Results: dupa

Query: 1gkpA

MOLECULE: HYDANTOINASE;

Select neighbours (check boxes) for viewing as multiple structural alignment or 3D superimposition. The list of neighbours is sorted by Z-score. Similarities with a Z-score lower than 2 are spurious. Each neighbour has links to pairwise structural alignment with the query structure, and to the PDB format coordinate file where the neighbour is superimposed onto the query structure.

Expand gaps

Summary

    No:  Chain   Z    rmsd lali nres  %id PDB  Description
   1:  1gkp-A 75.3  0.0  458   458  100 PDB  MOLECULE: HYDANTOINASE;                                              
   2:  4b3z-D 56.1  1.4  452   477   36 PDB  MOLECULE: DIHYDROPYRIMIDINASE-RELATED PROTEIN 1;                     
   3:  3e74-A 50.8  2.0  420   429   30 PDB  MOLECULE: ALLANTOINASE;                                              
   4:  3gri-A 43.9  2.4  401   422   29 PDB  MOLECULE: DIHYDROOROTASE;                                            
   5:  3giq-A 32.7  2.7  358   475   20 PDB  MOLECULE: N-ACYL-D-GLUTAMATE DEACYLASE;                              
   6:  3pnu-A 30.5  3.1  314   338   12 PDB  MOLECULE: DIHYDROOROTASE;                                            
   7:  1onx-A 29.5  2.7  332   390   18 PDB  MOLECULE: ISOASPARTYL DIPEPTIDASE;                                   
   8:  3nqb-A 28.6  3.0  313   587   21 PDB  MOLECULE: ADENINE DEAMINASE 2;                                       
   9:  1yrr-B 27.9  3.3  309   334   19 PDB  MOLECULE: N-ACETYLGLUCOSAMINE-6-PHOSPHATE DEACETYLASE;               
  10:  2vun-A 27.8  2.7  324   385   21 PDB  MOLECULE: ENAMIDASE;                                                 
  11:  4cqb-A 26.9  3.7  331   402   19 PDB  MOLECULE: N-ISOPROPYLAMMELIDE ISOPROPYL AMIDOHYDROLASE;              
  12:  2paj-A 25.2  3.5  319   421   18 PDB  MOLECULE: PUTATIVE CYTOSINE/GUANINE DEAMINASE;                       
  13:  2ogj-A 24.9  3.4  318   379   17 PDB  MOLECULE: DIHYDROOROTASE;                                            
  14:  3mtw-A 24.8  3.6  329   404   19 PDB  MOLECULE: L-ARGININE CARBOXYPEPTIDASE CC2672;                        
  15:  2oof-A 24.1  3.8  319   403   18 PDB  MOLECULE: 4-IMIDAZOLONE-5-PROPANOATE AMIDOHYDROLASE;                 
  16:  1a5k-C 23.8  2.5  340   566   22 PDB  MOLECULE: UREASE (GAMMA SUBUNIT);                                    
  17:  3mkv-A 23.6  3.4  324   414   20 PDB  MOLECULE: PUTATIVE AMIDOHYDROLASE;                                   
  18:  3ls9-A 23.3  3.4  330   453   17 PDB  MOLECULE: TRIAZINE HYDROLASE;                                        
  19:  1j6p-A 22.9  3.5  320   407   16 PDB  MOLECULE: METAL-DEPENDENT HYDROLASE OF                               
  20:  3ooq-A 22.9  3.2  290   384   21 PDB  MOLECULE: AMIDOHYDROLASE;                                            
  21:  1k6w-A 22.9  3.9  323   423   15 PDB  MOLECULE: CYTOSINE DEAMINASE;                                        
  22:  3icj-A 22.7  3.2  296   468   17 PDB  MOLECULE: UNCHARACTERIZED METAL-DEPENDENT HYDROLASE;                 
  23:  4c5y-A 21.4  3.7  323   436   19 PDB  MOLECULE: OCHRATOXINASE;                                             
  24:  2uz9-A 20.1  4.2  317   444   13 PDB  MOLECULE: GUANINE DEAMINASE;                                         
  25:  2ob3-A 18.9  3.1  249   329   15 PDB  MOLECULE: PARATHION HYDROLASE;                                       
  26:  4rdv-B 18.9  3.5  311   451   20 PDB  MOLECULE: N-FORMIMINO-L-GLUTAMATE IMINOHYDROLASE;                    
  27:  3irs-A 18.8  2.8  235   281   11 PDB  MOLECULE: UNCHARACTERIZED PROTEIN BB4693;                            
  28:  3cjp-A 18.8  2.7  225   262   12 PDB  MOLECULE: PREDICTED AMIDOHYDROLASE, DIHYDROOROTASE FAMILY;           
  29:  1bf6-A 18.1  2.7  231   291    9 PDB  MOLECULE: PHOSPHOTRIESTERASE HOMOLOGY PROTEIN;                       
  30:  2dvt-A 17.4  3.2  253   325   15 PDB  MOLECULE: THERMOPHILIC REVERSIBLE GAMMA-RESORCYLATE DECARBO          
  31:  4dlf-A 17.4  3.2  243   287   12 PDB  MOLECULE: AMIDOHYDROLASE 2;                                          
  32:  2vc5-A 17.3  2.9  230   314   12 PDB  MOLECULE: ARYLDIALKYLPHOSPHATASE;                                    
  33:  3k2g-B 17.3  2.8  233   358   12 PDB  MOLECULE: RESINIFERATOXIN-BINDING, PHOSPHOTRIESTERASE-               
  34:  4ofc-A 17.2  3.1  244   335   12 PDB  MOLECULE: 2-AMINO-3-CARBOXYMUCONATE-6-SEMIALDEHYDE DECARBOX          
  35:  2imr-A 17.1  5.4  294   380   14 PDB  MOLECULE: HYPOTHETICAL PROTEIN DR_0824;                              
  36:  4hk5-D 16.9  3.3  261   380   12 PDB  MOLECULE: URACIL-5-CARBOXYLATE DECARBOXYLASE;                        
  37:  2ffi-A 16.8  3.0  234   273   14 PDB  MOLECULE: 2-PYRONE-4,6-DICARBOXYLIC ACID HYDROLASE, PUTATIV          
  38:  4qrn-A 16.7  3.2  249   352   10 PDB  MOLECULE: 5-CARBOXYVANILLATE DECARBOXYLASE;                          
  39:  2y1h-B 16.7  2.9  226   265   14 PDB  MOLECULE: PUTATIVE DEOXYRIBONUCLEASE TATDN3;                         
  40:  4dzi-C 16.4  3.4  248   388   11 PDB  MOLECULE: PUTATIVE TIM-BARREL METAL-DEPENDENT HYDROLASE;             
  41:  4mup-B 16.0  3.1  232   286   13 PDB  MOLECULE: AMIDOHYDROLASE;                                            
  42:  2qpx-A 15.8  3.1  225   376   10 PDB  MOLECULE: PREDICTED METAL-DEPENDENT HYDROLASE OF THE TIM-BA          
  43:  1a4m-A 15.5  3.4  242   349   10 PDB  MOLECULE: ADENOSINE DEAMINASE;                                       
  44:  1itq-A 15.1  3.3  238   369   13 PDB  MOLECULE: RENAL DIPEPTIDASE;                                         
  45:  3gg7-A 15.1  3.2  216   243   13 PDB  MOLECULE: UNCHARACTERIZED METALLOPROTEIN;                            
  46:  2gwg-A 14.6  3.6  232   329   10 PDB  MOLECULE: 4-OXALOMESACONATE HYDRATASE;                               
  47:  3qy6-A 13.8  3.1  202   247   12 PDB  MOLECULE: TYROSINE-PROTEIN PHOSPHATASE YWQE;                         
  48:  1j5s-A 13.7  3.8  241   451   10 PDB  MOLECULE: URONATE ISOMERASE;                                         
  49:  3iac-A 12.6  3.9  243   469    7 PDB  MOLECULE: GLUCURONATE ISOMERASE;                                     
  50:  1v77-A 11.6  3.8  182   202    9 PDB  MOLECULE: HYPOTHETICAL PROTEIN PH1877;                               
  51:  2a3l-A  9.7  4.0  243   616   10 PDB  MOLECULE: AMP DEAMINASE;                                             
  52:  3f2b-A  9.4  5.7  198   994    9 PDB  MOLECULE: DNA-DIRECTED DNA POLYMERASE III ALPHA CHAIN;               
  53:  3dcp-A  9.3  3.8  192   277   11 PDB  MOLECULE: HISTIDINOL-PHOSPHATASE;                                    
  54:  3au2-A  9.1  6.8  184   575   12 PDB  MOLECULE: DNA POLYMERASE BETA FAMILY (X FAMILY);                     
  55:  1m65-A  8.8  3.5  182   234   10 PDB  MOLECULE: HYPOTHETICAL PROTEIN YCDX;                                 
  56:  1bks-A  7.7  4.8  180   255    8 PDB  MOLECULE: TRYPTOPHAN SYNTHASE;                                       
  57:  2yb1-A  5.7  3.9  161   284   11 PDB  MOLECULE: AMIDOHYDROLASE;                                            
  58:  2anu-A  5.6  3.4  142   224    9 PDB  MOLECULE: HYPOTHETICAL PROTEIN TM0559;                               
  59:  3e38-A  5.6  4.5  165   342   10 PDB  MOLECULE: TWO-DOMAIN PROTEIN CONTAINING PREDICTED PHP-LIKE           


Pairwise Structural Alignments

Notation: three-state secondary structure definitions by DSSP (reduced to H=helix, E=sheet, L=coil) are shown above the amino acid sequence. Structurally equivalent residues are in uppercase, structurally non-equivalent residues (e.g. in loops) are in lowercase. Amino acid identities are marked by vertical bars.

