hhhhhhHHHH-H


DSSP  HHHLLEEEEEEEELLlhhhllllHHHHHHHHHHHHHHHHHHLLLLeeelllhhhhhhhhh
Query LRAGFVGGQFWSVYTpcdtqnkdAVRRTLEQMDVVHRMCRMYPETflyvtssagirqafr  114
ident             |                     |                         
Sbjct QVLHGTLYTRTHVDV--------DSVAKTKAVEAVLEAKEELKDL---------------  149
DSSP  HHHLLEEEEEEEEEL--------LLLLLLHHHHHHHHHHHHLLLL---------------


DSSP  lllEEEEEEEELHH--hLLLL-HHHHHHHHHLLEEEEELLL-lLLLLLLllhhhllllll
Query egkVASLIGVEGGH--sIDSS-LGVLRALYQLGMRYLTLTH-sCNTPWAdnwlvdtgdse  170
ident                   |       |     |                           
Sbjct ---IDIQVVAFAQSgffVDLEsESLIRKSLDMGCDLVGGVDpaTRENNV-----------  195
DSSP  ---LEEEEEEELLLlllLLLLhHHHHHHHHHHLLLEEELLLllLLLLLH-----------


DSSP  llllllLHHHHHHHHHHHHHLLEEELLL-----lLHHHHHHHHHHL-----LLLLEELlL
Query pqsqglSPFGQRVVKELNRLGVLIDLAH-----vSVATMKATLQLS-----RAPVIFShS  220
ident               |      | ||          |       |          |  |  
Sbjct ------EGSLDLCFKLAKEYDVDIDYHIhdigtvGVYSINRLAQKTiengyKGRVTTS-H  248
DSSP  ------HHHHHHHHHHHHHLLLEEEEEElllhhhHHHHHHHHHHHHhhlllLLLEEEE-E


DSSP  LLLLLLLlllllLHHHHHHHHHHLLEEEELLLHhHHLLlllllhhhhhHHHHHHHHHLLh
Query SAYSVCAsrrnvPDDVLRLVKQTDSLVMVNFYNnYISCtnkanlsqvaDHLDHIKEVAGa  280
ident       |      |    | |         |                        |    
Sbjct AWCFADA-psewLDEAIPLYKDSGMKFVTCFSS-TPPT----------MPVIKLLEAGI-  295
DSSP  LLHHHHL-lhhhHHHHHHHHHHHLLEEEEELLL-LLLL----------LLHHHHHHLLL-


DSSP  hHEEELLLLL--lLLLLllllLLLLlHHHHHH------hhhHLLLLHhHHHHHHLHHHHH
Query rAVGFGGDFD--gVPRVpeglEDVSkYPDLIA------ellRRNWTEaEVKGALADNLLR  332
ident    |   |                                                   |
Sbjct -NLGCASDNIrdfWVPF----GNGD-MVQGALietqrlelkTNRDLG-LIWKMITSEGAR  348
DSSP  -EEEEELLLLlllLLLL----LLLL-HHHHHHhhhhhhlllLHHHHH-HHHHHHLHHHHH


DSSP  HHH-----------------hhhhllllllllllllllhhhlllllllllllll
Query VFE-----------------aveqasnltqapeeepipldqlggscrthygyss  369
ident |                                                     
Sbjct VLGieknygievgkkadlvvlnslspqwaiidqakrlcvikngriivkdeviva  402
DSSP  HHLlhhhlllllllllleeeellllhhhhhhhllleeeeeelleeeeelleell


No 31: Query=1itqA Sbjct=1k6wA Z-score=13.4

back to top
DSSP  --------------------------------------lhhhhhhhhhhLLLLEEEEEEL
Query --------------------------------------dffrdeaerimRDSPVIDGHND   22
ident                                                     |    |  
Sbjct alqtiinarlpgeeglwqihlqdgkisaidaqsgvmpitensldaeqglVIPPFVEPHIH   60
DSSP  llleeeeellllllleeeeeeelleeeeeeeellllllllleeelllleEELLEEEEEEL


DSSP  HHHH-----------------------hhhHHLLLLllhhhllllllllLLLHhHHHHLL
Query LPWQ-----------------------lldMFNNRLqderanlttlagtHTNIpKLRAGF   59
ident |                                                 |      |  
Sbjct LDTTqtagqpnwnqsgtlfegierwaerkaLLTHDD-------vkqrawQTLK-WQIANG  112
DSSP  LLLLlllllllllllllhhhhhhhhhllhhHLLHHH-------hhhhhhHHHH-HHHHLL


DSSP  EEEEEEEELLlhhhllllHHHHhHHHHHHHHHHHHHLLLleeelllhhhhhhhhhllLEE
Query VGGQFWSVYTpcdtqnkdAVRRtLEQMDVVHRMCRMYPEtflyvtssagirqafregKVA  119
ident        |               |                                    
Sbjct IQHVRTHVDV--------SDAT-LTALKAMLEVKQEVAP------------------WID  145
DSSP  EEEEEEEEEL--------LLLL-LHHHHHHHHHHHHHLL------------------LLE


DSSP  EEEEEELHH---hlLLLHHHHHHHHHLLEEEEELLllLLLLllllhhhllllllLLLLLL
Query SLIGVEGGH---siDSSLGVLRALYQLGMRYLTLThsCNTPwadnwlvdtgdsePQSQGL  176
ident   |                 |     ||                              | 
Sbjct LQIVAFPQEgilsyPNGEALLEEALRLGADVVGAI-pHFEF-------------TREYGV  191
DSSP  EEEEEELLLlllllLLHHHHHHHHHHLLLLEEEEL-hHHLL-------------LHHHHH


DSSP  LhhHHHHHHHHHHHLLEEELLLL-----lHHHHHHHHHH---LLLL--LEELLLllllll
Query SpfGQRVVKELNRLGVLIDLAHV-----sVATMKATLQL---SRAP--VIFSHSsaysvc  226
ident                 |||                   |         |  ||       
Sbjct E-sLHKTFALAQKYDRLIDVHCDeiddeqSRFVETVAALahhEGMGarVTASHT------  244
DSSP  H-hHHHHHHHHHHHLLEEEEEELllllllLLHHHHHHHHhhhHLLHhhEEEEEL------


DSSP  lllLLLL-------HHHHHHHHHHLLEEEELL-LHHHHLLL-llllhhhhhhHHHHHHHH
Query asrRNVP-------DDVLRLVKQTDSLVMVNF-YNNYISCT-nkanlsqvadHLDHIKEV  277
ident                   || |        |   |                       | 
Sbjct ---TAMHsyngaytSRLFRLLKMSGINFVANPlVNIHLQGRfdtypkrrgitRVKEMLES  301
DSSP  ---HHHHhllhhhhHHHHHHHHHHLLEEEELHhHHHHHLLLlllllllllllLHHHHHHL


DSSP  LLhhHEEELLLLL--lLLLLllllLLLLlHHHHHH------hHHHLLLLHHhHHHHHLHH
Query AGarAVGFGGDFD--gVPRVpeglEDVSkYPDLIA------eLLRRNWTEAeVKGALADN  329
ident      | || |                               |                 
Sbjct GI--NVCFGHDDVfdpWYPL----GTAN-MLQVLHmglhvcqLMGYGQIND-GLNLITHH  353
DSSP  LL--LEEELLLLLlllLLLL----LLLL-HHHHHHhhhhhllLLLHHHHHH-HHHHHLHH


DSSP  HHHHHH------------------------------hhhhllllllllllllllhhhlll
Query LLRVFE------------------------------aveqasnltqapeeepipldqlgg  359
ident   |                                                         
Sbjct SARTLNlqdygiaagnsanliilpaengfdalrrqvpvrysvrggkviastqpaqttvyl  413
DSSP  HHHHLLllllllllllllleeeellllhhhhhhhllllleeeelleeeeellllleeeel


DSSP  llllllllll
Query scrthygyss  369
ident           
Sbjct eqpeaidykr  423
DSSP  lleeeellll


No 32: Query=1itqA Sbjct=3mkvA Z-score=13.2

back to top
DSSP  -------------------------------------------lhhhhhhhhhhlLLLEE
Query -------------------------------------------dffrdeaerimrDSPVI   17
ident                                                            |
Sbjct lttflfrngalldpdhpdllqgfeiliedgfirevsdkpikssnahvidvkgktiMPGLI   60
DSSP  lleeeeeeeeelllllllleeeeeeeeelleeeeeellllllllleeeelllleeEELEE


DSSP  EEEELHHHH-----hHHHHLLLLllhhHLLLLllllllLHHHHHHLLEEEEEEEELllhh
Query DGHNDLPWQ-----lLDMFNNRLqderANLTTlagthtNIPKLRAGFVGGQFWSVYtpcd   72
ident | |                 | |                                     
Sbjct DLHVHVVAIefnlprVATLPNVL--vtLRAVP------IMRAMLRRGFTTVRDAGG----  108
DSSP  EEEELLLLLlllhhhHLLLLHHH--hhHHHHH------HHHHHHHLLEEEEEELLL----


DSSP  hllllhhhhhhhHHHHHHHHHHHLLLLEeelllhhhhhhhhhlllEEEEEE-EELHH---
Query tqnkdavrrtleQMDVVHRMCRMYPETFlyvtssagirqafregkVASLIG-VEGGH---  128
ident                                                             
Sbjct ------------AGYPFKQAVESGLVEG-----------------PRLFVSgRALSQtgg  139
DSSP  ------------LLHHHHHHHHLLLLLL-----------------LEEEELlLEEELlll


DSSP  ---------------------------HLLL----LHHHHHHHHHLLEEEEELLllllll
Query ---------------------------SIDS----SLGVLRALYQLGMRYLTLThscntp  157
ident                                         |   | |             
Sbjct hadprarsdymppdspcgccvrvgalgRVADgvdeVRRAVREELQMGADQIXIM------  193
DSSP  lllllllllllllllllllllllllleEELLlhhhHHHHHHHHHHHLLLLEEEE------


DSSP  lLLLH------HHLLlllllllllLLHHH-HHHHHHHHHHLLEEELLLllHHHHHHHHHH
Query wADNW------LVDTgdsepqsqgLSPFG-QRVVKELNRLGVLIDLAHvsVATMKATLQL  210
ident  |          |            |       | |    |          |        
Sbjct -ASGGvasptdPVGV-------fgYSEDEiRAIVAEAQGRGTYVLAHAytPAAIARAVRC  245
DSSP  -LLLLllllllLLLL-------llLLHHHhHHHHHHHHLLLLLEEEEEllHHHHHHHHHL


DSSP  LllLLEElLLLLLllllllllLLHHHHHHHHHHLLEEEELLL------------------
Query SraPVIFsHSSAYsvcasrrnVPDDVLRLVKQTDSLVMVNFY------------------  252
ident                        |   |||      |                       
Sbjct G--VRTI-EHGNL--------IDDETARLVAEHGAYVVPTLVtydalasegekyglppes  294
DSSP  L--LLEE-EELLL--------LLHHHHHHHHHHLLEEELLHHhhhhhhhhlllllllhhh


DSSP  ----hHHHLllllllhhHHHHHHHHHHHHLLhhHEEELLLLLlllllllllLLLLLHHHH
Query ----nNYISctnkanlsQVADHLDHIKEVAGarAVGFGGDFDgvprvpeglEDVSKYPDL  308
ident                           |        ||| |              |     
Sbjct iakiaDVHG--------AGLHSIEIMKRAGV--KMGFGTDLL-----geaqRLQSDEFRI  339
DSSP  hllhhHHHL--------LHHHHHHHHHHHLL--LLLLLLLLL-----hhhhHHLLHHHHH


DSSP  HHHHhhllLLHHHHHHHHLHHHHHHHH------------------hhhhlllllllllll
Query IAELlrrnWTEAEVKGALADNLLRVFE------------------aveqasnltqapeee  350
ident  ||        |||          |                                   
Sbjct LAEV----LSPAEVIASATIVSAEVLGmqdklgrivpgahadvlvvdgnplksvdcllgq  395
DSSP  HHLL----LLHHHHHHHLLHHHHHHLLllllllllllllllleeeellllllllllllll


DSSP  lllhhhlllllllllllll
Query pipldqlggscrthygyss  369
ident                    
Sbjct gehiplvmkdgrlfvnele  414
DSSP  llllleeeelleeeeelll


No 33: Query=1itqA Sbjct=1a4mA Z-score=13.1

back to top
DSSP  lhhhHHHHHhhllLLEEEEEELHH------------------------------------
Query dffrDEAERimrdSPVIDGHNDLP------------------------------------   24
ident       |       |    |  |                                     
Sbjct ----TPAFN----KPKVELHVHLDgaikpetilyfgkkrgialpadtveelrniigmdkp   52
DSSP  ----LLLLL----LLEEEEEEEHHhlllhhhhhhhhhhhllllllllhhhhhhhhlllll


DSSP  ----------hhhHHHH--LLLLllhhhllllllllllLHHHHHHLLEEEEEEEELLL--
Query ----------wqlLDMF--NNRLqderanlttlagthtNIPKLRAGFVGGQFWSVYTP--   70
ident                                                |            
Sbjct lslpgflakfdyyMPVIagCREA--------ikriayeFVEMKAKEGVVYVEVRYSPHll  104
DSSP  llhhhhhllhhhhHHHHllLHHH--------hhhhhhhHHHHHHHLLEEEEEEEELLHhh


DSSP  --hhHLLLL-----hhhhHHHHHHHHHHHHHH-LLLLeeelllhhhhhhhhhllLEEEEE
Query --cdTQNKD-----avrrTLEQMDVVHRMCRM-YPETflyvtssagirqafregKVASLI  122
ident                        | |                                  
Sbjct anskVDPMPwnqtegdvtPDDVVDLVNQGLQEgEQAF-----------------GIKVRS  147
DSSP  llllLLLLHhhlllllllHHHHHHHHHHHHHHhHHHH-----------------LLEEEE


DSSP  EEELH-hhlLLLHHHHHHHHHLL---EEEEELLLLllllllllHHHLlllllllLLLLLH
Query GVEGG-hsiDSSLGVLRALYQLG---MRYLTLTHScntpwadnWLVDtgdsepqSQGLSP  178
ident            || ||               |                         | |
Sbjct ILCCMrhqpSWSLEVLELCKKYNqktVVAMDLAGD--------ETIE-------GSSLFP  192
DSSP  EEEEElllhHHHHHHHHHHHHLLlllEEEEEEELL--------LLLL-------LHHHLH


DSSP  HHHHHHHHHHHHLLEEELLL---llHHHHHHHHHHLLlLLEElLLLLllllllllLLLH-
Query FGQRVVKELNRLGVLIDLAH---vsVATMKATLQLSRaPVIFsHSSAysvcasrrNVPD-  234
ident             |                                               
Sbjct GHVEAYEGAVKNGIHRTVHAgevgsPEVVREAVDILK-TERV-GHGY--------HTIEd  242
DSSP  HHHHHHHHHHHHLLEEEEEElllllHHHHHHHHHLLL-LLEE-EELH--------HHHHl


DSSP  -HHHHHHHHHLLEEEEL--LLHH--HHLLLllllhhhhhHHHHHHHHhlLHHHEEELLLL
Query -DVLRLVKQTDSLVMVN--FYNN--YISCTnkanlsqvaDHLDHIKEvaGARAVGFGGDF  289
ident                |                             |            | 
Sbjct eALYNRLLKENMHFEVCpwSSYLtgAWDPK-------ttHAVVRFKN--DKANYSLNTDD  293
DSSP  hHHHHHHHHLLLEEEELhhHHHHllLLLLL-------llLHHHHHHH--LLLLEEELLLL


DSSP  LllllllllLLLLllHHHHHHHHHHL-LLLHHHHHHHhLHHHHHHHhhhhhlllllllll
Query DgvprvpegLEDVskYPDLIAELLRR-NWTEAEVKGAlADNLLRVFeaveqasnltqape  348
ident                              || | |     |                   
Sbjct P------liFKST--LDTDYQMTKKDmGFTEEEFKRL-NINAAKSS--------------  330
DSSP  L------llLLLL--HHHHHHHHHHLlLLLHHHHHHH-HHHHHHLL--------------


DSSP  lllllhhhlllllllllllll
Query eepipldqlggscrthygyss  369
ident                      
Sbjct --flpeeekkellerlyreyq  349
DSSP  --lllhhhhhhhhhhhhhhll


No 34: Query=1itqA Sbjct=3e74A Z-score=13.0

back to top
DSSP  ----------------------------------------lhhhhhhHHHHllLLEEEEE
Query ----------------------------------------dffrdeaERIMrdSPVIDGH   20
ident                                                          | |
Sbjct sfdliikngtvilenearvvdiavkggkiaaigqdlgdakevxdasgLVVS--PGXVDAH   58
DSSP  leeeeeelleeelllleeeleeeeelleeeeeellllleeeeeelllLEEE--ELEEEEE


DSSP  ELHhhhhhhhhllllllhhhllllllllllLHHHHHHLLEEEEEEEELLLhhhllllhhH
Query NDLpwqlldmfnnrlqderanlttlagthtNIPKLRAGFVGGQFWSVYTPcdtqnkdavR   80
ident                                      |                      
Sbjct THI-----------------------gyetGTRAAAKGGITTXIEXPLNQ---------L   86
DSSP  ELL-----------------------lhhhHHHHHHHLLEEEEEELLLLL---------L


DSSP  HHH---HHHHHHHHHHHhlLLLEeelllhhhhhhhhhlllEEEEEEEELHhhlLLLHHHH
Query RTL---EQMDVVHRMCRmyPETFlyvtssagirqafregkVASLIGVEGGhsiDSSLGVL  137
ident                                                            |
Sbjct PATvdrASIELKFDAAK--GKLT-----------------IDAAQLGGLV---SYNIDRL  124
DSSP  LLLllhHHHHHHHHHHL--LLLL-----------------LEEEELEELL---LLLLLLH


DSSP  HHHHHLLEEEEELLllllLLLLllhhhllllllllllllLHHHHHHHHHHHHHLLEEELL
Query RALYQLGMRYLTLThscnTPWAdnwlvdtgdsepqsqglSPFGQRVVKELNRLGVLIDLA  197
ident   |   |                                          |  ||      
Sbjct HELDEVGVVGFXCF---vRDVN-----------------DWQFFKGAQKLGELGQPVLVH  164
DSSP  HHHHHHLLLLEEEE---lLLLL-----------------HHHHHHHHHHHHHHLLLEEEE


DSSP  LL----------------------------------LHHHHHHHHHHLLLLLEELlLLLL
Query HV----------------------------------SVATMKATLQLSRAPVIFShSSAY  223
ident                                                             
Sbjct CEnalicdelgeeakregrvtahdyvasrpvfteveAIRRVLYLAKVAGCRLHVC-HVSS  223
DSSP  LLlhhhhhhhhhhhhhhllllhhhhhhlllhhhhhhHHHHHHHHHHHHLLLEEEL-LLLL


DSSP  LlllllllLLHHHHHHH-hHHLLEEEELLLhhhhLLLLLL--------------lhhhhh
Query SvcasrrnVPDDVLRLV-kQTDSLVMVNFYnnyiSCTNKA--------------nlsqva  268
ident             | |      |              |                       
Sbjct P------eGVEEVTRARqeGQDITCESCPH-yfvLDTDQFeeigtlakcsppirdlenqk  276
DSSP  H------hHHHHHHHHHhlLLLEEEEELLH-hhhLLHHHHhhhlhhhllllllllhhhhh


DSSP  HHHHHHHHhllHHHEEELLLLL-------------llLLLLllllLLLL-HHHHHHHHHH
Query DHLDHIKEvagARAVGFGGDFD-------------gvPRVPegleDVSK-YPDLIAELLR  314
ident                    |                                    |   
Sbjct GXWEKLFN---GEIDCLVSDHSpcppexkagnixkawGGIA----GLQScXDVXFDEAVQ  329
DSSP  HHHHHHHL---LLLLEELLLLLlllllllllllllllLLLL----LHHHhHHHHHHHHLL


DSSP  -LLLLHHHHHHHHLHHHHHHHH--------------------------------------
Query -RNWTEAEVKGALADNLLRVFE--------------------------------------  335
ident  |           | |    |                                       
Sbjct kRGXSLPXFGKLXATNAADIFGlqqkgriapgkdadfvfiqpnssyvltnddleyrhkvs  389
DSSP  lLLLLHHHHHHHHLHHHHHHLLlllllllllllllleeeeelllleellhhhllllllll


DSSP  ------hhhhllllllllllllllhhhlllllllllllll
Query ------aveqasnltqapeeepipldqlggscrthygyss  369
ident                                         
Sbjct pyvgrtigaritktilrgdviydieqgfpvapkgqfilkh  429
DSSP  llllleelleeeeeeelleeeeelllllllllllleelll


No 35: Query=1itqA Sbjct=3nqbA Z-score=12.9

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct epadlnddtlraravaaargdqrfdvlitggtlvdvvtgelrpadigivgaliasvhepa   60
DSSP  llhhhllhhhhhhhhhhhhlllleeeeeelleeelllllleeeleeeeelleeeeeelll


DSSP  ----lhhhhhhhhhhLLLLEEEEEELHHHHHhhhhllllllhhhllllllllllLHHHHH
Query ----dffrdeaerimRDSPVIDGHNDLPWQLldmfnnrlqderanlttlagthtNIPKLR   56
ident                     || |                                    
Sbjct srrdaaqvidaggayVSPGLIDTHXHIESSX------------------itpaaYAAAVV  102
DSSP  lllleeeeeelllleEEELEEEEEELHHHHL------------------llhhhHHHHHH


DSSP  HLLEEEEEEEELLlhhhllllHHHHhHHHHHHHHHHHhhlLLLEeelllhhhhhhhhhll
Query AGFVGGQFWSVYTpcdtqnkdAVRRtLEQMDVVHRMCrmyPETFlyvtssagirqafreg  116
ident |  |    |             |                                     
Sbjct ARGVTTIVWDPHE------fgNVHG-VDGVRWAAKAI---ENLP----------------  136
DSSP  LLLEEEEEELLHH------hhHHHL-HHHHHHHHHHH---LLLL----------------


DSSP  lEEEEEEEELHHH---------lLLLHHHHHHHHHL-LEEE-EELLllllllLLLLhhhl
Query kVASLIGVEGGHS---------iDSSLGVLRALYQL-GMRY-LTLThscntpWADNwlvd  165
ident                        |     |  |                           
Sbjct -LRAILLAPSCVPsapglerggaDFDAAILADLLSWpEIGGiAEIX------NXRG----  185
DSSP  -LEEEEEELLLLLllllllllllLLLHHHHHHHHLLlLEEEeEEEL------LHHH----


DSSP  lllllllllLLLHH-HHHHHHHHHHHLLEEELLLLLH--HHHHHHHHHLlllLEELlLLL
Query tgdsepqsqGLSPF-GQRVVKELNRLGVLIDLAHVSV--ATMKATLQLSrapVIFShSSA  222
ident                    |        |          |   |                
Sbjct --------vIERDPrXSGIVQAGLAAEKLVCGHARGLknADLNAFXAAG--vSSDH-ELV  234
DSSP  --------hHLLLHhHHHHHHHHHHHLLEEEELLLLLlhHHHHHHHHLL--lLEEL-LLL


DSSP  LLLllllllLLHHHHHHHhhhlLEEEELLLHhhhlllllllHHHHHHHHHHHHHH-lLHH
Query YSVcasrrnVPDDVLRLVkqtdSLVMVNFYNnyisctnkanLSQVADHLDHIKEV-aGAR  281
ident               ||                                            
Sbjct SGE------DLXAKLRAG----LTIELRGSH----------DHLLPEFVAALNTLghLPQ  274
DSSP  LHH------HHHHHHHLL----LEEEEELLL----------HHHHHHHHHHHHHHllLLL


DSSP  HEEELLLLLlLLLLlllLLLL-lLHHHHHHHHHhllLLHHHHHHHHLHHHHHHHH-----
Query AVGFGGDFDgVPRVpegLEDV-sKYPDLIAELLrrnWTEAEVKGALADNLLRVFE-----  335
ident  |    |    |                                |   |           
Sbjct TVTLCTDDV-FPDD-llQGGGldDVVRRLVRYG---LKPEWALRAATLNAAQRLGrsdlg  329
DSSP  LEEEELLLL-LHHH-hhHLLLhhHHHHHHHHLL---LLHHHHHHHHLHHHHHHHLlllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  335
ident                                                             
Sbjct liaagrradivvfedlngfsarhvlasgravaeggrxlvdiptcdttvlkgsxklplrxa  389
DSSP  llllllllleeeellllllleeeeeelleeeeelleelllllllllhhhllllllllllh


DSSP  ----------------------------hhhhllllllllllllllhhhlllLLLL----
Query ----------------------------aveqasnltqapeeepipldqlggSCRT----  363
ident                                                             
Sbjct ndflvksqgakvrlatidrprftqwgeteadvkdgfvvppegatxisvthrhGXAEpttk  449
DSSP  hhhllllllleeeeeeeellllleeeeeeeeeelleellllleeeeeeelllLLLLllee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  363
ident                                                             
Sbjct tgfltgwgrwngafattvshdshnltvfggnagdxalaanavigtgggxavasegkvtai  509
DSSP  eeeeellllllleeeelllllllleeeeellhhhhhhhhhhhhhllleeeeeelleeeee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  363
ident                                                             
Sbjct lplplsglvsdapleevarafedlreavgkvvewqppylvfkacfgatlacnigphqtdx  569
DSSP  eelllllllllllhhhhhhhhhhhhhhhhhhlllllllllhhhhhlllllllllleelll


DSSP  ------llLLLL------
Query ------hyGYSS------  369
ident                   
Sbjct giadvltgKVXEspviev  587
DSSP  leeellllEEELlleeel


No 36: Query=1itqA Sbjct=3ls9A Z-score=12.8

back to top
DSSP  -------------------------------------------lhhhhhhhhhhLLLLEE
Query -------------------------------------------dffrdeaerimRDSPVI   17
ident                                                            |
Sbjct milirgltrvitfddqereledadilidgpkivavgkdlsdrsvsrtidgrgmiALPGLI   60
DSSP  leeeeeeeeeellllllleeeeeeeeeelleeeeeellllllllleeeellleeEEELEE


DSSP  EEEELHHHH----------------------------hhhHHLLLLllhhhlllllllll
Query DGHNDLPWQ----------------------------lldMFNNRLqderanlttlagth   49
ident   |  |                                   |                  
Sbjct NSHQHLYEGamraipqlervtmaswlegvltrsagwwrdgKFGPDV-------irevara  113
DSSP  EEEELHHHHhhlllhhhllllhhhhhhhhhhhhhhhhhllLLLHHH-------hhhhhhh


DSSP  LLHHhHHHLLEEEEEEEELLLhhhllLLHHHhhhHHHHHHHHHHHhllLLEEelllhhhh
Query TNIPkLRAGFVGGQFWSVYTPcdtqnKDAVRrtlEQMDVVHRMCRmypETFLyvtssagi  109
ident         |                            |                      
Sbjct VLLE-SLLGGITTVADQHLFF----pGATAD---SYIDATIEAAT---DLGI--------  154
DSSP  HHHH-HHHLLEEEEEEEELLL----lLLLLL---LHHHHHHHHHH---HHLL--------


DSSP  hhhhhllleEEEEEEELHH-------------hLLLL--HHHHHHHHHLL---------e
Query rqafregkvASLIGVEGGH-------------sIDSS--LGVLRALYQLG---------m  145
ident                                              |              
Sbjct ---------RFHAARSSMTlgkseggfcddlfvEPVDrvVQHCLGLIDQYhepepfgmvr  205
DSSP  ---------EEEEEELLLLllhhhlllllhhhlLLHHhhHHHHHHHHHHHllllllllee


DSSP  EEEELLL-LLLLLLLllhhhlllllllllllllhhHHHHHHHHHHHLLEEELLL------
Query RYLTLTH-SCNTPWAdnwlvdtgdsepqsqglspfGQRVVKELNRLGVLIDLAH------  198
ident   |         |                                  |            
Sbjct IALGPCGvPYDKPEL--------------------FEAFAQMAADYDVRLHTHFyeplda  245
DSSP  EEELLLLlLLLLHHH--------------------HHHHHHHHHHHLLEEEEEEllllhh


DSSP  ---------lLHHHHH--HHHHhllLLLEElLLLLLllllllllLLHHHHHHHHHHLLEE
Query ---------vSVATMK--ATLQlsrAPVIFsHSSAYsvcasrrnVPDDVLRLVKQTDSLV  247
ident                            |                 |              
Sbjct gmsdhlygmtPWRFLEkhGWAS---DRVWL-AHAVV--------PPREEIPEFADAGVAI  293
DSSP  hhhhhhhlllHHHHHHhlLLLL---LLEEE-EELLL--------LLHHHHHHHHHHLLEE


DSSP  EEL--LLHHHHLLlllllhhhhhhHHHHHHHHLLhhHEEELLLLLLLllllllLLLLlLH
Query MVN--FYNNYISCtnkanlsqvadHLDHIKEVAGarAVGFGGDFDGVprvpegLEDVsKY  305
ident                                      ||||                   
Sbjct AHLiaPDLRMGWG---------laPIREYLDAGI--TVGFGTTGSAS------NDGG-NL  335
DSSP  EELhhHHHHLLLL---------llLHHHHHHLLL--EEEELLLLLLL------LLLL-LH


DSSP  HHHHHHHHHL-----------LLLHHHHHHHHLHHHHH-HHHH-----------------
Query PDLIAELLRR-----------NWTEAEVKGALADNLLR-VFEA-----------------  336
ident                           |                                 
Sbjct LGDLRLAALAhrpadpnepekWLSARELLRMATRGSAEcLGRPdlgvleegraadiacwr  395
DSSP  HHHHHHHHHHlhhhllllhhhLLLHHHHHHHLLHHHHHhLLLLlllllllllllleeeee


DSSP  -------------------------hhhllllllllllllllhhhlllllllllllll
Query -------------------------veqasnltqapeeepipldqlggscrthygyss  369
ident                                                           
Sbjct ldgvdrvgvhdpaiglimtglsdraslvvvngqvlvenerpvladlerivanttalip  453
DSSP  lllhhhlllllhhhhhhhlllllllleeeelleeeeelleellllhhhhhhhhhhhll


No 37: Query=1itqA Sbjct=4c5yA Z-score=12.8

back to top
DSSP  -----------------------------------------------lhhhhhhhhhhLL
Query -----------------------------------------------dffrdeaerimRD   13
ident                                                             
Sbjct deakvtiiyagllipgdgeplrnaalvisdkiiafvgseadipkkylrstqsthrvpvLM   60
DSSP  lllleeeeeeeeellllllleeeeeeeeelleeeeeeehhhllhhhhhhllleeeeeeEE


DSSP  LLEEEEEELHHhhHHHH----------HLLLLllhhHLLLlllllllLHHHHHHLLEEEE
Query SPVIDGHNDLPwqLLDM----------FNNRLqderANLTtlagthtNIPKLRAGFVGGQ   63
ident     | |        |                    | |                     
Sbjct PGLWDCHMHFG--GDDDyyndytsglaTHPAS--sgARLA------rGCWEALQNGYTSY  110
DSSP  ELEEEEEELLL--LLLLlllllhhhhhLLHHH--hhHHHH------hHHHHHHHLLEEEE


DSSP  EEEELllhhhllllhhhhhhhHHHHHHHHHHHLLLLEeelllhhhhhhhhhlllEEEEEE
Query FWSVYtpcdtqnkdavrrtleQMDVVHRMCRMYPETFlyvtssagirqafregkVASLIG  123
ident                          |                                  
Sbjct RDLAG----------------YGCEVAKAINDGTIVG-----------------PNVYSS  137
DSSP  EELLL----------------LHHHHHHHHHLLLLLL-----------------LEEEEL


DSSP  -EELHH----------------------------------HLLL----LHHHHHHHHHLL
Query -VEGGH----------------------------------SIDS----SLGVLRALYQLG  144
ident                                          |           |     |
Sbjct gAALSQtaghgdifalpagevlgsygvmnprpgywgagplCIADgveeVRRAVRLQIRRG  197
DSSP  lLEEELlllllllllllhhhhhhhhlllllllllllllleEELLlhhhHHHHHHHHHHHL