No 1: Query=1gkpA Sbjct=1gkpA Z-score=75.3

back to top
DSSP  LEEEELLEEEELLEEEELEEEELLLLLLEEELLLLLLLLLEEEELLLLEEEELEEEEEEL
Query PLLIKNGEIITADSRYKADIYAEGETITRIGQNLEAPPGTEVIDATGKYVFPGFIDPHVH   60
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct PLLIKNGEIITADSRYKADIYAEGETITRIGQNLEAPPGTEVIDATGKYVFPGFIDPHVH   60
DSSP  LEEEELLEEEELLEEEELEEEELLLLLLEEELLLLLLLLLEEEELLLLEEEELEEEEEEL


DSSP  LLLEELLEELLLLHHHHHHHHHHLLEEEEEEEELLLLLLLHHHHHHHHHHHHLLLLLLEE
Query IYLPFMATFAKDTHETGSKAALMGGTTTYIEMCCPSRNDDALEGYQLWKSKAEGNSYCDY  120
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct IYLPFMATFAKDTHETGSKAALMGGTTTYIEMCCPSRNDDALEGYQLWKSKAEGNSYCDY  120
DSSP  LLLEELLEELLLLHHHHHHHHHHLLEEEEEEEELLLLLLLHHHHHHHHHHHHLLLLLLEE


DSSP  EEEEELLLLLLLHHHHHHHHHHLLLLEEEEEELLLLLLLLLHHHHHHHHHHHHHHLLEEE
Query TFHMAVSKFDEKTEGQLREIVADGISSFXIFLSYKNFFGVDDGEMYQTLRLAKELGVIVT  180
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct TFHMAVSKFDEKTEGQLREIVADGISSFXIFLSYKNFFGVDDGEMYQTLRLAKELGVIVT  180
DSSP  EEEEELLLLLLLHHHHHHHHHHLLLLEEEEEELLLLLLLLLHHHHHHHHHHHHHHLLEEE


DSSP  EEELLHHHHHHHHHHHHHLLLLLHHHLLLLLLHHHHHHHHHHHHHHHHHHLLEEEELLLL
Query AHCENAELVGRLQQKLLSEGKTGPEWHEPSRPEAVEAEGTARFATFLETTGATGYVVHLS  240
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct AHCENAELVGRLQQKLLSEGKTGPEWHEPSRPEAVEAEGTARFATFLETTGATGYVVHLS  240
DSSP  EEELLHHHHHHHHHHHHHLLLLLHHHLLLLLLHHHHHHHHHHHHHHHHHHLLEEEELLLL


DSSP  LHHHHHHHHHHHHLLLLEEEEEEHHHHHLLHHHHHLLHHHHHLLLLLLLLLLLHHHHHHH
Query CKPALDAAMAAKARGVPIYIESVIPHFLLDKTYAERGGVEAMKYIMSPPLRDKRNQKVLW  300
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct CKPALDAAMAAKARGVPIYIESVIPHFLLDKTYAERGGVEAMKYIMSPPLRDKRNQKVLW  300
DSSP  LHHHHHHHHHHHHLLLLEEEEEEHHHHHLLHHHHHLLHHHHHLLLLLLLLLLLHHHHHHH


DSSP  HHHHLLLLLEEELLLLLLLHHHHHHHLLLHHHLLLLLLLLLLHHHHHHHHHLLLLLLLHH
Query DALAQGFIDTVGTDHCPFDTEQKLLGKEAFTAIPNGIPAIEDRVNLLYTYGVSRGRLDIH  360
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct DALAQGFIDTVGTDHCPFDTEQKLLGKEAFTAIPNGIPAIEDRVNLLYTYGVSRGRLDIH  360
DSSP  HHHHLLLLLEEELLLLLLLHHHHHHHLLLHHHLLLLLLLLLLHHHHHHHHHLLLLLLLHH


DSSP  HHHHHHLHHHHHHLLLLLLLLLLLLLLLLLEEEEELLLLEELLHHHLLLLLLLLLLLLLE
Query RFVDAASTKAAKLFGLFPRKGTIAVGSDADLVVYDPQYRGTISVKTQHVNNDYNGFEGFE  420
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct RFVDAASTKAAKLFGLFPRKGTIAVGSDADLVVYDPQYRGTISVKTQHVNNDYNGFEGFE  420
DSSP  HHHHHHLHHHHHHLLLLLLLLLLLLLLLLLEEEEELLLLEELLHHHLLLLLLLLLLLLLE


DSSP  ELLEEEEEEELLEEEEELLEELLLLLLLLLLLLLLLLL
Query IDGRPSVVTVRGKVAVRDGQFVGEKGWGKLLRREPMYF  458
ident ||||||||||||||||||||||||||||||||||||||
Sbjct IDGRPSVVTVRGKVAVRDGQFVGEKGWGKLLRREPMYF  458
DSSP  ELLEEEEEEELLEEEEELLEELLLLLLLLLLLLLLLLL


No 2: Query=1gkpA Sbjct=4b3zD Z-score=56.1

back to top
DSSP  -LEEEELLEEEELLEEEELEEEELLLLLLEEELLLLLLLLLEEEELLLLEEEELEEEEEE
Query -PLLIKNGEIITADSRYKADIYAEGETITRIGQNLEAPPGTEVIDATGKYVFPGFIDPHV   59
ident   |||| | ||  |    || | |   |  || ||  | |   | | |  | || ||   
Sbjct dRLLIKGGRIINDDQSLYADVYLEDGLIKQIGENLIVPGGVKTIEANGRMVIPGGIDVNT   60
DSSP  lEEEEEEEEEELLLLEEEEEEEEELLEEEEEELLLLLLLLLEEEELLLLEEEELEEEEEE


DSSP  LLLLeelleELLLLHHHHHHHHHHLLEEEEEEEELLLLLLLHHHHHHHHHHHHLLLLLLE
Query HIYLpfmatFAKDTHETGSKAALMGGTTTYIEMCCPSRNDDALEGYQLWKSKAEGNSYCD  119
ident           | |    |  ||| ||||  |    |      |     |   |   | ||
Sbjct YLQK-----TAADDFFQGTRAALVGGTTMIIDHVVPEPGSSLLTSFEKWHEAADTKSCCD  115
DSSP  LLLL-----LLLLLHHHHHHHHHHLLEEEEEEEELLLLLLLHHHHHHHHHHHHHLLLLLE


DSSP  EEEEEELLLLLLLHHHHHHHHHH-LLLLEEEEEELLLLLLLLLHHHHHHHHHHHHHHLLE
Query YTFHMAVSKFDEKTEGQLREIVA-DGISSFXIFLSYKNFFGVDDGEMYQTLRLAKELGVI  178
ident |  |             |   |   |  ||     ||      |   |      | ||  
Sbjct YSLHVDITSWYDGVREELEVLVQdKGVNSFQVYMAYKDVYQMSDSQLYEAFTFLKGLGAV  175
DSSP  EEEEEELLLLLLLHHHHHHHHHHlLLLLEEEEELLLLLLLLLLHHHHHHHHHHHHHHLLE


DSSP  EEEEELLHHHHHHHHHHHHHLLLLLHHHLLLLLLHHHHHHHHHHHHHHHHHHLLEEEELL
Query VTAHCENAELVGRLQQKLLSEGKTGPEWHEPSRPEAVEAEGTARFATFLETTGATGYVVH  238
ident    | ||  |    |   |  | |||| |  ||||  |||   |  |         |   
Sbjct ILVHAENGDLIAQEQKRILEMGITGPEGHALSRPEELEAEAVFRAITIAGRINCPVYITK  235
DSSP  EEEELLLHHHHHHHHHHHHHLLLLLLHHHHHHLLHHHHHHHHHHHHHHHHHHLLLEEEEE


DSSP  LLLHHHHHHHHHHHHLLLLEEEEEEHHHHHLLHHHHHL-LHHHHHLLLLLLLLL-LLHHH
Query LSCKPALDAAMAAKARGVPIYIESVIPHFLLDKTYAER-GGVEAMKYIMSPPLR-DKRNQ  296
ident    | | |    |   |     |        | |         |     ||||  |    
Sbjct VMSKSAADIIALARKKGPLVFGEPIAASLGTDGTHYWSkNWAKAAAFVTSPPLSpDPTTP  295
DSSP  ELLHHHHHHHHHHHHHLLLEEEEELHHHHHLLLHHHHLlLHHHHHHLLLLLLLLlLLLHH


DSSP  HHHHHHHHLLLLLEEELLLLLLLHHHHHHHLLLHHHLLLLLLLLLLHHHHHHHHHLLLLL
Query KVLWDALAQGFIDTVGTDHCPFDTEQKLLGKEAFTAIPNGIPAIEDRVNLLYTYGVSRGR  356
ident   |   || |     |  |||  | ||  ||  || || |   || |        |  | 
Sbjct DYLTSLLACGDLQVTGSGHCPYSTAQKAVGKDNFTLIPEGVNGIEERMTVVWDKAVATGK  355
DSSP  HHHHHHHHHLLLLLLLLLLLLLLHHHHHHHLLLHHHLLLLLLLLLLHHHHHHHHHLLLLL


DSSP  LLHHHHHHHHLHHHHHHLLLLLLLLLLLLLLLLLEEEEELLLLEELLHHHLLLLLLLLLL
Query LDIHRFVDAASTKAAKLFGLFPRKGTIAVGSDADLVVYDPQYRGTISVKTQHVNNDYNGF  416
ident  |   ||   || ||| | | |||| |||||||| |  ||    ||  |       || |
Sbjct MDENQFVAVTSTNAAKIFNLYPRKGRIAVGSDADVVIWDPDKLKTITAKSHKSAVEYNIF  415
DSSP  LLHHHHHHHHLHHHHHHHLLLLLLLLLLLLLLLLEEEEEEEEEEELLLLLLLLLLLLLLL


DSSP  LLLEELLEEEEEEELLEEEEELLEELLLLLLLLLLLLLLLL-------------------
Query EGFEIDGRPSVVTVRGKVAVRDGQFVGEKGWGKLLRREPMY-------------------  457
ident || |  | | ||   ||    ||     || |    |                       
Sbjct EGMECHGSPLVVISQGKIVFEDGNINVNKGMGRFIPRKAFPehlyqrvkirnkvfglqgv  475
DSSP  LLLEEEEEEEEEEELLEEEEELLEELLLLLLLLLLLLLLLLhhhhhhhhhhhhhllllll


DSSP  -l
Query -f  458
ident   
Sbjct sr  477
DSSP  ll


No 3: Query=1gkpA Sbjct=3e74A Z-score=50.8

back to top
DSSP  --LEEEELLEEEELLEEEELEEEELLLLLLEEELLLLLLllLEEEELLLLEEEELEEEEE
Query --PLLIKNGEIITADSRYKADIYAEGETITRIGQNLEAPpgTEVIDATGKYVFPGFIDPH   58
ident    | ||||  |        ||   |  |  ||| |      || || |  | ||  | |
Sbjct sfDLIIKNGTVILENEARVVDIAVKGGKIAAIGQDLGDA--KEVXDASGLVVSPGXVDAH   58
DSSP  leEEEEELLEEELLLLEEELEEEEELLEEEEEELLLLLE--EEEEELLLLEEEELEEEEE


DSSP  ELLlleelleelllLHHHHHHHHHHLLEEEEEEEELL-lllllHHHHHHHHHHHHLLLLL
Query VHIylpfmatfakdTHETGSKAALMGGTTTYIEMCCP-srnddALEGYQLWKSKAEGNSY  117
ident  ||             |||  ||  || || ||                |    | |   
Sbjct THI-----------GYETGTRAAAKGGITTXIEXPLNqlpatvDRASIELKFDAAKGKLT  107
DSSP  ELL-----------LHHHHHHHHHHLLEEEEEELLLLllllllLHHHHHHHHHHHLLLLL


DSSP  LEEEEEEELLLLlllHHHHHHHHHHLLLLEEEEEElllllLLLLHHHHHHHHHHHHHHLL
Query CDYTFHMAVSKFdekTEGQLREIVADGISSFXIFLsyknfFGVDDGEMYQTLRLAKELGV  177
ident  |                 | |    |   || |        | |           ||| 
Sbjct IDAAQLGGLVSY---NIDRLHELDEVGVVGFXCFV-----RDVNDWQFFKGAQKLGELGQ  159
DSSP  LEEEELEELLLL---LLLLHHHHHHHLLLLEEEEL-----LLLLHHHHHHHHHHHHHHLL


DSSP  EEEEEELLHHHHHHHHHHHHHLLLLLHHHLLLLLLHHHHHHHHHHHHHHHHHHLLEEEEL
Query IVTAHCENAELVGRLQQKLLSEGKTGPEWHEPSRPEAVEAEGTARFATFLETTGATGYVV  237
ident  |  |||||     |      ||         |||   | |   |        |    | 
Sbjct PVLVHCENALICDELGEEAKREGRVTAHDYVASRPVFTEVEAIRRVLYLAKVAGCRLHVC  219
DSSP  LEEEELLLHHHHHHHHHHHHHHLLLLHHHHHHLLLHHHHHHHHHHHHHHHHHHLLLEEEL


DSSP  LLLLHHHHHHHHHHHHLLLLEEEEEEHHHHHLLHHHHHLlhhHHHLLLLLLLLLLLHHHH
Query HLSCKPALDAAMAAKARGVPIYIESVIPHFLLDKTYAERggvEAMKYIMSPPLRDKRNQK  297
ident | |          |   |  |  ||    | ||    |           ||| ||  |||
Sbjct HVSSPEGVEEVTRARQEGQDITCESCPHYFVLDTDQFEE---IGTLAKCSPPIRDLENQK  276
DSSP  LLLLHHHHHHHHHHHHLLLLEEEEELLHHHHLLHHHHHH---HLHHHLLLLLLLLHHHHH


DSSP  HHHHHHHLLLLLEEELLLLLLLHHHHHHHlllHHHLLLLLLLLLLHHHHHHHHHLLLLLL
Query VLWDALAQGFIDTVGTDHCPFDTEQKLLGkeaFTAIPNGIPAIEDRVNLLYTYGVSRGRL  357
ident   |  |  | ||    || |   | |            ||              |     
Sbjct GXWEKLFNGEIDCLVSDHSPCPPEXKAGN---IXKAWGGIAGLQSCXDVXFDEAVQKRGX  333
DSSP  HHHHHHHLLLLLEELLLLLLLLLLLLLLL---LLLLLLLLLLHHHHHHHHHHHHLLLLLL


DSSP  LHHHHHHHHLHHHHHHLLLLlLLLLLLLLLLLLEEEEELLLLEELLHHHLLLLLLLLLLL
Query DIHRFVDAASTKAAKLFGLFpRKGTIAVGSDADLVVYDPQYRGTISVKTQHVNNDYNGFE  417
ident     |     | ||  |||   || || | ||| |   |                     
Sbjct SLPXFGKLXATNAADIFGLQ-QKGRIAPGKDADFVFIQPNSSYVLTNDDLEYRHKVSPYV  392
DSSP  LHHHHHHHHLHHHHHHLLLL-LLLLLLLLLLLLEEEEELLLLEELLHHHLLLLLLLLLLL


DSSP  LLEELLEEEEEEELLEEEEELL-EELLLLlLLLLLLLLllll
Query GFEIDGRPSVVTVRGKVAVRDG-QFVGEKgWGKLLRREpmyf  458
ident |  |  |      || |       |      |          
Sbjct GRTIGARITKTILRGDVIYDIEqGFPVAP-KGQFILKH----  429
DSSP  LLEELLEEEEEEELLEEEEELLlLLLLLL-LLLEELLL----


No 4: Query=1gkpA Sbjct=3griA Z-score=43.9

back to top
DSSP  LEEEELLEEEelLEEEELEEEELLLLLLEEELLLLLLLLLEEEELLLLEEEELEEEEEEL
Query PLLIKNGEIItaDSRYKADIYAEGETITRIGQNLEAPPGTEVIDATGKYVFPGFIDPHVH   60
ident   |||||          |||   |  |  |    |   |   ||| |  | ||| | |||
Sbjct XKLIKNGKVLqnGELQQADILIDGKVIKQIAPAIEPSNGVDIIDAKGHFVSPGFVDVHVH   60
DSSP  LEEEELLEEEelLEEEELEEEEELLEEEEEELLLLLLLLLEEEELLLLEEEELEEEEEEL


DSSP  L-LLEElleELLLLHHHHHHHHHHLLEEEEEEEELLllllLHHHHHHHHHHHHLLLLLLE
Query I-YLPFmatFAKDTHETGSKAALMGGTTTYIEMCCPsrndDALEGYQLWKSKAEGNSYCD  119
ident            | | ||| |||  || ||           |  |           |    
Sbjct LrEPGG---EYKETIETGTKAAARGGFTTVCPXPNTrpvpDSVEHFEALQKLIDDNAQVR  117
DSSP  LlLLLL---LLLLLHHHHHHHHHHLLEEEEEELLLLllllLLHHHHHHHHHHHHHHLLLE


DSSP  EEEEEEL---LLLLllHHHHHHHHHHLLLLEEEEEellllLLLL-LHHHHHHHHHHHHHH
Query YTFHMAV---SKFDekTEGQLREIVADGISSFXIFlsyknFFGV-DDGEMYQTLRLAKEL  175
ident                         |  |   |          ||      |     |   
Sbjct VLPYASIttrQLGK--ELVDFPALVKEGAFAFTDD-----GVGVqTASXXYEGXIEAAKV  170
DSSP  ELLLEELlhhHLLL--LLLLHHHHHLLLLLLEEEL-----LLLLlLHHHHHHHHHHHHHH