DSSP  EEEEELLlllllllLLLHHhllLLLLlllLLLL-HHHHHHHHHHHHHLLEEELLLLLHHH
Query MRYLTLThscntpwADNWLvdtGDSEpqsQGLS-PFGQRVVKELNRLGVLIDLAHVSVAT  203
ident               |        |        |       | |  |            | 
Sbjct AKVIXVM-------ASGGV-msRDDNpnfAQFSpEELKVIVEEAARQNRIVSAHVHGKAG  249
DSSP  LLLEEEE-------LLLLL-llLLLLlllLLLLhHHHHHHHHHHHHLLLLEEEEELLHHH


DSSP  HHHHHHHLlllLEELlLLLLllllllllLLHHHHHHHHHHLLEEEEL-LLHHhhlLLLL-
Query MKATLQLSrapVIFShSSAYsvcasrrnVPDDVLRLVKQTDSLVMVN-FYNNyisCTNK-  261
ident   |                |            |  | |    |                 
Sbjct IMAAIKAG--cKSLE-HVSY--------ADEEVWELMKEKGILYVATrSVIE--iFLASn  296
DSSP  HHHHHHHL--lLEEE-ELLL--------LLHHHHHHHHHHLLEEELLhHHHH--hHHHHl


DSSP  -------------llhhhhhHHHHHHHHHLLhhHEEELLLLLlllllllllllLLLHhHH
Query -------------anlsqvaDHLDHIKEVAGarAVGFGGDFDgvprvpegledVSKYpDL  308
ident                                      | |                    
Sbjct geglvkeswaklqaladshlKAYQGAIKAGV--TIALGTDTA---------pgGPTA-LE  344
DSSP  lllllllhhhlllhhhhhhhHHHHHHHHLLL--LEELLLLLL---------llLLLH-HH


DSSP  HHHH-hhlLLLHHHHHHHHLHHHHHHHhHHHH----------------------------
Query IAEL-lrrNWTEAEVKGALADNLLRVFeAVEQ----------------------------  339
ident           |  |   |   |                                      
Sbjct LQFAvergGMTPLEAIKAATANAPLSV-GPQApltgqlregyeadvialeenpledikvf  403
DSSP  HHHHhhllLLLHHHHHHHHLLLHHHHH-HHHLllllllllllllleeeelllllllhhhh


DSSP  ---llllllllllllllhhhlllllllllllll
Query ---asnltqapeeepipldqlggscrthygyss  369
ident                                  
Sbjct qepkavthvwkggklfkgpgigpwgedarnpfl  436
DSSP  hlhhheeeeeelleeeellllllllllllllll


No 38: Query=1itqA Sbjct=1j5sA Z-score=12.8

back to top
DSSP  ------------lHHHHHHHHHHLlLLEEEEEELHHhhhhhhhllllllhhhLLLLL---
Query ------------dFFRDEAERIMRdSPVIDGHNDLPwqlldmfnnrlqderaNLTTL---   45
ident                           |  | || |                         
Sbjct hmflgedylltnrAAVRLFNEVKD-LPIVDPHNHLD-----------akdivENKPWndi   48
DSSP  llllllllllllhHHHHHHHHHLL-LLEEELLLLLL-----------hhhhhHLLLLllh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------   45
ident                                                             
Sbjct wevegatdhyvwelmrrcgvseeyitgsrsnkekwlalakvfprfvgnptyewihldlwr  108
DSSP  hhhhllllhhhhhhhhhllllhhhllllllhhhhhhhhhhhhhhhlllhhhhhhhhhhhh


DSSP  -----------------------lllllLHHHHHHLLEEEEEEEELllhhhllllhhhHH
Query -----------------------agthtNIPKLRAGFVGGQFWSVYtpcdtqnkdavrRT   82
ident                                 ||   |                      
Sbjct rfnikkviseetaeeiweetkkklpemtPQKLLRDMKVEILCTTDD------------PV  156
DSSP  hllllllllhhhhhhhhhhhhhhlllllHHHHHHHLLEEEEELLLL------------LL


DSSP  HHhHHHHHHHHHhLLLLeeelllhhhhhhhhhlllEEEEEEEELHHH-------------
Query LEqMDVVHRMCRmYPETflyvtssagirqafregkVASLIGVEGGHS-------------  129
ident                |                   |  |                     
Sbjct ST-LEHHRKAKE-AVEG------------------VTILPTWRPDRAmnvdkegwreyve  196
DSSP  LL-LHHHHHHHH-HLLL------------------LEEELLLLLHHHhllllllhhhhhh


DSSP  ----------------lllLHHHHHHHHHLLEEEEELLlllllllllLHHH---------
Query ----------------idsSLGVLRALYQLGMRYLTLThscntpwadNWLV---------  164
ident                               |                             
Sbjct kmgerygedtstldgflnaLWKSHEHFKEHGCVASDHA---------LLEPsvyyvdenr  247
DSSP  hhhhhhllllllhhhhhhhHHHHHHHHHLLLLLEEEEE---------ELLLllllllhhh


DSSP  ------------lllllLLLLllLLHHHHHHHHHHHHHLLEEELLL--------------
Query ------------dtgdsEPQSqgLSPFGQRVVKELNRLGVLIDLAH--------------  198
ident                  |              |          |                
Sbjct aravhekafsgekltqdEIND-yKAFMMVQFGKMNQETNWVTQLHIgalrdyrdslfktl  306
DSSP  hhhhhhhhlllllllhhHHHH-hHHHHHHHHHHHHHHHLLEEEEEEleellllhhhhhhl


DSSP  -------------lLHHHHHHHHHHL--LLLLEEllLLLLLLllllllLLHHHHHHHHHH
Query -------------vSVATMKATLQLS--RAPVIFshSSAYSVcasrrnVPDDVLRLVKQT  243
ident                       |                                     
Sbjct gpdsggdistnflrIAEGLRYFLNEFdgKLKIVL--YVLDPT------HLPTISTIARAF  358
DSSP  llllllleelllllHHHHHHHHHHHLllLLLEEE--EELLHH------HHHHHHHHHHHL


DSSP  L-LEEEELLlHHHHllllllLHHHHHHHHHHHHHHLLHHHE-EELLLLLlllllllllLL
Query D-SLVMVNFyNNYIsctnkaNLSQVADHLDHIKEVAGARAV-GFGGDFDgvprvpeglED  301
ident     |                      ||     |       |   |             
Sbjct PnVYVGAPW-WFND------SPFGMEMHLKYLASVDLLYNLaGMVTDSR-------klLS  404
DSSP  LlEEELLLL-LLLL------LHHHHHHHHHHHHLLLLHHHLlLLLLLLL-------llLH


DSSP  LLL-HHHHHHHHHHLL------------lLHHHHHHHHLHHHHHHHHhhhhlllllllll
Query VSK-YPDLIAELLRRN------------wTEAEVKGALADNLLRVFEaveqasnltqape  348
ident            |                     ||    |     |              
Sbjct FGSrTEMFRRVLSNVVgemvekgqipikeARELVKHVSYDGPKALFF-------------  451
DSSP  HHHhHHHHHHHHHHHHhhhhhlllllhhhHHHHHHHHHLHHHHHHHL-------------


DSSP  lllllhhhlllllllllllll
Query eepipldqlggscrthygyss  369
ident                      
Sbjct ---------------------  451
DSSP  ---------------------


No 39: Query=1itqA Sbjct=3gg7A Z-score=12.6

back to top
DSSP  lhhhhhhhhhhlllLEEEEEELHHHHHHhhhllllllhhhlllllllllLLHHhHHHLLE
Query dffrdeaerimrdsPVIDGHNDLPWQLLdmfnnrlqderanlttlagthTNIPkLRAGFV   60
ident                 || |  |                                     
Sbjct --------------SLIDFHVHLDLYPD------------------pvaVARA-CEERQL   27
DSSP  --------------LLEEEEELHHHLLL------------------hhhHHHH-HHHLLL


DSSP  eEEEEEELLlhhhllllhhhhhhhHHHHHHHHHhhllLLEEelllhhhhhhhhhllleEE
Query gGQFWSVYTpcdtqnkdavrrtleQMDVVHRMCrmypETFLyvtssagirqafregkvAS  120
ident         |                                                   
Sbjct -TVLSVTTT-------------paAWRGTLALA----AGRP-----------------HV   52
DSSP  -EEEELLLL-------------hhHHHHHHHHH----LLLL-----------------LE


DSSP  EEEEE-LHHH---lLLLHHHHHHHHHLLEEEEELLlllllllllLHHHlllLLLLLLLll
Query LIGVE-GGHS---iDSSLGVLRALYQLGMRYLTLThscntpwadNWLVdtgDSEPQSQgl  176
ident                  |                                          
Sbjct WTALGfHPEVvserAADLPWFDRYLPETRFVGEVG--------lDGSP---SLRGTWTqq  101
DSSP  EELLLlLHHHllllHHHLHHHHHHHHHLLEEEEEE--------lLLLH---HHHHHHHhh


DSSP  LHHHHHHHHHHHHH-LLEEELLLL-LHHHHHHHHHHLL--LLLEElLLLLlllllllllL
Query SPFGQRVVKELNRL-GVLIDLAHV-SVATMKATLQLSR--APVIFsHSSAysvcasrrnV  232
ident     |          |                 |         |  |             
Sbjct FAVFQHILRRCEDHgGRILSIHSRrAESEVLNCLEANPrsGTPIL-HWYS---------G  151
DSSP  HHHHHHHHHHHHHLlLEEEEEELLlLHHHHHHHHHHLHhhEEEEE-ELLL---------L


DSSP  LHHHHHHHHHHLLEEEELLLhhhhlllllllhhhHHHH--HHHHHHHLLHHHEEELLLLL
Query PDDVLRLVKQTDSLVMVNFYnnyisctnkanlsqVADH--LDHIKEVAGARAVGFGGDFD  290
ident     ||          |                                   |    |  
Sbjct SVTELRRAISLGCWFSVGPT--------------MVRTqkGAALIRSMPRDRVLTETDGP  197
DSSP  LHHHHHHHHHLLLEEEELHH--------------HHLLhhHHHHHHHLLHHHEEELLLLL


DSSP  LLllLLLL-lLLLLLHHHHHHHHHH-LLLL-HHHHHHHhLHHHHHHHHHhhhllllllll
Query GVprVPEG-lEDVSKYPDLIAELLR-RNWT-EAEVKGAlADNLLRVFEAveqasnltqap  347
ident        |              |                  |  |               
Sbjct FL--ELDGqaALPWDVKSVVEGLSKiWQIPaSEVERIV-KENVSRLLGT-----------  243
DSSP  LL--EELLeeLLHHHHHHHHHHHHHhHLLLhHHHHHHH-HHHHHHHHHL-----------


DSSP  llllllhhhlllllllllllll
Query eeepipldqlggscrthygyss  369
ident                       
Sbjct ----------------------  243
DSSP  ----------------------


No 40: Query=1itqA Sbjct=1a5kC Z-score=12.3

back to top
DSSP  ----------------------LHHH----------------------------------
Query ----------------------DFFR----------------------------------    4
ident                                                             
Sbjct snisrqayadmfgptvgdkvrlADTElwieveddlttygeevkfgggkvirdgmgqgqml   60
DSSP  leeehhhhhhhhlllllleeelLLLLleeelleellllllllllllllllllllllllll


DSSP  ---------------------------------------------------------hhh
Query ---------------------------------------------------------dea    7
ident                                                             
Sbjct aadcvdlvltnalivdhwgivkadigvkdgrifaigkagnpdiqpnvtipigaateviaa  120
DSSP  hhhllleeeeeeeeeelleeeeeeeeeelleeeeeeleellllllllleellllleeeel


DSSP  hhhhLLLLEEEEEELhHHHHhhhhllllllhhhllllllllLLLHhHHHHLLEEEEEEEE
Query erimRDSPVIDGHNDlPWQLldmfnnrlqderanlttlagtHTNIpKLRAGFVGGQFWSV   67
ident          || |                                       |       
Sbjct egkiVTAGGIDTHIH-WICP---------------------QQAE-EALVSGVTTMVGGG  157
DSSP  llleEEELEEEEEEE-LLLL---------------------LHHH-HHHHHLEEEEEEEL


DSSP  lllhhhllllhhhhHHHHHHHHHHHHhhLLLLeeelllhhhhhhhhhlllEEEEEEEELH
Query ytpcdtqnkdavrrTLEQMDVVHRMCrmYPETflyvtssagirqafregkVASLIGVEGG  127
ident                                                   |       | 
Sbjct tgpaagthattctpGPWYISRMLQAA--DSLP------------------VNIGLLGKGN  197
DSSP  llllhhhhhlllllHHHHHHHHHHHH--LLLL------------------LEEEEEEELL


DSSP  HhllLLHHHHHHHHHLLEEEEELLLLLL-LLLLllhhhlllllllllllllhhHHHHHHH
Query HsidSSLGVLRALYQLGMRYLTLTHSCN-TPWAdnwlvdtgdsepqsqglspfGQRVVKE  186
ident     |    ||     |   |        || |                           
Sbjct V---SQPDALREQVAAGVIGLEIHEDWGaTPAA--------------------IDCALTV  234
DSSP  L---LLHHHHHHHHHHLLLEEEEEHHHLlLHHH--------------------HHHHHHH


DSSP  HHHHLLEEElLLLL-------HHHHHHHHHHLllLLEElLLLLLllllLLLL---lLHHH
Query LNRLGVLIDlAHVS-------VATMKATLQLSraPVIFsHSSAYsvcaSRRN---vPDDV  236
ident            |         |    |                                 
Sbjct ADEMDIQVA-LHSDtlnesgfVEDTLAAIGGR--TIHT-FHTEG----AGGGhapdIITA  286
DSSP  HHHHLLEEE-EELLlllllllHHHHHHHHLLL--LEEE-LLLLL----LLLLllllHHHH


DSSP  HHHhhhHLLEEEELLLH--hhhlLLLLL-------------------------lhhhhhH
Query LRLvkqTDSLVMVNFYN--nyisCTNKA-------------------------nlsqvaD  269
ident          |                                                  
Sbjct CAH---PNILPSSTNPTlpytlnTIDEHldmlmvchhldpdiaedvafaesrirretiaA  343
DSSP  HHL---LLEEEEEEHHHllllllHHHHHhhhhhhhhllllllhhhhhlllllllhhhhhH


DSSP  HHHHHHHHLlhhHEEELLLLLLLllllllllLLLLHHHHHHHHHHLL-------------
Query HLDHIKEVAgarAVGFGGDFDGVprvpegleDVSKYPDLIAELLRRN-------------  316
ident         |         |             |            |              
Sbjct EDVLHDLGA---FSLTSSDSQAM-------gRVGEVILRTWQVAHRMkvqrgalaeetgd  393
DSSP  HHHHHHLLL---LLEEELLLLLL-------lLLLLHHHHHHHHHHHHhhhhlllllllll


DSSP  ---lLHHHHHHHHLHHHHHHHH--------------------------------------
Query ---wTEAEVKGALADNLLRVFE--------------------------------------  335
ident                |                                            
Sbjct ndnfRVKRYIAKYTINPALTHGiahevgsievgkladlvvwspaffgvkpatvikggmia  453
DSSP  llhhHHHHHHHLLLHHHHHHLLllllllllllllllleeeelhhhlllllleeeelleee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  335
ident                                                             
Sbjct iapmgdinasiptpqpvhyrpmfgalgsarhhcrltflsqaaaangvaerlnlrsaiavv  513
DSSP  eeeellllllllllllleeeelhhhlhhhhhhhleeeelhhhhhhlhhhhllllleeeel


DSSP  -HHHH------------------llllllllllllllhhhlllllllllllll
Query -AVEQ------------------asnltqapeeepipldqlggscrthygyss  369
ident                                                      
Sbjct kGCRTvqkadmvhnslqpnitvdaqtyevrvdgelitsepadvlpmaqryflf  566
DSSP  lLLLLllhhhllllllllleeelllllleeelleellllllllllllllllll


No 41: Query=1itqA Sbjct=3iacA Z-score=12.3

back to top
DSSP  -----LHHH-------HHHH-HHHLlLLEEEEEELHHhhhhhhhllllllhhhLLLLL--
Query -----DFFR-------DEAE-RIMRdSPVIDGHNDLPwqlldmfnnrlqderaNLTTL--   45
ident        |                   |  | |  |                        
Sbjct atfxtEDFLlkndiarTLYHkYAAP-XPIYDFHCHLS-----------pqeiaDDRRFdn   48
DSSP  lllllLLLLlllhhhhHHHHhLLLL-LLEEELLLLLL-----------hhhhhHLLLLll