DSSP  LLEEEEEELLHHHHHHHhhhhhhlllllhhHLLL----------LLLHHHHHHHHHHHHH
Query GVIVTAHCENAELVGRLqqkllsegktgpeWHEP----------SRPEAVEAEGTARFAT  225
ident      ||||   |                                 |   |    ||   
Sbjct NKAIVAHCEDNSLIYGG-------------AXHEgkrskelgipGIPNICESVQIARDVL  217
DSSP  LLLEEELLLLHHHLLLL-------------LEELlhhhhhhlllEELLHHHHHHHHHHHH


DSSP  HHHHHLLEEEELLLLLHHHHHHHHHHHHLLLLEEEEEEHHHHHLLHHHHhLLHHhhHLLL
Query FLETTGATGYVVHLSCKPALDAAMAAKARGVPIYIESVIPHFLLDKTYAeRGGVeaMKYI  285
ident   |  |    | | | |        ||  |     |    | ||       |      | 
Sbjct LAEAAGCHYHVCHVSTKESVRVIRDAKRAGIHVTAEVTPHHLLLTEDDI-PGNN--AIYK  274
DSSP  HHHHHLLLEEELLLLLHHHHHHHHHHHHLLLLEEEEELHHHHHLLHHHL-LLLL--HHHL


DSSP  LLLLLLLLHHHHHHHHHHHLLLLLEEELLLLLLLHHHHHHHlllHHHLLLLLLLLLLHHH
Query MSPPLRDKRNQKVLWDALAQGFIDTVGTDHCPFDTEQKLLGkeaFTAIPNGIPAIEDRVN  345
ident   ||||       |   |  | ||   ||| |     |          | ||   |    
Sbjct XNPPLRSTEDREALLEGLLDGTIDCIATDHAPHARDEKAQP---XEKAPFGIVGSETAFP  331
DSSP  LLLLLLLHHHHHHHHHHHHLLLLLEELLLLLLLLHHHHLLL---LLLLLLLLLLLLLHHH


DSSP  HHHHHHLLLLLLLHHHHHHHHLHHHHHHLLLLllLLLLLLLLLLLEEEEELLLLEELLHH
Query LLYTYGVSRGRLDIHRFVDAASTKAAKLFGLFprKGTIAVGSDADLVVYDPQYRGTISVK  405
ident ||||  |  |       ||    |    | |    ||      |||   |      |   
Sbjct LLYTHFVKNGDWTLQQLVDYLTIKPCETFNLE--YGTLKENGYADLTIIDLDSEQEIKGE  389
DSSP  HHHHHHLLLLLLLHHHHHHHHLHHHHHHLLLL--LLLLLLLLLLLEEEEELLLLEELLHH


DSSP  HLLLLLLLLLLLLLEELLEEEEEEELLEEEEELleelllllllllllllllll
Query TQHVNNDYNGFEGFEIDGRPSVVTVRGKVAVRDgqfvgekgwgkllrrepmyf  458
ident       |   | |    | |    | | |                        
Sbjct DFLSKADNTPFIGYKVYGNPILTXVEGEVKFEG--------------------  422
DSSP  HLLLLLLLLLLLLLEELLEEEEEEELLEEEEEL--------------------


No 5: Query=1gkpA Sbjct=3giqA Z-score=32.7

back to top
DSSP  ---LEEEELLEEEE--LLEEEELEEEELLLLLLEEELLLLLLlLLEEEELLLLEEEELEE
Query ---PLLIKNGEIIT--ADSRYKADIYAEGETITRIGQNLEAPpGTEVIDATGKYVFPGFI   55
ident       |  | ||      |  ||       |  ||     |      || || | ||||
Sbjct eklDFKITGGWIIDgtGAPRRRADLGVRDGRIAAIGELGAHP-ARHAWDASGKIVAPGFI   59
DSSP  lleEEEEELLEELLllLLLLEELEEEEELLEEEEEELLLLLL-EEEEEELLLLEEEELEE


DSSP  EEEELLLLeelleelllLHHHhHHHHHHLLEEEEEEE----ELLLLLL------------
Query DPHVHIYLpfmatfakdTHETgSKAALMGGTTTYIEM----CCPSRND------------   99
ident | | |  |                     | ||                           
Sbjct DVHGHDDL------mfvEKPD-LRWKTSQGITTVVVGncgvSAAPAPLpgntaaalallg  112
DSSP  ELLLLLLL------hhhHLLL-LHHHHLLLEEEEEELllllLLLLLLLlllllhhhhhhl


DSSP  --lhhHHHHHHHHHHL-LLLLLEEEEEEELL----------------llLLLHHHHHHHH
Query --dalEGYQLWKSKAE-GNSYCDYTFHMAVS----------------kfDEKTEGQLREI  140
ident                                                         |   
Sbjct etplfADVPAYFAALDaQRPMINVAALVGHAnlrlaamrdpqaaptaaeQQAMQDMLQAA  172
DSSP  lllllLLHHHHHHHHHhLLLLLEEEEEEEHHhhhhhhlllllllllhhhHHHHHHHHHHH


DSSP  HHLLLLEEEEEELLlLLLL-LLHHHHHHHHHHHHHHLLEEEEEELLhhhhhhhhhhhhhl
Query VADGISSFXIFLSYkNFFG-VDDGEMYQTLRLAKELGVIVTAHCENaelvgrlqqkllse  199
ident    |   |   | |          |     | | |     | |  |              
Sbjct LEAGAVGFSTGLAY-QPGAvAQAAELEGLARVAAERRRLHTSHIRN--------------  217
DSSP  HHHLLLEEEEELLL-LLHHhLLHHHHHHHHHHHHHLLLEEEEELLL--------------


DSSP  llllhhhllllllHHHHHHHHHHHHHHHHHHLLEEEELLLLL---------HHHHHHHHH
Query gktgpewhepsrpEAVEAEGTARFATFLETTGATGYVVHLSC---------KPALDAAMA  250
ident                               ||    | |  |            |     
Sbjct ------------eADGVEAAVEEVLAIGRGTGCATVVSHHKCmmpqnwgrsRATLANIDR  265
DSSP  ------------lLLLHHHHHHHHHHHHHHHLLEEEELLLLLllhhhlllhHHHHHHHHH


DSSP  HHHLLLLEEEEEEHhhHHLL-----------HHHHhllhhhHHLL---------------
Query AKARGVPIYIESVIphFLLD-----------KTYAerggveAMKY---------------  284
ident |   ||                                                      
Sbjct AREQGVEVALDIYP--YPGSstiliperaetIDDI------RITWstphpecsgeyladi  317
DSSP  HHHLLLLEEEEELL--LLEEeeellhhhlllLLLL------EEEEelllhhhllllhhhh


DSSP  ----------------lllllLLLLhHHHHHHHHHHlLLLLEEELLLL-LLLHhhhhhhl
Query ----------------imsppLRDKrNQKVLWDALAqGFIDTVGTDHC-PFDTeqkllgk  327
ident                                           || |              
Sbjct aarwgcdkttaarrlapagaiYFAM-DEDEVKRIFQ-HPCCMVGSDGLpNDAR-------  368
DSSP  hhhhlllhhhhhhhhlleeeeEELL-LHHHHHHHHH-LLLEEELLLLLlLLLL-------


DSSP  llhhhlllLLLLLLLHHHHHHHHHLLLL-LLLHHHHHHHHLHHHHHHLLLLlLLLLLLLL
Query eaftaipnGIPAIEDRVNLLYTYGVSRG-RLDIHRFVDAASTKAAKLFGLFpRKGTIAVG  386
ident           |             |           |       |  ||     |    |
Sbjct --------PHPRLWGSFTRVLGRYVREArLMTLEQAVARMTALPARVFGFA-ERGVLQPG  419
DSSP  --------LLLHHHHHHHHHHHHHHHHLlLLLHHHHHHHHLHHHHHHHLLL-LLLLLLLL


DSSP  LLLLEEEEELLL-leELLHhhlllllLLLLlllleelLEEEEEEELLEEEEelleELLL-
Query SDADLVVYDPQY-rgTISVktqhvnnDYNGfegfeidGRPSVVTVRGKVAVrdgqFVGE-  444
ident   || || ||                |               | | |             
Sbjct AWADVVVFDPDTvadRATW-------DEPT----lasVGIAGVLVNGAEVF----PQPPa  464
DSSP  LLLLEEEELLLLlllLLLL-------LLLL----lllLLEEEEEELLEEEE----LLLLl


DSSP  -LLLLLLLLLlllll
Query -KGWGKLLRRepmyf  458
ident     |  ||      
Sbjct dGRPGQVLRA----x  475
DSSP  lLLLLLLLLL----l


No 6: Query=1gkpA Sbjct=3pnuA Z-score=30.5

back to top
DSSP  leeeelleeeelleeeeleeeelllllleeellllllllleeeELLL-LEEEELEEEEEE
Query pllikngeiitadsrykadiyaegetitrigqnleappgteviDATG-KYVFPGFIDPHV   59
ident                                                         | | 
Sbjct ----------------------------------------enlYFQSnAMKLKNPLDMHL   20
DSSP  ----------------------------------------lllLLLLlLEEEELLEEEEE


DSSP  LLLLeelleelllLHHHHHHHHHHlLEEEEEEEELLLlllLHHHHHHHHHHHHLLLL---
Query HIYLpfmatfakdTHETGSKAALMgGTTTYIEMCCPSrndDALEGYQLWKSKAEGNS---  116
ident |              |                |         ||     |          
Sbjct HLRD-------nqMLELIAPLSAR-DFCAAVIMPNLIpplCNLEDLKAYKMRILKACkde   72
DSSP  LLLL-------hhHHHHHHHHHHL-LLLEEEELLLLLlllLLHHHHHHHHHHHHHHHlll


DSSP  LLEEEEEEELlLLLLlhHHHHHHHHhLLLLEEEEEELL----LLLLLLLHH--HHHHHHH
Query YCDYTFHMAVsKFDEktEGQLREIVaDGISSFXIFLSY----KNFFGVDDG--EMYQTLR  170
ident            |     |  |     | |   |          |             || 
Sbjct NFTPLMTLFF-KNYD--EKFLYSAK-DEIFGIXLYPAGittnSNGGVSSFDieYLKPTLE  128
DSSP  LLEEEEEEEL-LLLL--HHHHHHHL-LLLLEEEELLLLllllLLLLLLLLLhhHHHHHHH


DSSP  HHHHHLLEEEEEELLHHhhhhhhhhhhhlllllhhhlllLLLHhHHHHHHHHHHHHHHHH
Query LAKELGVIVTAHCENAElvgrlqqkllsegktgpewhepSRPEaVEAEGTARFATFLETT  230
ident     |      | |                               |              
Sbjct AMSDLNIPLLVHGETND----------------------FVMD-RESNFAKIYEKLAKHF  165
DSSP  HHHHLLLLEEELLLLLL----------------------LHHH-LLHHHHHHHHHHHHHL


DSSP  L-LEEEELLLLLHHHHHHHHHHhhllLLEEEEEEHHHHHLLHHHHHLLHhHHHLLLLLLL
Query G-ATGYVVHLSCKPALDAAMAAkargVPIYIESVIPHFLLDKTYAERGGvEAMKYIMSPP  289
ident         |   |                |      |          |          | 
Sbjct PrLKIVMEHITTKTLCELLKDY----ENLYATITLHHLIITLDDVIGGK-MNPHLFCKPI  220
DSSP  LlLLEEELLLLLHHHHHHHHHL----LLEEEEELLHHHLLLHHHHHLLL-LLHHHLLLLL


DSSP  LLLLHHHHHHHHHHHLLL-LLEEELLLLLLLHHhhhhhlllhhhLLLLLLLLLLHHHHHH
Query LRDKRNQKVLWDALAQGF-IDTVGTDHCPFDTEqkllgkeaftaIPNGIPAIEDRVNLLY  348
ident          |      |      | |  |                  |          | 
Sbjct AKRYEDKEALCELAFSGYeKVMFGSDSAPHPKG-----------CAAGVFSAPVILPVLA  269
DSSP  LLLHHHHHHHHHHHHLLLlLEEELLLLLLLLLL-----------LLLLLLLHHHHHHHHH


DSSP  HHHLllLLLLHHHHHHHHLHHHHHHlLLLLLlllllllLLLLEEEEELlLLEELLHHH-l
Query TYGVsrGRLDIHRFVDAASTKAAKLfGLFPRkgtiavgSDADLVVYDPqYRGTISVKT-q  407
ident                   |    |                                    
Sbjct ELFK--QNSSEENLQKFLSDNTCKI-YDLKF-------KEDKILTLEE-KEWQVPNVYed  318
DSSP  HHHH--HHLLHHHHHHHHLHHHHHH-HLLLL-------LLLLEEEEEL-LLEELLLLEel


DSSP  llLLLLLLLLLLEELLEEEEeeelleeeeelleelllllllllllllllll
Query hvNNDYNGFEGFEIDGRPSVvtvrgkvavrdgqfvgekgwgkllrrepmyf  458
ident   |       |                                        
Sbjct kyNQVVPYMAGEILKFQLKH-------------------------------  338
DSSP  llLEELLLLLLLEELLEELL-------------------------------


No 7: Query=1gkpA Sbjct=1onxA Z-score=29.5

back to top
DSSP  --------LEEEELLEEEELLEEEELEEEELLLLLLEEELLLLL--LLLLEEEELLLLEE
Query --------PLLIKNGEIITADSRYKADIYAEGETITRIGQNLEA--PPGTEVIDATGKYV   50
ident           |           |   |       |     |      |   | |  |   
Sbjct midytaagFTLLQGAHLYAPEDRGICDVLVANGKIIAVASNIPSdiVPNCTVVDLSGQIL   60
DSSP  llllhhhlLEEEEEEEEELLLEEEEEEEEEELLEEEEEELLLLLllLLLLEEEELLLLEE


DSSP  EELEEEEEELL-LLEE---LLEELLLLhhhHHHHHHHLLEEEEEEEELLLLLLlhhhHHH
Query FPGFIDPHVHI-YLPF---MATFAKDThetGSKAALMGGTTTYIEMCCPSRNDdaleGYQ  106
ident  ||||| |||           |                | |                   
Sbjct CPGFIDQHVHLiGGGGeagPTTRTPEV---ALSRLTEAGVTSVVGLLGTDSIS---rHPE  114
DSSP  EELEEEEEELLlLLLLlllHHHLLLLL---LHHHHHHLLEEEEEELLLLLLLL---lLHH


DSSP  HHHHHHLL--LLLLEEEEEE-ELLLLlllhhHHHHHH-HHLL-LLEEEEEE---LLLLll
Query LWKSKAEG--NSYCDYTFHM-AVSKFdekteGQLREI-VADG-ISSFXIFL---SYKNff  158
ident     |                |         |               |            
Sbjct SLLAKTRAlnEEGISAWMLTgAYHVPsrtitGSVEKDvAIIDrVIGVXCAIsdhRSAA--  172
DSSP  HHHHHHHHhhHHLLEEEEEEeLLLLLlllllLLHHHHhHHLLlEEEEEEEElllLLLL--


DSSP  lLLHHHHHHHHHHHHHHL------LEEEEEELlhhhhhhhhhhhhhlllllhhhlllllL
Query gVDDGEMYQTLRLAKELG------VIVTAHCEnaelvgrlqqkllsegktgpewhepsrP  212
ident   |              |           |                              
Sbjct -PDVYHLANMAAESRVGGllggkpGVTVFHMG---------------------------D  204
DSSP  -LLHHHHHHHHHHHHHHHhhhlllLEEEEEEL---------------------------L


DSSP  HHHHhhhHHHHHHHHH-HHLL--EEEELLLL-LHHHHHHHHHHHHLLllEEEEEEHHHHh
Query EAVEaegTARFATFLE-TTGA--TGYVVHLS-CKPALDAAMAAKARGvpIYIESVIPHFl  268
ident               ||            |     |    |      |    |        
Sbjct SKKA---LQPIYDLLEnCDVPisKLLPTHVNrNVPLFEQALEFARKG--GTIDITSSID-  258
DSSP  LLLL---LHHHHHHHHlLLLLhhHEEEELHHhLHHHHHHHHHHHHLL--LLEEEELLLL-


DSSP  llhhhhhllhhhhhlllllllllllHHHHhHHHHHHLLL-------lLEEELLLLLLlhh
Query ldktyaerggveamkyimspplrdkRNQKvLWDALAQGF-------iDTVGTDHCPFdte  321
ident                                    |            |   |       
Sbjct -------------------------EPVA-PAEGIARAVqagiplarVTLSSDGNGS---  289
DSSP  -------------------------LLLL-HHHHHHHHHhllllhhhEEEELLLLLE---


DSSP  hhhhhlllHHHLLLlLLLLlLHHHHHHHHHLLLLLLLHHHHHHHHLHHHHHHLLLLlLLL
Query qkllgkeaFTAIPNgIPAIeDRVNLLYTYGVSRGRLDIHRFVDAASTKAAKLFGLFpRKG  381
ident                               |      |           |    |   ||
Sbjct qpffddegNLTHIG-VAGF-ETLLETVQVLVKDYDFSISDALRPLTSSVAGFLNLT-GKG  346
DSSP  eeeellllLEEEEE-ELLL-HHHHHHHHHHHHHHLLLHHHHHHHHLHHHHHHLLLL-LLL


DSSP  LLLLLLLLLEEEEELLlleellhhhllllllllllllleelLEEEEEEELLEEEEELLEE
Query TIAVGSDADLVVYDPQyrgtisvktqhvnndyngfegfeidGRPSVVTVRGKVAVRDGQF  441
ident  |  | |||| |  |                           |   |  |||  | ||  
Sbjct EILPGNDADLLVMTPE-------------------------LRIEQVYARGKLMVKDGKA  381
DSSP  LLLLLLLLLEEEELLL-------------------------LLEEEEEELLEEEEELLEE


DSSP  LLLLLllllllllllll
Query VGEKGwgkllrrepmyf  458
ident                  
Sbjct CVKGT--------fetd  390
DSSP  LLLLL--------llll