DSSP  -----LLLL---------------------------------------------------
Query -----AGTH---------------------------------------------------   49
ident                                                             
Sbjct lgqiwLEGDhykwralrsagvdeslitgketsdyekyxawantvpktlgnplyhwthlel  108
DSSP  hhhhhHLLLlhhhhhhhhllllhhhlllllllhhhhhhhhhhhhhhllllhhhhhhhhhh


DSSP  --------------------------------lLHHHHHHLLEEEEEEEELllhhhllll
Query --------------------------------tNIPKLRAGFVGGQFWSVYtpcdtqnkd   77
ident                                           |                 
Sbjct rrpfgitgtlfgpdtaesiwtqcneklatpafsARGIXQQXNVRXVGTTDD---------  159
DSSP  hlllllllllllhhhhhhhhhhhhhhhllhhhlHHHHHHHLLEEEEELLLL---------


DSSP  hhhhHHHHhHHHHHHHHhLLLLeeelllhhhhhhhhhllLEEEEEEEELHH---------
Query avrrTLEQmDVVHRMCRmYPETflyvtssagirqafregKVASLIGVEGGH---------  128
ident                                                             
Sbjct ---pIDSL-EYHRQIAA-DDSI-----------------DIEVAPSWRPDKvfkieldgf  197
DSSP  ---lLLLL-HHHHHHHH-LLLL-----------------LLEEELLLLLHHhhllllllh


DSSP  --------------------hllLLHHHHHHHHHLLEEEEELLlllllllllLHHH----
Query --------------------sidSSLGVLRALYQLGMRYLTLThscntpwadNWLV----  164
ident                             |      | |                      
Sbjct vdylrkleaaadvsitrfddlrqALTRRLDHFAACGCRASDHG---------IETLrfap  248
DSSP  hhhhhhhhhhhllllllhhhhhhHHHHHHHHHHHLLLLEEEEE---------ELLLllll


DSSP  -----------------llllllLLLLlLLHHHHHHHHHHHHHLLEEELLL---------
Query -----------------dtgdsePQSQgLSPFGQRVVKELNRLGVLIDLAH---------  198
ident                           |                |    |           
Sbjct vpddaqldailgkrlagetlselEIAQfTTAVLVWLGRQYAARGWVXQLHIgairnnntr  308
DSSP  lllhhhhhhhhhhhhllllllhhHHHHhHHHHHHHHHHHHHHHLLEEEEEEleellllhh


DSSP  -----------------lLHHHHHHHHHHL-----LLLLEEllLLLLllllllllLLHHH
Query -----------------vSVATMKATLQLS-----RAPVIFshSSAYsvcasrrnVPDDV  236
ident                           |            |                    
Sbjct xfrllgpdtgfdsigdnnISWALSRLLDSXdvtneLPKTIL--YCLN------prDNEVL  360
DSSP  hhhhhllllllleellllLHHHHHHHHHHHhllllLLEEEE--EELL------hhHHHHH


DSSP  HHHHHHH-------LLEEEELLlHHHHlllllllHHHHHHHHHHHHHHLLH-HHEEELLL
Query LRLVKQT-------DSLVMVNFyNNYIsctnkanLSQVADHLDHIKEVAGA-RAVGFGGD  288
ident                                          |            ||   |
Sbjct ATXIGNFqgpgiagKVQFGSGW-WFND------qKDGXLRQLEQLSQXGLLsQFVGXLTD  413
DSSP  HHHHHHLlllllllLEEELLLL-HHHL------lHHHHHHHHHHHHHHLLHhHLLLLLLL


DSSP  LLllllllllllLLLL-HHHHHHHHHHLL--------------lLHHHHHHHHLHHHHHH
Query FDgvprvpegleDVSK-YPDLIAELLRRN--------------wTEAEVKGALADNLLRV  333
ident                         |                       |      |  | 
Sbjct SR--------sfLSYTrHEYFRRILCNLLgqwaqdgeipddeaxLSRXVQDICFNNAQRY  465
DSSP  LL--------llLLLHhHHHHHHHHHHHHhhhhhlllllllhhhHHHHHHHHHLHHHHHH


DSSP  HHHHhhllllllllllllllhhhlllllllllllll
Query FEAVeqasnltqapeeepipldqlggscrthygyss  369
ident |                                   
Sbjct FTIK--------------------------------  469
DSSP  LLLL--------------------------------


No 42: Query=1itqA Sbjct=3icjA Z-score=12.2

back to top
DSSP  ----------------------------------------------lhhhhhhhhhhLLL
Query ----------------------------------------------dffrdeaerimRDS   14
ident                                                             
Sbjct cmkalingtiytsfspvkkvsglvisnervlyagdsstalriaelaggeiidlkgkfVMP   60
DSSP  leeeeelleeeeeelleeeeleeeeelleeeeeelhhhhhhhhhhhlleeeelllleEEE


DSSP  LEEEEEELHHH-------------------------------------------------
Query PVIDGHNDLPW-------------------------------------------------   25
ident    | |  |                                                   
Sbjct AFFDSHLHLDElgmslemvdlrgvksmeelvervkkgrgriifgfgwdqdelgrwptred  120
DSSP  LEEEEEELHHHhhhhhhleellllllhhhhhhhhhlllllleeeeeelhhhhlllllhhh


DSSP  ------------------------------------------------------hhhhhH
Query ------------------------------------------------------qlldmF   31
ident                                                             
Sbjct ldvidrpvflyrrcfhvavmnskmidllnlkpskdfdestgivreraleesrkiinekiL  180
DSSP  hlllllleeeeelllleeeelhhhhhhhllllllleelllleeehhhhhhhhhhhhhllL


DSSP  LLLLllhhhllllllllllLHHHHHHLLEEEEEEEELllhhhllllhhhhHHHHHHHHHH
Query NNRLqderanlttlagthtNIPKLRAGFVGGQFWSVYtpcdtqnkdavrrTLEQMDVVHR   91
ident                        |    |                               
Sbjct TVKD--------ykhyiesAQEHLLSLGVHSVGFMSV-------------GEKALKALFE  219
DSSP  LHHH--------hhhhhhhHHHHHHHLLEEEEEEEEE-------------LHHHHHHHHH


DSSP  HHHHlLLLEEelllhhhhhhhhhllleEEEEEEElHHHLlllhHHHH---HHHH----lL
Query MCRMyPETFLyvtssagirqafregkvASLIGVEgGHSIdsslGVLR---ALYQ----lG  144
ident   |                                          |              
Sbjct LERE-GRLKM-----------------NVFAYLS-PELL----DKLEelnLGKFegrrlR  256
DSSP  HHHL-LLLLL-----------------EEEEEEL-HHHH----HHHHhhlLLLEellleE


DSSP  EEEEELLllllllllLLHH------HLLL--------LLLLLllLLLHhHHHHHHHHHHH
Query MRYLTLThscntpwaDNWL------VDTG--------DSEPQsqGLSPfGQRVVKELNRL  190
ident      |                                 |            |      |
Sbjct IWGVXLF--------VDGSlgartaLLSEpytdnpttSGELV-mNKDE-IVEVIERAKPL  306
DSSP  EEEEEEE--------LLLLllllllLLLLllllllllLLLLL-lLHHH-HHHHHHHHLLL


DSSP  LLEEELLL---lLHHHHHHHHHHLLLLLEELlLLLLllllllllLLHHHHHHHHHHLLEE
Query GVLIDLAH---vSVATMKATLQLSRAPVIFShSSAYsvcasrrnVPDDVLRLVKQTDSLV  247
ident |            |                              | || |   |      
Sbjct GLDVAVHAigdkAVDVALDAFEEAEFSGRIE-HASL--------VRDDQLERIKELKVRI  357
DSSP  LLEEEEEEllhhHHHHHHHHHHHHLLLLEEE-ELLL--------LLHHHHHHHHHHLLEE


DSSP  EEL-LLHHhHLLLL----lllhhhhhhHHHHHHHHLlhhHEEELLLLLLllllllllLLL
Query MVN-FYNNyISCTN----kanlsqvadHLDHIKEVAgarAVGFGGDFDGvprvpeglEDV  302
ident                             |            ||  |           |  
Sbjct SAQpHFIV-SDWWIvnrvgeerakwayRLKTLSSIT---KLGFSTDSPI--------EPA  405
DSSP  EELlLHHH-HLLLHhhhhhhhhhhhllLHHHHHHHL---LEEELLLLLL--------LLL


DSSP  LlHHHHHHHHHHL-------lLLHHHHHHHHLHHHHHHHHhhhhllllllllllllllhh
Query SkYPDLIAELLRR-------nWTEAEVKGALADNLLRVFEaveqasnltqapeeepipld  355
ident       |     |            |           |                      
Sbjct D-PWVSIDAAVNRyvvdpgerVSREEALHLYTHGSAQVTL----------aedlgklerg  454
DSSP  L-HHHHHHHHHHLllllhhhlLLHHHHHHHLLHHHHHHLL----------llllllllll


DSSP  hlllllllllllll
Query qlggscrthygyss  369
ident               
Sbjct fraeyiildrdplk  468
DSSP  lllleeeellllll


No 43: Query=1itqA Sbjct=2ogjA Z-score=12.2

back to top
DSSP  ------------------------------------------lhhhhhhhhhhLLLLEEE
Query ------------------------------------------dffrdeaerimRDSPVID   18
ident                                                            |
Sbjct qapilltnvkpvgfgkgasqsstdiliggdgkiaavgsalqapadtqridaafISPGWVD   60
DSSP  llleeeeeeeellllllllllleeeeellllleeeeelllllllleeelllleEEELEEE


DSSP  EEELHHhHHHHHhllllllhhhlllllllLLLLHhhHHHLLEEEEEEEELLlhhhllllh
Query GHNDLPwQLLDMfnnrlqderanlttlagTHTNIpkLRAGFVGGQFWSVYTpcdtqnkda   78
ident  |                                       |                  
Sbjct LHVHIW-HGGTD---------------isIRPSE-cGAERGVTTLVDAGSA--------g   95
DSSP  EEELLL-LLLLL---------------llLLHHH-lLHHHLEEEEEEELLL--------l


DSSP  HHHHHHHHHHHHHHHhhlllleeelllhhhhhhhhhllleEEEEEEeLHHH---------
Query VRRTLEQMDVVHRMCrmypetflyvtssagirqafregkvASLIGVeGGHS---------  129
ident                                                   |         
Sbjct EANFHGFREYIIEPS-----------------------reRIKAFL-NLGSiglvacnrv  131
DSSP  LLLHHHHHHHLLLLL-----------------------llEEEEEE-ELLLlllllllll


DSSP  ------lLLLHHHHHHHHHLL---EEEEELLlllllllllLHHHlllllllLLLLLlhhh
Query ------iDSSLGVLRALYQLG---MRYLTLThscntpwadNWLVdtgdsepQSQGLspfg  180
ident        |  |      |         |               |                
Sbjct pelrdikDIDLDRILECYAENsehIVGLXVR---------ASHV----itgSWGVT--pv  176
DSSP  lllllhhHLLHHHHHHHHHLLlllEEEEEEE---------ELHH----hhlLLLLH--hh


DSSP  HHHHHHHHHHLLEEELLL-----lLHHHHHHHHhhllLLLEElLLLLllLLLLL----ll
Query QRVVKELNRLGVLIDLAH-----vSVATMKATLqlsrAPVIFsHSSAysVCASR----rn  231
ident     |    | |                                                
Sbjct KLGKKIAKILKVPXXVHVgeppalYDEVLEILG----PGDVV-THCF-nGKSGSsixede  230
DSSP  HHHHHHHHHHLLLEEEEEllllllHHHHHHHLL----LLLEE-ELLL-lLLLLLlllllh


DSSP  lLHHHHHHHhhHLLEEEELLLHHHHlllllllhhhHHHHHHHHH-HHLLhhHEEELLLLL
Query vPDDVLRLVkqTDSLVMVNFYNNYIsctnkanlsqVADHLDHIK-EVAGarAVGFGGDFD  290
ident                                                          |  
Sbjct dLFNLAERC--EGIRLDIGHGGASF----------SFKVAEAAIaRGLL--PFSISTDLH  276
DSSP  hHHHHHHHL--LLLEEELLLLLLLL----------LHHHHHHHHhLLLL--LLLLLLLLL


DSSP  lLLLLLLLLLlllLHHHHHHHHHHLLLLHHHHHHHHLHHHHHHHH---------------
Query gVPRVPEGLEdvsKYPDLIAELLRRNWTEAEVKGALADNLLRVFE---------------  335
ident                      ||        |  |   |   |                 
Sbjct -GHSXNFPVW---DLATTXSKLLSVDXPFENVVEAVTRNPASVIRldxenrldvgqradf  332
DSSP  -LLLLLLLLL---LHHHHHHHHHHLLLLHHHHHHLLLHHHHHHLLlllllllllllllee


DSSP  -------------hhhhllllllllllllllhhhlllllllllllll
Query -------------aveqasnltqapeeepipldqlggscrthygyss  369
ident                                                
Sbjct tvfdlvdadleatdsngdvsrlkrlfepryavigaeaiaasryipra  379
DSSP  eeeeeeeeeeeeellllleeeeeeeeeeeeeeelleeeellllllll


No 44: Query=1itqA Sbjct=1j6pA Z-score=11.3

back to top
DSSP  -------------------------------------lhhhhhhhhhhlLLLEEEEEELH
Query -------------------------------------dffrdeaerimrDSPVIDGHNDL   23
ident                                                         |   
Sbjct hhxiignclilkdfssepfwgaveiengtikrvlqgevkvdldlsgklvXPALFNTHTHA   60
DSSP  leeeeeeeeelllllllleeeeeeeelleeeeeeelllllleellleeeEELEEEEEELH


DSSP  HH---------------------hhHHHHLLLLllhhhlllllllllLLHHHHHHLLEEE
Query PW---------------------qlLDMFNNRLqderanlttlagthTNIPKLRAGFVGG   62
ident |                         |                                |
Sbjct PXtllrgvaedlsfeewlfskvlpiEDRLTEKX--------ayygtiLAQXEXARHGIAG  112
DSSP  HHhhhllllllllhhhhhhllhhhhHLLLLHHH--------hhhhhhHHHHHHHLLLEEE


DSSP  EEEEELllhhhllllhhhhhhhHHHHHHHHHHhllLLEEelllhhhhhhhhhllleEEEE
Query QFWSVYtpcdtqnkdavrrtleQMDVVHRMCRmypETFLyvtssagirqafregkvASLI  122
ident                                |                          | 
Sbjct FVDXYF----------------HEEWIAKAVR---DFGX-----------------RALL  136
DSSP  EEEEEL----------------LHHHHHHHHH---HHLL-----------------EEEE


DSSP  EEELH-------HHLLllhhHHHHHHHLL--------EEEEELLLLLLLlllllhhhlll
Query GVEGG-------HSIDsslgVLRALYQLG--------MRYLTLTHSCNTpwadnwlvdtg  167
ident                         ||                                  
Sbjct TRGLVdsngddgGRLE----ENLKLYNEWngfegrifVGFGPHSPYLCS-----------  181
DSSP  EEEELlllllllLHHH----HHHHHHHHHllhhhleeEEEEELLLLLLL-----------


DSSP  lllllllllLHHHHHHHHHHHHHLLEEELLL-------lLHHHHH-HHHHhlLLLLEElL
Query dsepqsqglSPFGQRVVKELNRLGVLIDLAH-------vSVATMK-ATLQlsRAPVIFsH  219
ident               ||      |                         |       |   
Sbjct ---------EEYLKRVFDTAKSLNAPVTIHLyetskeeyDLEDILnIGLK--EVKTIA-A  229
DSSP  ---------HHHHHHHHHHHHHHLLLEEEEEllllllllLLHHHHlLLLL--LLLEEE-E


DSSP  LLLLllllllllLLHHHHHHHHHHLLEEEEL--LLHHHHLLlllllhhhhhhHHHHHHHH
Query SSAYsvcasrrnVPDDVLRLVKQTDSLVMVN--FYNNYISCtnkanlsqvadHLDHIKEV  277
ident              |       |     |  |                           | 
Sbjct HCVH--------LPERYFGVLKDIPFFVSHNpaSNLKLGNG---------iaPVQRXIEH  272
DSSP  ELLL--------LLHHHHHHHLLLLEEEEELhhHHHHLLLL---------llLHHHHHHL