No 8: Query=1gkpA Sbjct=3nqbA Z-score=28.6

back to top
DSSP  ------------------------LEEEELLEEEEL--LEEEELEEEELLLLLLEEEL--
Query ------------------------PLLIKNGEIITA--DSRYKADIYAEGETITRIGQ--   32
ident                           ||  |            |||   |  |       
Sbjct epadlnddtlraravaaargdqrfDVLITGGTLVDVvtGELRPADIGIVGALIASVHEpa   60
DSSP  llhhhllhhhhhhhhhhhhlllleEEEEELLEEELLllLLEEELEEEEELLEEEEEELll


DSSP  LLLLLllLEEEELLLLEEEELEEEEEELLLLeelleeLLLLHHHHHHHHHHLLEEEEEEE
Query NLEAPpgTEVIDATGKYVFPGFIDPHVHIYLpfmatfAKDTHETGSKAALMGGTTTYIEM   92
ident          |||| | || || || | ||           |      |    | ||    
Sbjct SRRDA--AQVIDAGGAYVSPGLIDTHXHIES------SXITPAAYAAAVVARGVTTIVWD  112
DSSP  LLLLE--EEEEELLLLEEEELEEEEEELHHH------HLLLHHHHHHHHHLLLEEEEEEL


DSSP  EL--LLLLLlhHHHHHHHHHHHLLlLLLEEEEEEELLL---------llllHHHHHHHHH
Query CC--PSRNDdaLEGYQLWKSKAEGnSYCDYTFHMAVSK---------fdekTEGQLREIV  141
ident              |        |                                |    
Sbjct PHefGNVHG--VDGVRWAAKAIEN-LPLRAILLAPSCVpsapglerggadfDAAILADLL  169
DSSP  LHhhHHHHL--HHHHHHHHHHHLL-LLLEEEEEELLLLlllllllllllllLHHHHHHHH


DSSP  HL-LLLE-EEEEellllllLLLH-----HHHHHHHHHHHHHLLEEEEEELlhhhhhhhhh
Query AD-GISS-FXIFlsyknffGVDD-----GEMYQTLRLAKELGVIVTAHCEnaelvgrlqq  194
ident     |     |                                 |  |            
Sbjct SWpEIGGiAEIX-------NXRGvierdPRXSGIVQAGLAAEKLVCGHAR----------  212
DSSP  LLlLEEEeEEEL-------LHHHhhlllHHHHHHHHHHHHHLLEEEELLL----------


DSSP  hhhhlllllhhhllllllhhHHHH-HHHHHHHHHhhhllEEEELLLLLHHHHHHHHHHHh
Query kllsegktgpewhepsrpeaVEAE-GTARFATFLettgaTGYVVHLSCKPALDAAMAAKa  253
ident                              |               |     | |   |  
Sbjct --------------------GLKNaDLNAFXAAG-----VSSDHELVSGEDLXAKLRAG-  246
DSSP  --------------------LLLHhHHHHHHHLL-----LLEELLLLLHHHHHHHHHLL-


DSSP  llllEEEEEEHHHHHllhhhhhllhhhhhlllllllllllhHHHHHHHHH---HLLL-LL
Query rgvpIYIESVIPHFLldktyaerggveamkyimspplrdkrNQKVLWDAL---AQGF-ID  309
ident       ||    |                                   ||          
Sbjct ----LTIELRGSHDH--------------------------LLPEFVAALntlGHLPqTV  276
DSSP  ----LEEEEELLLHH--------------------------HHHHHHHHHhhhLLLLlLE


DSSP  EEELLLLLLlhhhhhhhlllhhhlllLLLL-lLLHHhHHHHHHLlLLLLLHHHHHHHHLH
Query TVGTDHCPFdteqkllgkeaftaipnGIPA-iEDRVnLLYTYGVsRGRLDIHRFVDAAST  368
ident |  ||                                      | |  |       ||  
Sbjct TLCTDDVFP-----------------DDLLqgGGLD-DVVRRLV-RYGLKPEWALRAATL  317
DSSP  EEELLLLLH-----------------HHHHhlLLHH-HHHHHHH-HLLLLHHHHHHHHLH


DSSP  HHHHHLLLlLLLLLLLLLLLLLEEEEELllleellhhhllllllllllllleELLEEEEE
Query KAAKLFGLfPRKGTIAVGSDADLVVYDPqyrgtisvktqhvnndyngfegfeIDGRPSVV  428
ident  ||   |     | || |  || ||                                  |
Sbjct NAAQRLGR-SDLGLIAAGRRADIVVFED-----------------------lNGFSARHV  353
DSSP  HHHHHHLL-LLLLLLLLLLLLLEEEELL-----------------------lLLLLEEEE


DSSP  EELLEEEEELLEELLLLL------------------------------------------
Query TVRGKVAVRDGQFVGEKG------------------------------------------  446
ident    |      |                                                 
Sbjct LASGRAVAEGGRXLVDIPtcdttvlkgsxklplrxandflvksqgakvrlatidrprftq  413
DSSP  EELLEEEEELLEELLLLLllllhhhllllllllllhhhhllllllleeeeeeeellllle


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  446
ident                                                             
Sbjct wgeteadvkdgfvvppegatxisvthrhgxaepttktgfltgwgrwngafattvshdshn  473
DSSP  eeeeeeeeelleellllleeeeeeellllllllleeeeeeellllllleeeellllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  446
ident                                                             
Sbjct ltvfggnagdxalaanavigtgggxavasegkvtailplplsglvsdapleevarafedl  533
DSSP  eeeeellhhhhhhhhhhhhhllleeeeeelleeeeeeelllllllllllhhhhhhhhhhh


DSSP  ------------------------------------------llllllllllll
Query ------------------------------------------wgkllrrepmyf  458
ident                                                       
Sbjct reavgkvvewqppylvfkacfgatlacnigphqtdxgiadvltgkvxespviev  587
DSSP  hhhhhhhlllllllllhhhhhlllllllllleelllleeelllleeellleeel


No 9: Query=1gkpA Sbjct=1yrrB Z-score=27.9

back to top
DSSP  lEEEELLEEEELLEEEE-LEEEELLLLLLEEELLLLLLLLLEEEELLLLEEEELEEEEEE
Query pLLIKNGEIITADSRYK-ADIYAEGETITRIGQNLEAPPGTEVIDATGKYVFPGFIDPHV   59
ident       | | |                |       | ||  |     |    |||||   
Sbjct -YALTQGRIFTGHEFLDdHAVVIADGLIKSVCPVAELPPEIEQRSLNGAILSPGFIDVQL   59
DSSP  -LEEELLEEELLLLEELlEEEEEELLEEEEEEEHHHLLLLLLEEELLLLEEEELEEEEEE


DSSP  L-----LLLEelLEEL--lLLHHHHHHHHHHLLEEEEEEEELLLlLLLHHHHHHHHHHHH
Query H-----IYLPfmATFA--kDTHETGSKAALMGGTTTYIEMCCPSrNDDALEGYQLWKSKA  112
ident                |    | |   ||    | | |         |             
Sbjct NgcggvQFND--TAEAvsvETLEIMQKANEKSGCTNYLPTLITT-SDELMKQGVRVMREY  116
DSSP  LeelleELLL--LLLLllhHHHHHHHHHHHLLLEEEEEEEELLL-LHHHHHHHHHHHHHH


DSSP  LLLLLLEEE-EEEELLLLLLLHHHHHHHHHhLLLLEEEEEelllllllLLHHhhHHHHHH
Query EGNSYCDYT-FHMAVSKFDEKTEGQLREIVaDGISSFXIFlsyknffgVDDGemYQTLRL  171
ident            |             | |   | |                          
Sbjct LAKHPNQALgLHLEGPWLNAALVDFLCENA-DVITKVTLA-------pEMVP--AEVISK  166
DSSP  HHHLLLLLLlEEEELLLLLLHHHHHHHHLH-HHEEEEEEL-------hHHLL--HHHHHH


DSSP  HHHHLLEEEEEELlhhhhhhhhhhhhhlllllhhhllllllhhhhhHHHH-HHHHHHHhh
Query AKELGVIVTAHCEnaelvgrlqqkllsegktgpewhepsrpeaveaEGTA-RFATFLEtt  230
ident     |  | |                                      |           
Sbjct LANAGIVVSAGHS---------------------------------NATLkEAKAGFR--  191
DSSP  HHHHLLEEEELLL---------------------------------LLLHhHHHHHHH--


DSSP  LLEEEELLLL---------lhHHHHHHHHHHhlllLEEEEEEHhhHHLLhhhhhllhhhh
Query GATGYVVHLS---------ckPALDAAMAAKargvPIYIESVIphFLLDktyaerggvea  281
ident        ||                |          ||         |            
Sbjct AGITFATHLYnampyitgrepGLAGAILDEA----DIYCGIIA--DGLH-----------  234
DSSP  HLEEEELLLLlllllllllllHHHHHHHHLL----LLEEEEEL--LLLL-----------


DSSP  hlllllllllllhHHHHHHHHHHLLL-LLEEELLLLlllhhhhhhhlllhhhllLLLLLl
Query mkyimspplrdkrNQKVLWDALAQGF-IDTVGTDHCpfdteqkllgkeaftaipNGIPAi  340
ident                     |           ||                     |    
Sbjct ------------vDYANIRNAKRLKGdKLCLVTDAT------------------SGSSL-  263
DSSP  ------------lLHHHHHHHHHHHHhHEEEELLLL------------------LLLLL-


DSSP  lLHHHHHHhHHLLLLLLLHHHHHHHHLHHHHHHLLLLLLLLLLLLLLLLLEEEEELllle
Query eDRVNLLYtYGVSRGRLDIHRFVDAASTKAAKLFGLFPRKGTIAVGSDADLVVYDPqyrg  400
ident            |             |    |   |   | || | |  | |    |    
Sbjct -TMIEGVR-NLVEHCGIALDEVLRMATLYPARAIGVEKRLGTLAAGKVANLTAFTP----  317
DSSP  -LHHHHHH-HHHHHHLLLHHHHHHHHLHHHHHHLLLLLLLLLLLLLLLLLEEEELL----


DSSP  ellhhhllllllllllllleeLLEEEEEEELLEEEEELleelllllllllllllllll
Query tisvktqhvnndyngfegfeiDGRPSVVTVRGKVAVRDgqfvgekgwgkllrrepmyf  458
ident                      |       | |   |                      
Sbjct ---------------------DFKITKTIVNGNEVVTQ--------------------  334
DSSP  ---------------------LLLEEEEEELLEEEEEL--------------------


No 10: Query=1gkpA Sbjct=2vunA Z-score=27.8

back to top
DSSP  -LEEEELL-EEEEL----LEEEELEEEELLLLLLEEE-LLLL-lLLLLEEEELLLLEEEE
Query -PLLIKNG-EIITA----DSRYKADIYAEGETITRIG-QNLE-aPPGTEVIDATGKYVFP   52
ident     |||   |              |  |   |  ||   |         ||| |  | |
Sbjct sKTIIKNIgKIVSGdiksPVLQADTIVVEDGLIAAIGgEELMkdAGDATIIDAAGSTVTP   60
DSSP  lEEEEELLlEEELLllllLEELLLEEEEELLEEEEEElHHHHllLLLLEEEELLLLEEEE


DSSP  LEEEEEELLLleelleELLLLhhHHHHHHHHLLEEEEEEEEL-----LLLL-LLHHHHHH
Query GFIDPHVHIYlpfmatFAKDTheTGSKAALMGGTTTYIEMCC-----PSRN-DDALEGYQ  106
ident |  | |||          |         || || || |                      
Sbjct GLLDTHVHVSggdyapRQKTM--DFISSALHGGVTTMISAGSphfpgRPKDaAGTKALAI  118
DSSP  LEEEEEELLLllleehHHLEE--LHHHHHHLLLEEEEEELLLlllllLLLLhHHHHHHHH


DSSP  HHHHHH-LLLLL-LEEEE-EEELLLLLllHHHHHHHHHHLLLLEE-EEEElllllLLLLH
Query LWKSKA-EGNSY-CDYTF-HMAVSKFDekTEGQLREIVADGISSF-XIFLsyknfFGVDD  162
ident                         |    ||    |    |        |          
Sbjct TLSKSYyNARPAgVKVHGgAVILEKGL--TEEDFIEMKKEGVWIVgEVGL-----GTIKN  171
DSSP  HHHHHHhHLLHHhLEEELlEELLLLLL--LHHHHHHHHHLLLLEEeEELL-----LLLLL


DSSP  -HHHHHHHHHHHHHLLEEEEEE-LLHHHHHhhhhhhhhlllllhhhllllllhhHHHHhh
Query -GEMYQTLRLAKELGVIVTAHC-ENAELVGrlqqkllsegktgpewhepsrpeaVEAEgt  220
ident           |   |  |  |                                       
Sbjct pEDAAPMVEWAHKHGFKVQMHTgGTSIPGS-----------------------sTVTA--  206
DSSP  hHHHHHHHHHHHHLLLEEEEELlLLLLLLL-----------------------lLLLH--


DSSP  HHHHHHHhhhllEEEELLLL------LHHHHHHHHHHHhlllLEEEEEEHHHHHllhhhh
Query ARFATFLettgaTGYVVHLS------CKPALDAAMAAKargvPIYIESVIPHFLldktya  274
ident                | |             |  |           | |           
Sbjct DDVIKTK-----PDVVSHINggptaiSVQEVDRIMDET----DFAMEIVQCGNP------  251
DSSP  HHHHHHL-----LLEEELLLllllllLHHHHHHHHHHL----LLEEEEELLLLH------


DSSP  hllhhhhhlllllllllllHHHHHHHHHHH---LLLLLEEELLLLLllhhhhhhhlllhh
Query erggveamkyimspplrdkRNQKVLWDALA---QGFIDTVGTDHCPfdteqkllgkeaft  331
ident                              |   |      | |                 
Sbjct -------------------KIADYVARRAAekgQLGRVIFGNDAPS--------------  278
DSSP  -------------------HHHHHHHHHHHhhlLHHHEEEELLLLL--------------


DSSP  hllLLLLLlLLHHHHHHHHHLLLLLLLHHHHHHHHLHHHHHHLLLllLLLLLLLLLLLLE
Query aipNGIPAiEDRVNLLYTYGVSRGRLDIHRFVDAASTKAAKLFGLfpRKGTIAVGSDADL  391
ident                      |    |    |  |        ||    | || |  |||
Sbjct ---GTGLI-PLGILRNMCQIASMSDIDPEVAVCMATGNSTAVYGL--NTGVIAPGKEADL  332
DSSP  ---LLLLL-LLHHHHHHHHHHHHLLLLHHHHHHHHLHHHHHHHLL--LLLLLLLLLLLLE


DSSP  EEEElLLLEellhhhlllllllllllllEELLEEEEEEELLEEEEELLEellllllllll
Query VVYDpQYRGtisvktqhvnndyngfegfEIDGRPSVVTVRGKVAVRDGQfvgekgwgkll  451
ident    |    |                         |||   |   |               
Sbjct IIMD-TPLG-------svaedamgaiaaGDIPGISVVLIDGEAVVTKSR------ntppa  378
DSSP  EEEE-LLLL-------lllllhhhhhhhLLLLEEEEEEELLEEEELLLL------lllll


DSSP  lllllll
Query rrepmyf  458
ident        
Sbjct kraakil  385
DSSP  lllleel


No 11: Query=1gkpA Sbjct=4cqbA Z-score=26.9

back to top
DSSP  ----LEEEELLEEEelLEEEELEEEELLLLLLEEELLLLlLLLLEEEELLLLEEEELEEE
Query ----PLLIKNGEIItaDSRYKADIYAEGETITRIGQNLEaPPGTEVIDATGKYVFPGFID   56
ident      | | |            ||   |  |  |    |       ||| |  | ||| |
Sbjct skdfDLIIRNAYLS--EKDSVYDIGIVGDRIIKIEAKIE-GTVKDEIDAKGNLVSPGFVD   57
DSSP  llleEEEEEEEEEL--LLLEEEEEEEELLEEEEEELLLL-LLEEEEEELLLLLEEELEEE


DSSP  EEELLLL------------------------EELLE-------ellLLHHHHHHHHHHLL
Query PHVHIYL------------------------PFMAT-------fakDTHETGSKAALMGG   85
ident  | |                                                       |
Sbjct AHTHMDKsftstgerlpkfwsrpytrdaaieDGLKYyknatheeikRHVIEHAHMQVLHG  117
DSSP  EEELHHHllllllllllllllllllhhhhhhHHHHHhhhllhhhhhHHHHHHHHHHHHLL


DSSP  EEEEEEEELLLlLLLHHHHHHHHHHHHLLLL-LLEEEEEEEL-LLLL--LLHHHHHHHHH
Query TTTYIEMCCPSrNDDALEGYQLWKSKAEGNS-YCDYTFHMAV-SKFD--EKTEGQLREIV  141
ident |                          |      |        | |      |   |   
Sbjct TLYTRTHVDVD-SVAKTKAVEAVLEAKEELKdLIDIQVVAFAqSGFFvdLESESLIRKSL  176
DSSP  EEEEEEEEELL-LLLLLHHHHHHHHHHHHLLlLLEEEEEEELlLLLLllLLHHHHHHHHH


DSSP  HLLLLEEEEEE--LLLLllllLHHHHHHHHHHHHHHLLEEEEEELLhhhhhhhhhhhhhl
Query ADGISSFXIFL--SYKNffgvDDGEMYQTLRLAKELGVIVTAHCENaelvgrlqqkllse  199
ident   |             |      |       ||||  |    |                 
Sbjct DMGCDLVGGVDpaTREN---nVEGSLDLCFKLAKEYDVDIDYHIHD--------------  219
DSSP  HHLLLEEELLLllLLLL---lHHHHHHHHHHHHHHLLLEEEEEELL--------------


DSSP  llllhhhlllllLHHHHHHHHHHHHHHHHHHLL--EEEELLLL-LHHH----hhhHHHHH
Query gktgpewhepsrPEAVEAEGTARFATFLETTGA--TGYVVHLS-CKPA----ldaAMAAK  252
ident                |      | |      |        |      |       |    
Sbjct ------------IGTVGVYSINRLAQKTIENGYkgRVTTSHAWcFADApsewldeAIPLY  267
DSSP  ------------LHHHHHHHHHHHHHHHHHLLLllLEEEEELLhHHHLlhhhhhhHHHHH