DSSP  LLhhHEEELLLLLLLllllllLLLLlLHHHHHHHHHH-------LLLLHHHHHHHHLHHH
Query AGarAVGFGGDFDGVprvpegLEDVsKYPDLIAELLR-------RNWTEAEVKGALADNL  330
ident      |  | |                                 ||              
Sbjct GX--KVTLGTDGAAS------NNSL-NLFFEXRLASLlqkaqnpRNLDVNTCLKXVTYDG  323
DSSP  LL--EEEELLLLLLL------LLLL-LHHHHHHHHHHhhhllllLLLLHHHHHHHHLHHH


DSSP  HHHHH---------------------------------------------hhhhllllll
Query LRVFE---------------------------------------------aveqasnltq  345
ident                                                             
Sbjct AQAXGfksgkieegwnadlvvidldlpexfpvqniknhlvhafsgevfatxvagkwiyfd  383
DSSP  HHHHLllllllllllllleeeeelllhhhllhhhhhhhhhhllllllleeeelleeeeel


DSSP  llllllllhhhlllllllllllll
Query apeeepipldqlggscrthygyss  369
ident                         
Sbjct geyptidseevkrelariekelys  407
DSSP  lllllllhhhhhhhhhhhhhhhhl


No 45: Query=1itqA Sbjct=2imrA Z-score=11.3

back to top
DSSP  ---------------------------------------------lhhhHHHHhhhlLLL
Query ---------------------------------------------dffrDEAErimrDSP   15
ident                                                            |
Sbjct htprlltcdvlytgaqspggvvvvgetvaaaghpdelrrqyphaaeeraGAVI----APP   56
DSSP  lleeeeeeleeelleelleeeeeelleeeeeelhhhhhhhlllleeeelLLEE----LLL


DSSP  EEEEEELHHH-----------------------HHHHHhllllllhhhllllllllLLLH
Query VIDGHNDLPW-----------------------QLLDMfnnrlqderanlttlagtHTNI   52
ident     |  |                                                    
Sbjct PVNAHTHLDMsayefqalpyfqwipevvirgrhLRGVA---------------aaqAGAD  101
DSSP  LLEEEEELLLlhhhhhhlhhhhllhhhhhhhllLLHHH---------------hhhHHHH


DSSP  hHHHHLLEEEEEEEELllhhhllllhhhhHHHHHHHHHHHHhhlllleeelllhhhhhhh
Query pKLRAGFVGGQFWSVYtpcdtqnkdavrrTLEQMDVVHRMCrmypetflyvtssagirqa  112
ident   |     ||    |                | ||                         
Sbjct -TLTRLGAGGVGDIVW-------------APEVMDALLARE-------------------  128
DSSP  -HHHHLLLLLEEEEEL-------------LHHHHHHHHLLL-------------------


DSSP  hhllLEEEEEEEELHH----hllLLHHHHHHHHHLL--------eEEEELLLlLLLLLll
Query fregKVASLIGVEGGH----sidSSLGVLRALYQLG--------mRYLTLTHsCNTPWad  160
ident             |                |                 |            
Sbjct ----DLSGTLYFEVLNpfpdkadEVFAAARTHLERWrrlerpglrLGLSPHTpFTVSH--  182
DSSP  ----LLLEEEEEEELLllhhhhhHHHHHHHHHHHHHhlllllleeEEEEELLlLLLLH--


DSSP  lhhhlllllllllllllHHHHHHHHHHHHHLLEEELLL----------------------
Query nwlvdtgdsepqsqglsPFGQRVVKELNRLGVLIDLAH----------------------  198
ident                               |                             
Sbjct -----------------RLMRLLSDYAAGEGLPLQIHVaehptelemfrtgggplwdnrm  225
DSSP  -----------------HHHHHHHHHHHHHLLLLEEEElllhhhhhhhhhlllllhhhll


DSSP  ---------------------lLHHHHH-HHHHhllLLLEELlLLLLllllllllLLHHH
Query ---------------------vSVATMK-ATLQlsrAPVIFShSSAYsvcasrrnVPDDV  236
ident                                |    |                  |  | 
Sbjct palyphtlaevigrepgpdltpVRYLDElGVLA---ARPTLV-HMVN--------VTPDD  273
DSSP  hhhllllhhhhhlllllllllhHHHHHHhLLHH---HLLEEE-ELLL--------LLHHH


DSSP  HHHHHHHLLEEEEL--LLHHHHLLlllllhhhhhHHHHHHHHHLLhhHEEELLLLLLLll
Query LRLVKQTDSLVMVN--FYNNYISCtnkanlsqvaDHLDHIKEVAGarAVGFGGDFDGVpr  294
ident    |      |                                     |  | |      
Sbjct IARVARAGCAVVTCprSNHHLECG---------tFDWPAFAAAGV--EVALGTDSVAS--  320
DSSP  HHHHHHHLLLEEELhhHHHHLLLL---------lLLHHHHHHLLL--LEEELLLLHHH--


DSSP  lllllLLLLlHHHHHHHHHH--LLLLHHHHHHHHLHHHHHHhhhhhhlllllllllllll
Query vpeglEDVSkYPDLIAELLR--RNWTEAEVKGALADNLLRVfeaveqasnltqapeeepi  352
ident      |                          |      ||                   
Sbjct ----gETLN-VREEVTFARQlyPGLDPRVLVRAAVKGGQRV------------vgtpflr  363
DSSP  ----hLLLL-LHHHHHHHHHhlLLLLHHHHHHHHHHHHHHH------------hllllll


DSSP  lhhhlllllllllllll
Query pldqlggscrthygyss  369
ident                  
Sbjct rgetwqegfrwelsrdl  380
DSSP  llllllhhhlhhhllll


No 46: Query=1itqA Sbjct=2uz9A Z-score=11.0

back to top
DSSP  -------------------------------------------------------lhhhh
Query -------------------------------------------------------dffrd    5
ident                                                             
Sbjct plahifrgtfvhstwtcpmevlrdhllgvsdsgkivfleeasqqeklakewcfkpceire   60
DSSP  llleeeeeeeeellllllleeeeeeeeeellllleeeeeehhhhhhhhhhhlllhhheee


DSSP  hhhhhhlLLLEEEEEELHHHHH-------------------------hhhHLLLLllhhh
Query eaerimrDSPVIDGHNDLPWQL-------------------------ldmFNNRLqdera   40
ident             | |                                             
Sbjct lshheffMPGLVDTHIHASQYSfagssidlpllewltkytfpaehrfqniDFAEE-----  115
DSSP  llllleeEELEEEEEEEHHHHHhllllllllhhhhhhhlhhhhhhhhhlhHHHHH-----


DSSP  lllllllllLLHHhHHHLLEEEEEEEELLlhhhllllhhhhHHHHHHHHHHHHHHLLlle
Query nlttlagthTNIPkLRAGFVGGQFWSVYTpcdtqnkdavrrTLEQMDVVHRMCRMYPetf  100
ident                                                             
Sbjct -----vytrVVRR-TLKNGTTTACYFATI------------HTDSSLLLADITDKFG---  154
DSSP  -----hhhhHHHH-HHHLLEEEEEEELLL------------LHHHHHHHHHHHHHHL---


DSSP  eelllhhhhhhhhhlllEEEEEEEELHH----------hlLLLHHHHHHHHHLL------
Query lyvtssagirqafregkVASLIGVEGGH----------siDSSLGVLRALYQLG------  144
ident                       |                   |                 
Sbjct -----------------QRAFVGKVCMDlndtfpeykettEESIKETERFVSEMlqknys  197
DSSP  -----------------LEEEEELEELLlllllllllllhHHHHHHHHHHHHHHhhhlll


DSSP  --EEEEELLLLLLLLLlllhhhlllllllllllllHHHHHHHHHHHHHLLEEELLL----
Query --MRYLTLTHSCNTPWadnwlvdtgdsepqsqglsPFGQRVVKELNRLGVLIDLAH----  198
ident       |   |                                        |        
Sbjct rvKPIVTPRFSLSCSE-------------------TLMGELGNIAKTRDLHIQSHIsenr  238
DSSP  leEEEEEELLHHHLLH-------------------HHHHHHHHHHHHHLLEEEEEElllh


DSSP  -----------llhHHHHHHHHHL--lLLLEElLLLLLllllllllLLHHHHHHHHHHLL
Query -----------vsvATMKATLQLS--rAPVIFsHSSAYsvcasrrnVPDDVLRLVKQTDS  245
ident                                      |             |        
Sbjct deveavknlypsykNYTSVYDKNNlltNKTVM-AHGCY--------LSAEELNVFHERGA  289
DSSP  hhhhhhhhhlllllLHHHHHHHLLlllLLEEE-EELLL--------LLHHHHHHHHHHLL


DSSP  EEEELLL----HHHHlllllllhhhhhhHHHHHHHHLLhhHEEELLLLLLLlllllllLL
Query LVMVNFY----NNYIsctnkanlsqvadHLDHIKEVAGarAVGFGGDFDGVprvpeglED  301
ident                                           | | |  |          
Sbjct SIAHCPNsnlsLSSG-----------flNVLEVLKHEV--KIGLGTDVAGG-------YS  329
DSSP  EEEELHHhhhhLLLL-----------llLHHHHHHLLL--EEEELLLLLLL-------LL


DSSP  LL--LHHHH-HHHH--------hhLLLLHHHHHHHHLHHH-HHHH---------------
Query VS--KYPDL-IAEL--------lrRNWTEAEVKGALADNL-LRVF---------------  334
ident  |                         |  ||                            
Sbjct YSmlDAIRRaVMVSnillinkvneKSLTLKEVFRLATLGGsQALGldgeignfevgkefd  389
DSSP  LLhhHHHHHhHHHHhhhhhlllllLLLLHHHHHHHHLHHHhHHLLlllllllllllllll


DSSP  --------------------hhhhhllllllllllllllhhhlllllllllllll
Query --------------------eaveqasnltqapeeepipldqlggscrthygyss  369
ident                                                        
Sbjct ailinpkasdspidlfygdffgdiseaviqkflylgddrnieevyvggkqvvpfs  444
DSSP  eeeelllllllllllllhhhhlllllhhhhhhhhhllhhheeeeeelleeeelll


No 47: Query=1itqA Sbjct=4rdvB Z-score=10.8

back to top
DSSP  -----------------------------------lhhhhhhhhhhlLLLEEEEEELHH-
Query -----------------------------------dffrdeaerimrDSPVIDGHNDLP-   24
ident                                                       |     
Sbjct saifaerallpegwarnvrfeisadgvlaeirpdanadgaerlggavLPGMPNLHSHAFq   60
DSSP  leeeeeeeeelleeeeeeeeeellllleeeeelllllllleelllleEELEEEEEELHHh


DSSP  ------------------------hhhHHHHLLLLllhhhlllllllllLLHHhHHHLLE
Query ------------------------wqlLDMFNNRLqderanlttlagthTNIPkLRAGFV   60
ident                                                    |        
Sbjct ramaglaevagnpndsfwtwrelmyrmVARLSPEQ-------ieviacqLYIE-MLKAGY  112
DSSP  hhhlllllllllllllhhhhhhhhhhhHLLLLHHH-------hhhhhhhHHHH-HHHHLE


DSSP  EEEEEEELLlhhhlLLLHhhhhHHHHHHHHHHHhhlLLLEeelllhhhhhhhhhlllEEE
Query GGQFWSVYTpcdtqNKDAvrrtLEQMDVVHRMCrmyPETFlyvtssagirqafregkVAS  120
ident        |               |      |                             
Sbjct TAVAEFHYV-hhdlDGRSyadpAELSLRISRAA---SAAG-----------------IGL  151
DSSP  EEEEEEELL-llllLLLLllllLHHHHHHHHHH---HHHL-----------------LEE


DSSP  EEEEELH----------------HHLLllHHHHHHHHHLL---------eEEEELLLLLL
Query LIGVEGG----------------HSIDssLGVLRALYQLG---------mRYLTLTHSCN  155
ident                                    | |              |       
Sbjct TLLPVLYshagfggqpasegqrrFING--SEAYLELLQRLrapleaaghsLGLCFHSLRA  209
DSSP  EEEELLLleeellleellhhhllLLLL--HHHHHHHHHHHhhhhhhhlleELEEELLLLL


DSSP  LLLlllhhhlllllllllllllHHHHHHHHHhHHHLLEEELLL-----------------
Query TPWadnwlvdtgdsepqsqglsPFGQRVVKElNRLGVLIDLAH-----------------  198
ident                            |                                
Sbjct VTP-------------------QQIATVLAA-GHDDLPVHIHIaeqqkevddcqawsgrr  249
DSSP  LLH-------------------HHHHHHHLL-LLLLLLEEEEElllhhhhhhhhhhhlll


DSSP  lLHHHHHHHhhhLLLL-LEELlLLLLllllllllLLHHHHHHHHHHLLEEEELL--LHHH
Query vSVATMKATlqlSRAP-VIFShSSAYsvcasrrnVPDDVLRLVKQTDSLVMVNF--YNNY  255
ident                                                           | 
Sbjct pLQWLYENV---AVDQrWCLV-HATH--------ADPAEVAAMARSGAVAGLCLstEANL  297
DSSP  hHHHHHHHL---LLLLlEEEE-ELLL--------LLHHHHHHHHHHLLEEEELHhhHHHL


DSSP  HLLlllllhhhhhhHHHHHHHHLLhhHEEELLLLLlllllllllLLLLlHHHHHHHHH--
Query ISCtnkanlsqvadHLDHIKEVAGarAVGFGGDFDgvprvpeglEDVSkYPDLIAELL--  313
ident                        |    | | |              |        |   
Sbjct GDG---------ifPATDFLAQGG--RLGIGSDSH---------VSLS-VVEELRWLEyg  336
DSSP  LLL---------llLHHHHHHLLL--EEEELLLLL---------LLLL-HHHHHHHHHhh


DSSP  -------HLLL-------LHHHHHHHHLHHHHHHHH------------------------
Query -------RRNW-------TEAEVKGALADNLLRVFE------------------------  335
ident        |                 |                                  
Sbjct qrlrdrkRNRLyrddqpmIGRTLYDAALAGGAQALGqpigslavgrradllvldgndpyl  396
DSSP  hhhhhllLLLLlllllllHHHHHHHHHHHHHHHHHLllllllllllllleeeellllhhh


DSSP  ---------------------hhhhllllllllllllllhhhlllllllllllll
Query ---------------------aveqasnltqapeeepipldqlggscrthygyss  369
ident                                                        
Sbjct asaegdallnrwlfaggdrqvrdvmvagrwvvrdgrhageersarafvqvlgell  451
DSSP  hllllhhhhhhhhhhllhhheeeeeelleeeelllllllhhhhhhhhhhhhhhhl


No 48: Query=1itqA Sbjct=3ooqA Z-score=9.9

back to top
DSSP  --------------------------------------lhhhhhhhhhhLLLLEEEEEEL
Query --------------------------------------dffrdeaerimRDSPVIDGHND   22
ident                                                        | |  
Sbjct kilfknatvfpitsrpfkgdvlvsngkvekvgeniedpdaeivdltgkfLFPGFVDAHSH   60
DSSP  leeeeeeeellllllleeeeeeeelleeeeeelllllllleeeelllleEEELEEEEEEL


DSSP  HHHHH--hHHHLL-------llllhhhllllllllllLHHHHHHLLEEEEEEEELllhhh
Query LPWQL--lDMFNN-------rlqderanlttlagthtNIPKLRAGFVGGQFWSVYtpcdt   73
ident                                       |    || |             
Sbjct IGLFEegvGYYYSdgneatdpvtphvkaldgfnpqdpAIERALAGGVTSVXIVPG-----  115
DSSP  LLLLLlllLHHHLllllllllllllllhhhhlllllhHHHHHHLLLEEEEEELLL-----


DSSP  llllhhhhhhhhhhhhhHHHHhlllleEELLlhhhhhhhhhllleeeeeeeelhhhllll
Query qnkdavrrtleqmdvvhRMCRmypetfLYVTssagirqafregkvasligvegghsidss  133
ident                              |                              
Sbjct sanpvggqgsvikfrsiIVEE------CIVK-----------------------------  140
DSSP  lllleeeeeeeeellllLHHH------HEEE-----------------------------


DSSP  hhhhhhhhhlLEEEEELL--LLLLllllllhhhlllLLLLL-LLLLLhHHHH--------
Query lgvlralyqlGMRYLTLT--HSCNtpwadnwlvdtgDSEPQ-SQGLSpFGQR--------  182
ident               |                                             
Sbjct ----------DPAGLKXAfgENPK--rvygerkqtpSTRXGtAGVIR-DYFTkvknyxkk  187
DSSP  ----------EEEEEEEEllHHHH--hhhhhlllllLLHHHhHHHHH-HHHHhhhhhhhh


DSSP  -------------------hHHHHHHHLLEEELLL----LLHHHHHHHhHHLLLLLEELl
Query -------------------vVKELNRLGVLIDLAH----VSVATMKATlQLSRAPVIFSh  219
ident                          |                                  
Sbjct kelaqkegkeftetdlkxevGEXVLRKKIPARXHAhradDILTAIRIA-EEFGFNLVIE-  245
DSSP  hhhhhhlllllllllhhhhhHHHHHLLLLLEEEEEllhhHHHHHHHHH-HHHLLLEEEE-


DSSP  LLLLllllllllLLHHhHHHHHHHLLEEEELLLHHhhLLLLlllhhHHHHHHHHHHHHLL
Query SSAYsvcasrrnVPDDvLRLVKQTDSLVMVNFYNNyiSCTNkanlsQVADHLDHIKEVAG  279
ident                            | |         |                    
Sbjct HGTE--------AYKI-SKVLAEKKIPVVVGPLLT--FRTKlelkdLTXETIAKLLKDGV  294
DSSP  ELLL--------HHHH-HHHHHHHLLLEEELLLLL--LLLLhhhllLLLLHHHHHHHLLL


DSSP  hhHEEELLLLLLlllllllllLLLLHHHHHHHHHHLLLLHHHHHHHHLHHHHHHHH----
Query arAVGFGGDFDGvprvpegleDVSKYPDLIAELLRRNWTEAEVKGALADNLLRVFE----  335
ident         |                     |   |    |      |  |          
Sbjct --LIALXCDHPV--------iPLEFATVQAATAXRYGAKEEDLLKILTVNPAKILGledr  344
DSSP  --LEEELLLLLL--------lLHHHHHHHHHHHHHHLLLHHHHHHLLLHHHHHHLLllll


DSSP  ------hhhhllllllllllllllhhhlllllllllllll
Query ------aveqasnltqapeeepipldqlggscrthygyss  369
ident                                         
Sbjct igsiepgkdadlvvwsghpfdxksvvervyidgvevfrre  384
DSSP  llllllllllleeeelllllllllleeeeeelleeeeell


No 49: Query=1itqA Sbjct=3qy6A Z-score=9.5

back to top
DSSP  lhhhhhhhhhhllllEEEEEELHH-----HHHHhhhllllllhhhllllllllllLHHHH
Query dffrdeaerimrdspVIDGHNDLP-----WQLLdmfnnrlqderanlttlagthtNIPKL   55
ident                 || |                                        
Sbjct ---------------MIDIHCHILpamddGAGD----------------sadsieMARAA   29
DSSP  ---------------LEELLLLLLlllllLLLL----------------hhhhhhHHHHH


DSSP  HHLLEEEEEEEELLLHHHllllHHHHHHHHHHHHHHHHHHLL--LLEEElllhhhhhhhh
Query RAGFVGGQFWSVYTPCDTqnkdAVRRTLEQMDVVHRMCRMYP--ETFLYvtssagirqaf  113
ident                                                |            
Sbjct VRQGIRTIIATPHHNNGV----YKNEPAAVREAADQLNKRLIkeDIPLH-----------   74
DSSP  HHLLLLEEELLLEELLLL----LLLLHHHHHHHHHHHHHHHHhlLLLLE-----------


DSSP  hllleeEEEEEELHhhllllhhhhhhhhhlleeeeellllllllllllhhhlllllllll
Query regkvaSLIGVEGGhsidsslgvlralyqlgmryltlthscntpwadnwlvdtgdsepqs  173
ident        | | |                                                
Sbjct ------VLPGQEIR----------------------------------------------   82
DSSP  ------EELLLEEE----------------------------------------------


DSSP  llllhhhHHHHHHH-------hhhLLEEELLLL---LHHHHHHHHHHLL---LLLEELLL
Query qglspfgQRVVKEL-------nrlGVLIDLAHV---SVATMKATLQLSR---APVIFSHS  220
ident          |   |             |                              | 
Sbjct -----iyGEVEQDLakrqllslndTKYILIEFPfdhVPRYAEQLFYDLQlkgYIPVIAHP  137
DSSP  -----llLLHHHHHhllllllhhhLLEEEEELLlllLLLLHHHHHHHHHhllLEEEEELH


DSSP  LLLllllLLLL-lLHHHHHHHHHHlLEEEELLLhhhhlllllLLHHHHHHHHHHHHHHLL
Query SAYsvcaSRRN-vPDDVLRLVKQTdSLVMVNFYnnyisctnkANLSQVADHLDHIKEVAG  279
ident              |     ||                         |         |   
Sbjct ERN----REIRenPSLLYHLVEKG-AASQITSG-----slagIFGKQLKAFSLRLVEANL  187
DSSP  HHL----HHHHhlLHHHHHHHHLL-LEEEEEHH-----hhllLLLHHHHHHHHHHHHLLL


DSSP  hhHEEELLLLLllllllllLLLLlLHHHHHHHHHHLlLLHHHHHHHHlHHHHHH--HHHH
Query arAVGFGGDFDgvprvpegLEDVsKYPDLIAELLRRnWTEAEVKGALaDNLLRV--FEAV  337
ident         |                       |                |          
Sbjct --IHFVASDAH-----nvkTRNF-HTQEALYVLEKE-FGSELPYMLT-ENAELLlrNQTI  237
DSSP  --LLEEELLLL-----lllLLLL-LHHHHHHHHHHH-HLLHHHHHHH-HHHHHHhlLLLL


DSSP  hhllllllllllllllhhhlllllllllllll
Query eqasnltqapeeepipldqlggscrthygyss  369
ident                                 
Sbjct ----------------------frqppqpvkr  247
DSSP  ----------------------llllllllll


No 50: Query=1itqA Sbjct=2a3lA Z-score=8.8

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct qpdpiaadilrkepeqetfvrlnvplevptsdeveaykclqeclelrkryvfqetvapwe   60
DSSP  llllllllllllllllllllllllllllllllllllhhhhhhhhhhhhllllllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct keepfahypqgksdhcfemqdgvvhvfankdakedlfpvadatafftdlhhvlkviaagn  120
DSSP  lllllllllllllllllllllllllllllllllllllllllhhhhhhhhhhhhhhlllhh


DSSP  -----------------------------lhhhhhhhHHHLlLLEEEE-EELH-------
Query -----------------------------dffrdeaeRIMRdSPVIDG-HNDL-------   23
ident                                               |             
Sbjct irtlchrrlvlleqkfnlhlmlnadkeflaqksaphrDFYN-VRKVDThVHHSacmnqkh  179
DSSP  hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhllllLLLL-LLEEEEeEELLllllhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------   23
ident                                                             
Sbjct llrfiksklrkepdevvifrdgtyltlrevfesldltgydlnvdlldvhadkstfhrfdk  239
DSSP  hhhhhhhhhhllllllleeelleeelhhhhhhhhllllllllllllllllllllllllll


DSSP  ---------------hhHHHHH-HLLLLllhhHLLLLlllllLLHHHHHHLLEeEEEEEE
Query ---------------pwQLLDM-FNNRLqderANLTTlagthTNIPKLRAGFVgGQFWSV   67
ident                     |     |                                 
Sbjct fnlkynpcgqsrlreifLKQDNlIQGRF--lgEITKQ-----VFSDLEASKYQ-MAEYRI  291
DSSP  lhhhhllllllhhhhhhLLLLLlLLLLL--hhHHHHH-----HHHHHLLLLLE-EEEEEE


DSSP  LLLhhhlllLHHHHHHHHHHHHH-HHHHhlllleeelllhhhhhhhhhlllEEEEEEEEL
Query YTPcdtqnkDAVRRTLEQMDVVH-RMCRmypetflyvtssagirqafregkVASLIGVEG  126
ident                                                             
Sbjct SIY-----gRKMSEWDQLASWIVnNDLY----------------------sENVVWLIQL  324
DSSP  ELL-----lLLLLHHHHHHHHHHlLLLL----------------------lLLEEEEEEE


DSSP  HH------------hllLLHH-HHHHH---------------hHLLEEEEELLLLlllll
Query GH------------sidSSLG-VLRAL---------------yQLGMRYLTLTHScntpw  158
ident                    |      |                        |        
Sbjct PRlyniykdmgivtsfqNILDnIFIPLfeatvdpdshpqlhvfLKQVVGFDLVDD-----  379
DSSP  ELlhhhhlllllllllhHHHHhHLLHHhhhhhlhhhllllhhhHLLEEEEEEELL-----


DSSP  lllHHHLlllLLLL---------------LLLLLhhHHHHHHHHHHHL----------LE
Query adnWLVDtgdSEPQ---------------SQGLSpfGQRVVKELNRLG----------VL  193
ident                                            |  |             
Sbjct ---ESKP---ERRPtkhmptpaqwtnafnPAFSY-yVYYCYANLYVLNklreskgmttIT  432
DSSP  ---LLLL---LLLLlllllllllllllllLLHHH-hHHHHHHHHHHHHhhhlllllllLE


DSSP  EELLL---lLHHHHHHHHHHLlllLEELlLLLLllllllllLLHH--HHHHHHHHLLEEE
Query IDLAH---vSVATMKATLQLSrapVIFShSSAYsvcasrrnVPDD--VLRLVKQTDSLVM  248
ident                ||                                 |         
Sbjct LRPHSgeagDIDHLAATFLTC---HSIA-HGIN--------LRKSpvLQYLYYLAQIGLA  480
DSSP  ELLLLllllLLHHHHHHHHHL---LLLL-LLHH--------HHHLhhHHHHHHHHLLLEE


DSSP  EL--LLHH-HHLLlllllhhhhhHHHHHHHHHLLhhHEEELLLLLllLLLLLLllllLLH
Query VN--FYNN-YISCtnkanlsqvaDHLDHIKEVAGarAVGFGGDFDgvPRVPEGledvSKY  305
ident       |                              |    |                 
Sbjct MSplSNNSlFLDY--------hrNPFPVFFLRGL--NVSLSTDDP--LQIHLT---kEPL  525
DSSP  ELhhHHLLlLLLL--------llLLHHHHHHLLL--LEEELLLLH--HHHLLL---lLHH


DSSP  HHHHHHHHHL-LLLHHHHHHHHlHHHHHHH---------------------------hhh
Query PDLIAELLRR-NWTEAEVKGALaDNLLRVF---------------------------eav  337
ident                         |                                   
Sbjct VEEYSIAASVwKLSACDLCEIA-RNSVYQSgfshalkshwigkdyykrgpdgndihktnv  584
DSSP  HHHHHHHHHHhLLLHHHHHHHH-HHHHHHLlllhhhhhhhlllllllllhhhllhhhhll


DSSP  hhllllllllllllllhhhlllllllllllll
Query eqasnltqapeeepipldqlggscrthygyss  369
ident                                 
Sbjct phirvefrdtiwkeemqqvylgkavisdevvp  616
DSSP  lhhhhhhhhhhhhhhhhhhlllllllllllll


No 51: Query=1itqA Sbjct=3au2A Z-score=8.6

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct mrnqelarifeeiglmseflgdnpfrvrayhqaartlydldtpieeiaekgkealmelpg   60
DSSP  llhhhhhhhhhhhhhhhhhllllhhhhhhhhhhhhhhhhllllhhhhhlllhhhhlllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct vgpdlaekileflrtgkvrkheelsrkvprgvlevmevpgvgpktarllyeglgidslek  120
DSSP  llhhhhhhhhhhhhhlllhhhhhhhhhllhhhhhhhllllllhhhhhhhhhhhllllhhh


DSSP  ---------------------------------------------LHHH-----------
Query ---------------------------------------------DFFR-----------    4
ident                                                             
Sbjct lkaaldrgdltrlkgfgpkraerireglalaqaagkrrplgavlsLARSlleairalpgv  180
DSSP  hhhhhhhlhhhhlllllhhhhhhhhhhhhhhhhlllleehhhhhhHHHHhhhhhhlllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    4
ident                                                             
Sbjct eraelcgsarrykdtvgdldflvasregeravegfvrlpqvkevyakgkeratvflkngl  240
DSSP  leeeelhhhhlllleelleeeeeelllhhhhhhhhhlllleeeeeeellleeeeeellll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    4
ident                                                             
Sbjct qvdlrvvppesygaglqyltgskahsirlralaqekglklseygvfrgekriageteeev  300
DSSP  eeeeeeelhhhhhhhhhhhhllhhhhhhhhhhhhhllleeelleeeelleeeelllhhhh


DSSP  --------------------------hhhhhhhllllEEEEEELH-HHHHhhhhllllll
Query --------------------------deaerimrdspVIDGHNDL-PWQLldmfnnrlqd   37
ident                                        |                    
Sbjct yaalglpwippplredqgeveaalegrlpkllelpqvKGDLQVHStYSDG----------  350
DSSP  hhhlllllllhhhlllllhhhhhhlllllllllhhhlLEEEEELLlLLLL----------


DSSP  hhhlllllllLLLL--HHHHHHLLEEEEEEEELL--LHHHlllLHHHhHHHHHHHHHHHH
Query eranlttlagTHTN--IPKLRAGFVGGQFWSVYT--PCDTqnkDAVRrTLEQMDVVHRMC   93
ident                                                   |    |    
Sbjct ---------qNTLEelWEAAKTMGYRYLAVTDHSpaVRVA---GGPS-PEEALKRVGEIR  397
DSSP  ---------lLLHHhhHHHHHHHLLLEEEEEEELhhHHLL---LLLL-HHHHHHHHHHHH


DSSP  HHLLLLEeelllhhhhhhhhhllLEEEE-EEEELH-----HHLLllhhhhHHHHHLLEEE
Query RMYPETFlyvtssagirqafregKVASL-IGVEGG-----HSIDsslgvlRALYQLGMRY  147
ident |                          |                                
Sbjct RFNETHG----------------PPYLLaGAEVDIhpdgtLDYP------DWVLRELDLV  435
DSSP  HHHHHHL----------------LLEEEeEEEEELlllllLLLL------HHHHLLLLEE


DSSP  EELlLLLLllllllhhhllllLLLL--LLLLLhhHHHHHHHHhhhLLEEELLLLL-----
Query LTLtHSCNtpwadnwlvdtgdSEPQ--SQGLSpfGQRVVKELnrlGVLIDLAHVS-----  200
ident |                           |                 |             
Sbjct LVS-VHSR-------------FNLPkaDQTKR--LLKALENP---FVHVLAHPTArllgr  476
DSSP  EEE-LLLL-------------LLLLhhHHHHH--HHHHHLLL---LLLEELLLLLlllll


DSSP  ----hHHHHHHHHHL-LLLLEELLLLllllllLLLLLLHHHHHHHHHHLLEEEELLlhhh
Query ----vATMKATLQLS-RAPVIFSHSSaysvcaSRRNVPDDVLRLVKQTDSLVMVNFynny  255
ident      |   |  |      |             |   |||  |                 
Sbjct rapieADWEAVFQKAkEKGVAVEIDG----yyDRMDLPDDLARMAYGMGLWISLST----  528
DSSP  lllllLLHHHHHHHHhHHLLEEEEEL----llLLLLLLHHHHHHHHHLLLLEEEEL----


DSSP  hlllllllhhhHHHHHHHHHH-HLLHHHEEElllllllllllllllllllhhhhhhhhhh
Query isctnkanlsqVADHLDHIKE-VAGARAVGFggdfdgvprvpegledvskypdliaellr  314
ident                         |   |                               
Sbjct -dahqtdhlrfMELAVGTAQRaWIGPERVLN-----------------------------  558
DSSP  -llllhhhhhhHHHHHHHHHHlLLLLLLLHH-----------------------------


DSSP  llllhhhhhhHHLH-hhHHHHHhhHHLLllllllllllllhhhlllllllllllll
Query rnwteaevkgALAD-nlLRVFEavEQASnltqapeeepipldqlggscrthygyss  369
ident            |     |                                      
Sbjct ----------TLDYedlLSWLK--ARRG---------------------------v  575
DSSP  ----------HLLHhhhHHHHH--LLLL---------------------------l


No 52: Query=1itqA Sbjct=1v77A Z-score=8.6

back to top
DSSP  lhhhhhhhhhhllLLEEEEEELHHhhhhhhhllllllhhhllllllllLLLHhHHHHlLE
Query dffrdeaerimrdSPVIDGHNDLPwqlldmfnnrlqderanlttlagtHTNIpKLRAgFV   60
ident                 |                                           
Sbjct -------------VKFIEMDIRDK------------------------EAYE-LAKE-WF   21
DSSP  -------------LLLEEEEELLH------------------------HHHH-HHHH-HL


DSSP  EEEEEEELllhhhllllHHHHHHHHHHHHhhhhhhlllleeelllhhhhhhhhhllleee
Query GGQFWSVYtpcdtqnkdAVRRTLEQMDVVhrmcrmypetflyvtssagirqafregkvas  120
ident      |                 |                                    
Sbjct DEVVVSIK----fneevDKEKLREARKEY------------------------------g   47
DSSP  LEEEEEEE----ellllLHHHHHHHHHHH------------------------------l


DSSP  EEEEelhhhllllhhhhhhhhhlleeeeELLLlllllllllhhhllllllllllLLLHhH
Query LIGVegghsidsslgvlralyqlgmrylTLTHscntpwadnwlvdtgdsepqsqGLSPfG  180
ident                              |                          |   
Sbjct KVAI------------------------LLSN---------------------pKPSL-V   61
DSSP  LEEE------------------------EEEL---------------------lLHHH-H


DSSP  HHHHHHHHhhLLEEELLLLLHHHHHHHHHHLlllLEELlLLLLllLLLLlLLLHHHHHHH
Query QRVVKELNrlGVLIDLAHVSVATMKATLQLSrapVIFShSSAYsvCASRrNVPDDVLRLV  240
ident    |        ||                         |                  | 
Sbjct RDTVQKFK--SYLIYVESNDLRVIRYSIEKG--vDAII-SPWV--NRKDpGIDHVLAKLM  114
DSSP  HHHHHHLL--LLEEEEELLLHHHHHHHHHLL--lLEEE-LLLL--LLLLlLLLHHHHHHH


DSSP  HHHLLEEEEL-LLHHhhllLLLLL--hHHHHHHHHHHHHHLLhhHEEELLLLLlllllll
Query KQTDSLVMVN-FYNNyiscTNKAN--lSQVADHLDHIKEVAGarAVGFGGDFDgvprvpe  297
ident                                                             
Sbjct VKKNVALGFSlRPLL-ysnPYERAnllRFMMKAWKLVEKYKV--RRFLTSSAQ-------  164
DSSP  HHHLLEEEEElHHHH-hllHHHHHhhhHHHHHHHHHHHHHLL--LEEEELLLL-------


DSSP  llLLLLLHHH---HHHHHHhllLLHHHHHHHHLHHHHHHHHhhhhllllllllllllllh
Query glEDVSKYPD---LIAELLrrnWTEAEVKGALADNLLRVFEaveqasnltqapeeepipl  354
ident    ||    |   |              |                               
Sbjct ekWDVRYPRDlisLGVVIG---MEIPQAKASISMYPEIILK-------------------  202
DSSP  lhHHLLLHHHhhhHHHHLL---LLHHHHHHLLLHHHHHHHL-------------------


DSSP  hhlllllllllllll
Query dqlggscrthygyss  369
ident                
Sbjct ---------------  202
DSSP  ---------------


No 53: Query=1itqA Sbjct=1m65A Z-score=8.2

back to top
DSSP  lhhhhhhhhhhlllLEEEEEELHhhHHHHhhllllllhhhlllllllllLLHHHHHHLLE
Query dffrdeaerimrdsPVIDGHNDLpwQLLDmfnnrlqderanlttlagthTNIPKLRAGFV   60
ident                  | |                               |        
Sbjct --------------YPVDLHMHT--VAST-------------haystlsDYIAQAKQKGI   31
DSSP  --------------LLEELLLLL--LLLL-------------lllllhhHHHHHHHHHLL


DSSP  EEEEEEEL-LLHHHllllhhhHHHHHHHhHHHHhhhLLLLeeelllhhhhhhhhhLLLEE
Query GGQFWSVY-TPCDTqnkdavrRTLEQMDvVHRMcrmYPETflyvtssagirqafrEGKVA  119
ident                                                         |   
Sbjct KLFAITDHgPDMED-----apHHWHFIN-MRIW---PRVV---------------DGVGI   67
DSSP  LEEEEEEElLLLLL-----llLLHHHHH-HHHL---LLEE---------------LLEEE


DSSP  EEEEEEL-------HHHLlllhhhhHHHHhLLEE-EEELLLLLLlllllLHHHLllllll
Query SLIGVEG-------GHSIdsslgvlRALYqLGMR-YLTLTHSCNtpwadNWLVDtgdsep  171
ident                                         |            |      
Sbjct LRGIEANiknvdgeIDCS-------GKMF-DSLDlIIAGFHEPV-----FAPHD------  108
DSSP  EEEEEEElllllllLLLL-------HHHH-HHLLeEEEELLLLL-----LLLLL------


DSSP  llllllhhhhhhhhhhhhhlleeellllLHHHHHHHHHHLlllLEELlLLLLlllLLLLl
Query qsqglspfgqrvvkelnrlgvlidlahvSVATMKATLQLSrapVIFShSSAYsvcASRRn  231
ident                                 | ||        | |             
Sbjct -------------------------katNTQAMIATIASG-nvHIIS-HPGN---PKYEi  138
DSSP  -------------------------hhhHHHHHHHHHHLL-llLEEL-LLLL---LLLLl


DSSP  lLHHHHHHHHHHLLEEEELLLHhhhlllllllhhhhhhHHHHHHHHLL--hHHEEELLLL
Query vPDDVLRLVKQTDSLVMVNFYNnyisctnkanlsqvadHLDHIKEVAG--aRAVGFGGDF  289
ident     |             |                                  |  | | 
Sbjct dVKAVAEAAAKHQVALEINNSS----------------NCREVAAAVRdagGWVALGSDS  182
DSSP  lHHHHHHHHHHHLLEEEEELLL----------------LHHHHHHHHHhhlLLEEEELLL


DSSP  LlllllllllLLLLlHHHHhhhhhHLLLlhhHHHHHHLH---hHHHHHHHHHhlllllll
Query DgvprvpeglEDVSkYPDLiaellRRNWteaEVKGALAD---nLLRVFEAVEqasnltqa  346
ident                                     |      ||   |           
Sbjct H-------taFTMG-EFEEclkilDAVD--fPPERILNVsprrLLNFLESRG--------  224
DSSP  L-------lhHHLL-LLHHhhhhhHHLL--lLHHHLHHHlhhhHHHHHHHLL--------


DSSP  lllllllhhhlllllllllllll
Query peeepipldqlggscrthygyss  369
ident                        
Sbjct -------------mapiaefadl  234
DSSP  -------------llllhhhlll


No 54: Query=1itqA Sbjct=1bksA Z-score=7.4

back to top
DSSP  -lhhhhhhhhhHLLLleEEEEELHHhhhHHHHLLLlllhhhlllllllllLLHHHHhhll
Query -dffrdeaeriMRDSpvIDGHNDLPwqlLDMFNNRlqderanlttlagthTNIPKLragf   59
ident                              |                    | |       
Sbjct meryenlfaqlNDRRegAFVPFVTL---GDPGIEQ---------slkiidTLIDAG----   44
DSSP  lhhhhhhhhhhHHLLllEEEEEEEL---LLLLHHH---------hhhhhhHHHHLL----


DSSP  eeEEEEEeLLLHHHL-------------lllhhhHHHHHHHHHHHHHHhllllEEELllh
Query vgGQFWSvYTPCDTQ-------------nkdavrRTLEQMDVVHRMCRmypetFLYVtss  106
ident           |                                                 
Sbjct -aDALEL-GVPFSDPladgptiqnanlrafaagvTPAQCFEMLALIRE-----KHPT---   94
DSSP  -lLLEEE-ELLLLLLllllhhhhhhhhhhhhhllLHHHHHHHHHHHHH-----HLLL---


DSSP  hhhhhhhhllleeEEEEEEL-HHHLL--LLHHHHHHHHHLLEEEEELLllllllllllhh
Query agirqafregkvaSLIGVEG-GHSID--SSLGVLRALYQLGMRYLTLThscntpwadnwl  163
ident                ||                     | |                   
Sbjct -------------IPIGLLMyANLVFnnGIDAFYARCEQVGVDSVLVA------------  129
DSSP  -------------LLEEEEElHHHHHllLHHHHHHHHHHHLLLEEEEL------------


DSSP  hllllllllllLLLHhHHHHHHHHHHHLLEEELL---lllhhHHHHHHHHLllLLEELLL
Query vdtgdsepqsqGLSPfGQRVVKELNRLGVLIDLA---hvsvaTMKATLQLSraPVIFSHS  220
ident                          |                                  
Sbjct ---------dvPVEE-SAPFRQAALRHNIAPIFIcppnadddLLRQVASYG--RGYTYLL  177
DSSP  ---------llLHHH-LHHHHHHHHHLLLEEEEEelllllhhHHHHHHHHL--LLLEEEL


DSSP  llllllllllllLHHHHHHHHH-HLLEEEELLLhhhhllllllLHHHHHHHHHHHhhhll
Query saysvcasrrnvPDDVLRLVKQ-TDSLVMVNFYnnyisctnkaNLSQVADHLDHIkevag  279
ident                     |          |              ||            
Sbjct ---------alpLHHLIEKLKEyHAAPALQGFG--------isSPEQVSAAVRAG-----  215
DSSP  ---------lllHHHHHHHHHHhLLLLEEELLL--------llLHHHHHHHHHHL-----


DSSP  hhhEEELLLL-LLLL----------llllllLLLLL-HHHHHhhhhhllllhhhhhhhhl
Query araVGFGGDF-DGVP----------rvpeglEDVSK-YPDLIaellrrnwteaevkgala  327
ident     |                            ||                         
Sbjct --aAGAISGSaIVKIieknlaspkqmlaelrSFVSAmKAASR------------------  255
DSSP  --lLEEEELLhHHHHhhhllllhhhhhhhhhHHHHHhHHLLL------------------


DSSP  hhhhhhhhhhhhllllllllllllllhhhlllllllllllll
Query dnllrvfeaveqasnltqapeeepipldqlggscrthygyss  369
ident                                           
Sbjct ------------------------------------------  255
DSSP  ------------------------------------------


No 55: Query=1itqA Sbjct=3dcpA Z-score=7.2

back to top
DSSP  lhhhhhhhhhhlllLEEEEEELHhhHHHHhhllllllhhhlllllllllLLHHhHHHLLE
Query dffrdeaerimrdsPVIDGHNDLpwQLLDmfnnrlqderanlttlagthTNIPkLRAGFV   60
ident                  |||                                        
Sbjct --------------XKRDGHTHT--EFCP-----------hgthddveeXVLK-AIELDF   32
DSSP  --------------LLEEEEELL--LLLL-----------llllllhhhHHHH-HHHLLL


DSSP  EEEEEEELLLHH--------------hllllHHHHHHHHHHHHHHHHhhlLLLEeelllh
Query GGQFWSVYTPCD--------------tqnkdAVRRTLEQMDVVHRMCrmyPETFlyvtss  106
ident          |                     |                            
Sbjct DEYSIVEHAPLSsefxkntagdkeavttasxAXSDLPYYFKKXNHIK---KKYA------   83
DSSP  LEEEEEEELLLLhhhhhllllllhhhhllllLHHHHHHHHHHHHHHH---HHLL------


DSSP  hhhhhhhhlLLEEEEEEEELHH---hllLLHHHHHHHHHlLEEEEelllllllllllLHH
Query agirqafreGKVASLIGVEGGH---sidSSLGVLRALYQlGMRYLtlthscntpwadNWL  163
ident                || |              |                         |
Sbjct ---------SDLLIHIGFEVDYligyedFTRDFLNEYGP-QTDDG--------vlslHFL  125
DSSP  ---------LLLEEEEEEEEELllllhhHHHHHHHHHHH-HLLEE--------eeelLEE


DSSP  HllLLLLlllllllhhhhhhhhhhhhhlleeellllLHHHHHHHHHHL---lllLEELlL
Query VdtGDSEpqsqglspfgqrvvkelnrlgvlidlahvSVATMKATLQLS---rapVIFShS  220
ident    |                                     |                  
Sbjct EgqGGFR---sidfsaedynegivqfyggfeqaqlaYLEGVKQSIEADlglfkpRRXG-H  181
DSSP  EelLEEE---ellllhhhhhhhlhhhhllhhhhhhhHHHHHHHHHHLLllllllLEEL-L


DSSP  LLL-------------lllllllllLHHHHHHHHHHLLEEEELLLhhHHLLLLLLlhhhh
Query SAY-------------svcasrrnvPDDVLRLVKQTDSLVMVNFYnnYISCTNKAnlsqv  267
ident                              | |||  |     |                 
Sbjct ISLcqkfqqffgedtsdfseevxekFRVILALVKKRDYELDFNTA--GLFKPLCG----e  235
DSSP  LLHhhllhhhhlllhhhllhhhhhhHHHHHHHHHHHLLEEEEELH--HHHLLLLL----l


DSSP  hhHHHHHHHHLL--HHHEEELLLLLlllllllllLLLL-lHHHHHHHHHhllllhhhhhh
Query adHLDHIKEVAG--ARAVGFGGDFDgvprvpeglEDVS-kYPDLIAELLrrnwteaevkg  324
ident       |   |         | |            |    |      |            
Sbjct tyPPKKIVTLASelQIPFVYGSDSH-------gvQDIGrgYSTYCQKLE-----------  277
DSSP  llLLHHHHHHHHhlLLLEEEELLLL-------lhHHLLllHHHHHHHLL-----------


DSSP  hhlhhhhhhhhhhhhllllllllllllllhhhlllllllllllll
Query aladnllrvfeaveqasnltqapeeepipldqlggscrthygyss  369
ident                                              
Sbjct ---------------------------------------------  277
DSSP  ---------------------------------------------


No 56: Query=1itqA Sbjct=3f2bA Z-score=6.2

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct vrrletiveeerrvvvqgyvfdaevselksgrtlltmkitdytnsilvkmfsrdkedael   60
DSSP  lllhhhlllleeeeeeeeeeeeeeeeellllleeeeeeeelllleeeeeeelllhhhhhh


DSSP  ----------------------------------lhhhhhhHHHHLLLLEEEEEELHhhH
Query ----------------------------------dffrdeaERIMRDSPVIDGHNDLpwQ   26
ident                                                      |      
Sbjct msgvkkgmwvkvrgsvqndtfvrdlviiandlneiaanerqDTAPEGEKRVELHLHT--P  118
DSSP  hhlllllleeeeeeeeeeelllleeeeeeeeeeeellllllLLLLLLLLLLLLLLLL--L


DSSP  HHHhhllllllhhhllllllllllLHHHHHHlLEEEEEEEELLlhhhllllhhhhHHHHH
Query LLDmfnnrlqderanlttlagthtNIPKLRAgFVGGQFWSVYTpcdtqnkdavrrTLEQM   86
ident                          |                                  
Sbjct MSQ------------mdavtsvtkLIEQAKKwGHPAIAVTDHA------------VVQSF  154
DSSP  LLL------------llllllhhhHHHHHHHlLLLLEEELLLL------------LLLLH


DSSP  HHHHHHHhhLLLLEeelllhhhhhhhhhllleEEEEEEEL--------------------
Query DVVHRMCrmYPETFlyvtssagirqafregkvASLIGVEG--------------------  126
ident                                     | |                     
Sbjct PEAYSAA--KKHGM------------------KVIYGLEAnivddpfhvtllaqnetglk  194
DSSP  HHHHHHH--HHHLL------------------LEEEEEEEeeellleeeeeeellhhhhh


DSSP  ---HHHLLLLhhhhhhhhhlleeeeellllllllLLLLhhhlllllllllllllhhhhhH
Query ---GHSIDSSlgvlralyqlgmryltlthscntpWADNwlvdtgdsepqsqglspfgqrV  183
ident         |                                                   
Sbjct nlfKLVSLSH----------------iqyfhrvpRIPR-------------------svL  219
DSSP  hhhHHHHHHH----------------llllllllLEEH-------------------hhH


DSSP  HHHHhhHLLEEelllllhhhhhhhhhhlllllEELLlllllllllLLLL---LHHHHHHH
Query VKELnrLGVLIdlahvsvatmkatlqlsrapvIFSHssaysvcasRRNV---PDDVLRLV  240
ident ||     | |                                            |  |  
Sbjct VKHR--DGLLV---------------------GSGC--------dKGELfdnVEDIARFY  248
DSSP  HHLL--LLEEE---------------------ELLL--------lLLLLlllLLLLHHHL


DSSP  hhhlLEEEELLlhhhHLLLLlllhHHHHHHHHHHHHHLL--hhHEEELLLLL--------
Query kqtdSLVMVNFynnyISCTNkanlSQVADHLDHIKEVAG--arAVGFGGDFD--------  290
ident         |                        |          |   |           
Sbjct ----DFLEVHP-pdvYKPLYvkdeEMIKNIIRSIVALGEkldiPVVATGNVHylnpedki  303
DSSP  ----LLEEELL-hhhHLLLLlllhHHHHHHHHHHHHHHHhlllLEEELLLLLlllhhhhh


DSSP  ----------------lllLLLLlllLLLLHHHHHHHHHhlLLLHHHHHHHHLHHHHHHH
Query ----------------gvpRVPEgleDVSKYPDLIAELLrrNWTEAEVKGALADNLLRVF  334
ident                                                 |    ||     
Sbjct yrkilihsqgganplnrheLPDV---YFRTTNEMLDCFS--FLGPEKAKEIVVDNTQKIA  358
DSSP  hhhhhhhllhhhlllllllLLLL---LLLLHHHHHHHHH--HHHHHHHHHHHLHHHHHHH


DSSP  HH----------------------------------------------------------
Query EA----------------------------------------------------------  336
ident                                                             
Sbjct SLigdvkpikdelytpriegadeeiremsyrrakeiygdplpklveerlekelksiighg  418
DSSP  HLllllllllllllllllllhhhhhhhhhhhhhhhhhlllllhhhhhhhhhhhhhhhhll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  336
ident                                                             
Sbjct faviylishklvkkslddgylvgsrgsvgssfvatmteitevnplpphyvcpnckhseff  478
DSSP  lhhhhhhhhhhhhhhhhllllleelhhhhhlhhhhhllllllllllleeelllllleeel


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  336
ident                                                             
Sbjct ndgsvgsgfdlpdkncprcgtkykkdghdipfetflgfkgdkvpdidlnfsgeyqprahn  538
DSSP  lllllllhhhllllllllllllleeellllllhhhhllllllllleeeeeelllhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  336
ident                                                             
Sbjct ytkvlfgednvyragtigtvadktaygfvkayasdhnlelrgaeidrlaagctgvkrttg  598
DSSP  hhhhhhlllleeeeeeeeellhhhhhhhhhhhhhhllllllhhhhhhhhhhhllleeeee


DSSP  -----hhhllllllllllllllhhhlLLLLLLL---------------------------
Query -----veqasnltqapeeepipldqlGGSCRTH---------------------------  364
ident                             |                               
Sbjct qhpggiivvpdymeiydftpiqypadDTSSEWRtthfdfhsihdnllkldilghddptvi  658
DSSP  eeeeeeeellllllhhhllleelhhhLLLLLLLeeeeehhhhllllleeeeeeehhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  364
ident                                                             
Sbjct rmlqdlsgidpktiptddpdvmgifssteplgvtpeqimcnvgtigipefgtrfvrqmle  718
DSSP  hhhhhhhlllhhhlllllhhhhhlllllhhhlllhhhhllllllllllllllhhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  364
ident                                                             
Sbjct etrpktfselvqisglshgtdvwlgnaqeliqngtctlsevigcrddimvyliyrgleps  778
DSSP  hhllllhhhhhhhhhhllllllllllhhhhhhlllllhhhllllhhhhhhhhhhllllhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  364
ident                                                             
Sbjct lafkimesvrkgkgltpefeaemrkhdvpewyidsckkikymfpkahaaayvlmavriay  838
DSSP  hhhhhhhhhlllllllhhhhhhhhhllllhhhhhhhhhllllllhhhhhhhhhhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  364
ident                                                             
Sbjct fkvhhpllyyasyftvraedfdldamikgsaairkrieeinakgiqatakekslltvlev  898
DSSP  hhhhlhhhhhhhhhhhllllllhhhhhhlhhhhhhhhhhhhhlhhhllhhhhhhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  364
ident                                                             
Sbjct alemcergfsfknidlyrsqatefvidgnslippfnaipglgtnvaqaivrareegefls  958
DSSP  hhhhhhllleellllllllllllleeelleeellhhhlllllhhhhhhhhhhhhllllll


DSSP  -------------------------------lllll
Query -------------------------------ygyss  369
ident                                     
Sbjct kedlqqrgklsktlleylesrgcldslpdhnqlslf  994
DSSP  hhhhhhhhlllhhhhhhhhhllllllllllllllll


No 57: Query=1itqA Sbjct=3e38A Z-score=5.6

back to top
DSSP  -lhhhhhHHHH--hlLLLEEEEEELHH---HHHHhhhllllllhhhlllllllllLLHHH
Query -dffrdeAERI--mrDSPVIDGHNDLP---WQLLdmfnnrlqderanlttlagthTNIPK   54
ident                     | |                                     
Sbjct aqrrneiQVPDldgyTTLKCDFHXHSVfsdGLVW-------------------ptVRVDE   41
DSSP  lllllllLLLLllllEEEEEELLLLLLlllLLLL-------------------hhHHHHH


DSSP  HHHLLEEEEEEEELllhhhllllHHHH---hhHHHHHHHHHHhhllLLEEelllhhhhhh
Query LRAGFVGGQFWSVYtpcdtqnkdAVRR---tlEQMDVVHRMCrmypETFLyvtssagirq  111
ident                                               |             
Sbjct AYRDGLDAISLTEH------ieyRPHKqdvvsDHNRSFDLCR----EQAE----------   81
DSSP  HHHLLLLEELLEEE------lllLLLLlllllLLLHHHHHHH----HHHH----------


DSSP  hhhlLLEEEEEEEELHH--------hllllhhHHHHhhhlleeeeellllllllllllhh
Query afreGKVASLIGVEGGH--------sidsslgVLRAlyqlgmryltlthscntpwadnwl  163
ident            | |                                              
Sbjct ---kLGILLIKGSEITRaxapghfnaiflsdsNPLE------------------------  114
DSSP  ---hHLLEELLEEEEELllllleeeeelllllHHHL------------------------


DSSP  hlllllllllllllhHHHHHHHHHHHHLLEEELLLL-----------LHHHHHHHHHHLl
Query vdtgdsepqsqglspFGQRVVKELNRLGVLIDLAHV-----------SVATMKATLQLSr  212
ident                       |    |      |                  |  |   
Sbjct -------------qkDYKDAFREAKKQGAFXFWNHPgwdsqqpdttkWWPEHTALYQEG-  160
DSSP  -------------llLHHHHHHHHHHLLLEEEELLLlllllllllllLLHHHHHHHHLL-


DSSP  lLLEEL----llLLLLlllllllLLHHHHHHHhhhlLEEEelllhhhhlllllllhhhhh
Query aPVIFS----hsSAYSvcasrrnVPDDVLRLVkqtdSLVMvnfynnyisctnkanlsqva  268
ident                             |                               
Sbjct cXHGIEvanghlYXPE-------AIQWCLDKN----LTXI--------------------  189
DSSP  lLLEEEeeelleELLH-------HHHHHHHHL----LEEE--------------------


DSSP  hhhhhhhhhllhhheeELLLLLL--lLLLLL--LLLLlllhhhhhhhhhhllllhhhhhh
Query dhldhikevagaravgFGGDFDG--vPRVPE--GLEDvskypdliaellrrnwteaevkg  324
ident                    |             |                          
Sbjct ----------------GTSDIHQpiqTDYDFekGEHR---------------------tx  212
DSSP  ----------------EELLLLLlhhHHLLHhhLLLL---------------------le


DSSP  HHLH--------HHHHHHH-----------------------------------------
Query ALAD--------NLLRVFE-----------------------------------------  335
ident                                                             
Sbjct TFVFakerslqgIREALDNrrtaayfhelligredllrpffekcvkieevsrneqgvtls  272
DSSP  EEEEellllhhhHHHHHHLlleeeeelleeellhhhhhhhhhhheeeeeeeeelleeeee


DSSP  ------------------------------------hhhhllllllllllllllhhhlll
Query ------------------------------------aveqasnltqapeeepipldqlgg  359
ident                                                             
Sbjct itnvtdlvlklkktahdtllvyfrdxtlkphtrytvrigfkqgikggdvnfevtnfivap  332
DSSP  eeellllleeeeelllllleellleeeellleeeeeeeeellllllleeeeeeeeeeeel


DSSP  llllllllll
Query scrthygyss  369
ident           
Sbjct dkglkytisl  342
DSSP  leeeeeeeel


No 58: Query=1itqA Sbjct=2anuA Z-score=5.5

back to top
DSSP  lhhhhhhhhhhlLLLEEEEEELHHHHhhhhhllllllhhhllllllllLLLHhHHHHLLE
Query dffrdeaerimrDSPVIDGHNDLPWQlldmfnnrlqderanlttlagtHTNIpKLRAGFV   60
ident                  | |                                       |
Sbjct -----------tEWLLCDFHVHTNXS---------------dghlplgEVVD-LFGKHGV   33
DSSP  -----------lEEEEEEEEELLLLL---------------lllllhhHHHH-HHHHLLL


DSSP  EEEEEEELLLHHHLLL-----------lHHHHHHHHHHHHHHHHHH-LLLLeeelllhhh
Query GGQFWSVYTPCDTQNK-----------dAVRRTLEQMDVVHRMCRM-YPETflyvtssag  108
ident                                          |       |          
Sbjct DVVSITDHIVDRRTLEqrkrngeplgaiTEDKFQDYLKRLWREQKRaWEEY---------   84
DSSP  LEEEEEEEEELHHHHHhhhhllllllllLLLLHHHHHHHHHHHHHHhHHHH---------


DSSP  hhhhhhllLEEEEEEEELHHhllllhhhhhhhhhlleeeeelllLLLLlllllhhhllll
Query irqafregKVASLIGVEGGHsidsslgvlralyqlgmryltlthSCNTpwadnwlvdtgd  168
ident               |||                                           
Sbjct --------GXILIPGVEITN------------------------NTDL------yhivav  106
DSSP  --------LLEEEEEEEEEE------------------------LLLL------eeeeee


DSSP  lllllllllhHHHHHHHHHHHHLLEEELLL--------lLHHHHHHHHHHlllLLEE-lL
Query sepqsqglspFGQRVVKELNRLGVLIDLAH--------vSVATMKATLQLsraPVIF-sH  219
ident                |  |     |   ||           |                  
Sbjct dvkeyvdpslPVEEIVEKLKEQNALVIAAHpdrkklswyLWANXERFKDT--fDAWEiaN  164
DSSP  llllllllllLHHHHHHHHHHLLLEEEELLllllllllhHHHLLLLLLLL--lLEEEeeE


DSSP  LLLLlllllllllLHHHHHHHHhhlLEEEelllhhhhlllllllhhhhhhhhhhhhhhll
Query SSAYsvcasrrnvPDDVLRLVKqtdSLVMvnfynnyisctnkanlsqvadhldhikevag  279
ident                 |          |                                
Sbjct RDDL---------FNSVGVKKY---RYVA-------------------------------  181
DSSP  LLEE---------LHHHHHLLL---LEEE-------------------------------


DSSP  hhheeeLLLLLllllllllLLLLllhhhhhhhhhhllllhhhhhhHHLH-------hHHH
Query aravgfGGDFDgvprvpegLEDVskypdliaellrrnwteaevkgALAD-------nLLR  332
ident         ||         |  |                       |             
Sbjct ------NSDFH-------eLWHV------------------yswkTLVKseknieaiKEA  210
DSSP  ------ELLLL-------lHHHH------------------lleeEEEEelllhhhhHHH


DSSP  HHHHhhhllllllllllllllhhhlllllllllllll
Query VFEAveqasnltqapeeepipldqlggscrthygyss  369
ident                                      
Sbjct IRKN-----------------------tdvaiylxrk  224
DSSP  HHHL-----------------------lleeeeelll


No 59: Query=1itqA Sbjct=2yb1A Z-score=4.6

back to top
DSSP  lhhhhhhhhhhlllLEEEEEELHH---HHHHhhhllllllhhhlllllllllllHHHHHh
Query dffrdeaerimrdsPVIDGHNDLP---WQLLdmfnnrlqderanlttlagthtnIPKLRa   57
ident                 || |         |                              
Sbjct --------------ANIDLHFHSRtsdGALT------------------pteviDRAAA-   27
DSSP  --------------LLEELLLLLLlllLLLL------------------hhhhhHHHHL-


DSSP  LLEEEEEEEELLlhhhllllhhhhhhhhHHHHHHHHHhLLLLeeelllhhhhhhhhhllL
Query GFVGGQFWSVYTpcdtqnkdavrrtleqMDVVHRMCRmYPETflyvtssagirqafregK  117
ident                                                             
Sbjct RAPALLALTDHD---------------cTGGLAEAAAaAARR-----------------G   55
DSSP  LLLLEEEELLLL---------------lLLLHHHHHHhHHHL-----------------L


DSSP  EEEEEEEELHH------------hllllhHHHHH--------------------------
Query VASLIGVEGGH------------sidsslGVLRA--------------------------  139
ident    | |||                       | |                          
Sbjct IPFLNGVEVSVswgrhtvhivglgidpaePALAAglksiregrlerarqmgasleaagia  115
DSSP  LLEEEEEEEEEeelleeeeeeeellllllHHHHHhhhhhhllhhhhhhhhhhhhhhllll


DSSP  -------------------------------------hhhlleeeeelllllLLLLlllh
Query -------------------------------------lyqlgmryltlthscNTPWadnw  162
ident                                                             
Sbjct gcfdgamrwcdnpemisrthfarhlvdsgavkdmrtvfrkyltpgkpgyvshQWAS----  171
DSSP  lhhhhhhlllllhhhllhhhhhhhhhhllllllhhhhhhhllllllllllllLLLL----


DSSP  hhlllllllllllllhhHHHHHHHHHHHLLEEELLL---------lLHHHHHHHHHHLll
Query lvdtgdsepqsqglspfGQRVVKELNRLGVLIDLAH---------vSVATMKATLQLSra  213
ident                      |      |     ||                        
Sbjct -----------------LEDAVGWIVGAGGMAVIAHpgrydmgrtlIERLILDFQAAG--  212
DSSP  -----------------HHHHHHHHHHLLLEEEELLhhhllllhhhHHHHHHHHHHLL--


DSSP  lLEEL---llLLLLllllllLLLHhHHHHHHHHLLEEEelllhhhhlllllllhhhhhhh
Query pVIFS---hsSAYSvcasrrNVPDdVLRLVKQTDSLVMvnfynnyisctnkanlsqvadh  270
ident                                                             
Sbjct gQGIEvasgsHSLD------DMHK-FALHADRHGLYAS----------------------  243
DSSP  lLEEEeeellLLHH------HHHH-HHHHHHHHLLEEE----------------------


DSSP  hhhhhhhllhhheeELLLLLlLLLLlllllLLLLhhhhhhhhhhllllhhhhhhhhlhHH
Query ldhikevagaravgFGGDFDgVPRVpegleDVSKypdliaellrrnwteaevkgaladNL  330
ident                | ||   |       ||                            
Sbjct --------------SGSDFH-APGE-----DVGH---------------tedlppicrPI  268
DSSP  --------------EELLLL-LLLL-----LLLL---------------lllllllllLH


DSSP  HHHHHhhhhllllllllllllllhhhlllllllllllll
Query LRVFEaveqasnltqapeeepipldqlggscrthygyss  369
ident  |  |                                  
Sbjct WRELE-----------------------arilrpadaen  284
DSSP  HHHLH-----------------------hhlllllhhhl