DSSP  HlLLLEEEEEEHHHHhllhhhhhllhhhhhlllllllllllhhHHHHhhHHHLL----LL
Query ArGVPIYIESVIPHFlldktyaerggveamkyimspplrdkrnQKVLwdALAQG----FI  308
ident                                                             
Sbjct K-DSGMKFVTCFSST----------------------------PPTM--PVIKLleagIN  296
DSSP  H-HHLLEEEEELLLL----------------------------LLLL--LHHHHhhllLE


DSSP  LEEELLLLLLlhhhhhhhlllhhhlLLLL-LLLLlHHHHHHHHH-llLLLL--LHHHHHH
Query DTVGTDHCPFdteqkllgkeaftaiPNGI-PAIEdRVNLLYTYG-vsRGRL--DIHRFVD  364
ident      |                              |                |      
Sbjct LGCASDNIRD---------------FWVPfGNGD-MVQGALIETqrlELKTnrDLGLIWK  340
DSSP  EEEELLLLLL---------------LLLLlLLLL-HHHHHHHHHhhhLLLLhhHHHHHHH


DSSP  HHLHHHHHHLLLLLLLlLLLLLLLLLEEEEELLlleellhhhlllllllllllllEELLE
Query AASTKAAKLFGLFPRKgTIAVGSDADLVVYDPQyrgtisvktqhvnndyngfegfEIDGR  424
ident       |   |       | ||  |||||                               
Sbjct MITSEGARVLGIEKNY-GIEVGKKADLVVLNSL----------------spqwaiIDQAK  383
DSSP  HHLHHHHHHHLLHHHL-LLLLLLLLLEEEELLL----------------lhhhhhHHLLL


DSSP  EEEEEELLEEEEELLEELLlllllllllllllll
Query PSVVTVRGKVAVRDGQFVGekgwgkllrrepmyf  458
ident    |   |   | |   |                
Sbjct RLCVIKNGRIIVKDEVIVA---------------  402
DSSP  EEEEEELLEEEEELLEELL---------------


No 12: Query=1gkpA Sbjct=2pajA Z-score=25.2

back to top
DSSP  -LEEEELL-EEEEL--------LEEEELEEEELLLLLLEEELlLLLLLLLEEEELLLLEE
Query -PLLIKNG-EIITA--------DSRYKADIYAEGETITRIGQnLEAPPGTEVIDATGKYV   50
ident    || |   | |               ||   | ||  ||  |   ||    |||    
Sbjct pSTLIRNAaAIMTGgrgtaddpSRVPGPDIRIVGDTIDAIGA-LAPRPGETIVDATDCVI   59
DSSP  lEEEEELLlEELLLllllllllLLLLLLLEEEELLEEEEELL-LLLLLLLEEEELLLLEE


DSSP  EELEEEEEELLLL-------EELLE---ellLLHHHHHHHHHHLLEEEEEEEELLLLLLl
Query FPGFIDPHVHIYL-------PFMAT---fakDTHETGSKAALMGGTTTYIEMCCPSRNDd  100
ident  |     | |                          |       |  |            
Sbjct YPAWVNTHHHLFQsllkgepFRALFderrfrLAARIGLIELARSGCATVADHNYVYYPG-  118
DSSP  EELEELLLLLHHHhhlllllLHHHLlhhhhhHHHHHHHHHHHLLLEEEEEELLLLLLLL-


DSSP  hhhhhHHHHHHHLLLL---LLEEEEEEELLL----------------LLLLHHHHHHHHH
Query alegyQLWKSKAEGNS---YCDYTFHMAVSK----------------FDEKTEGQLREIV  141
ident                                                             
Sbjct ---mpFDSSAILFEEAeklGLRFVLLRGGATqtrqleadlptalrpeTLDAYVADIERLA  175
DSSP  ---llLLHHHHHHHHHhhlLLEEEEEELLLLllllllllllhhhlllLHHHHHHHHHHHH


DSSP  HLLL---------LEEEE-EELLllllLLLHHHHHHHHHHHHHHLLEEEEEELlhhhhhh
Query ADGI---------SSFXI-FLSYknffGVDDGEMYQTLRLAKELGVIVTAHCEnaelvgr  191
ident |                     |         ||  |   |  ||     |         
Sbjct ARYHdaspramrrVVMAPtTVLY----SISPREMRETAAVARRLGLRMHSHLS-------  224
DSSP  HHLLllllllleeEEELLlLLLL----LLLHHHHHHHHHHHHHLLLEEEEELL-------


DSSP  hhhhhhhlllllhhhllllllhhhhhHHHHHHHHHHhhhllEEEELLLLLHH--HHHHHH
Query lqqkllsegktgpewhepsrpeaveaEGTARFATFLettgaTGYVVHLSCKP--ALDAAM  249
ident                              |                ||            
Sbjct ------------------------gkSPVAFCGEHD-wlgsDVWYAHLVKVDadEIALLA  259
DSSP  ------------------------llLHHHHHHHLL-llllLEEEELLLLLLhhHHHHHH


DSSP  HHHhllllEEEEEEHHHHHLLhhhhhllhhhhhlllllllllllhhhhHHHHHHHLLLLL
Query AAKargvpIYIESVIPHFLLDktyaerggveamkyimspplrdkrnqkVLWDALAQGFID  309
ident                                                         |   
Sbjct QTG-----TGVAHCPQSNGRL---------------------------PVREMADAGVPV  287
DSSP  HHL-----LEEEELHHHHHLL---------------------------LLLLHHHHLLLE


DSSP  EEELLLLLllhhhhhhhlllhhhlllLLLLLL--LHHHHHHHHHlLLLLLLHHHHHHHHL
Query TVGTDHCPfdteqkllgkeaftaipnGIPAIE--DRVNLLYTYGvSRGRLDIHRFVDAAS  367
ident   | |                        |      |              |        
Sbjct SIGVDGAA------------------SNEAADmiSEVHMTWLAQ-RARLASIAEVIHWGT  328
DSSP  EELLLHHH------------------HLLLLLhhHHHHHHHHHH-HHLLLLHHHHHHHHL


DSSP  HHHHHHLLLLlLLLLLLLLLLLLEEEEELLLL--------------EELLhhhlllllll
Query TKAAKLFGLFpRKGTIAVGSDADLVVYDPQYR--------------GTISvktqhvnndy  413
ident    |   ||    |  |||  ||  ||                                 
Sbjct AGGARVMGLD-EVGKVAVGYAADIAVYRLDDPryfglhdpaigpvaSGGR----------  377
DSSP  HHHHHHHLLL-LLLLLLLLLLLLEEEEELLLHhhlllllhhhhhhhLLLL----------


DSSP  lllllleelLEEEEEEELLEEEEELLEEL--------llllllllllllllll
Query ngfegfeidGRPSVVTVRGKVAVRDGQFV--------gekgwgkllrrepmyf  458
ident                   ||  | |                            
Sbjct ---------PSVMALFSAGKRVVVDDLIEgvdikelggearrvvrellrevvv  421
DSSP  ---------LEEEEEEELLEEEEELLLLLlllhhhhhhhhhhhhhhhhhhhhl


No 13: Query=1gkpA Sbjct=2ogjA Z-score=24.9

back to top
DSSP  --LEEEELLEEEELL---EEEELEEEELL-LLLLEEELLLLLLlLLEEEELLlLEEEELE
Query --PLLIKNGEIITAD---SRYKADIYAEG-ETITRIGQNLEAPpGTEVIDATgKYVFPGF   54
ident   | |  |          |    ||   |   |   |  | ||              || 
Sbjct qaPILLTNVKPVGFGkgaSQSSTDILIGGdGKIAAVGSALQAP-ADTQRIDA-AFISPGW   58
DSSP  llLEEEEEEEELLLLlllLLLLEEEEELLlLLEEEEELLLLLL-LLEEELLL-LEEEELE


DSSP  EEEEELLLLEelleELLLLhhhHHHHHHHLLEEEEEEEELLlllllHHHHHHHHHHHHLL
Query IDPHVHIYLPfmatFAKDThetGSKAALMGGTTTYIEMCCPsrnddALEGYQLWKSKAEG  114
ident  | ||||                |      | ||                          
Sbjct VDLHVHIWHG--gtDISIR---PSECGAERGVTTLVDAGSA-----GEANFHGFREYIIE  108
DSSP  EEEEELLLLL--llLLLLL---HHHLLHHHLEEEEEEELLL-----LLLLHHHHHHHLLL


DSSP  LLLLEEEEEEELL-------------lLLLL-HHHHHHH-HHHLL--LLEEEEEELllLL
Query NSYCDYTFHMAVS-------------kFDEK-TEGQLRE-IVADG--ISSFXIFLSykNF  157
ident  |                                    |        |   |   |    
Sbjct PSRERIKAFLNLGsiglvacnrvpelrDIKDiDLDRILEcYAENSehIVGLXVRAS--HV  166
DSSP  LLLLEEEEEEELLllllllllllllllLHHHlLHHHHHHhHHLLLllEEEEEEEEL--HH


DSSP  LL--lLHHHHHHHHHHHHHHLLEEEEEELLHHhhhhhhhhhhhlllllhhhllllllhhh
Query FG--vDDGEMYQTLRLAKELGVIVTAHCENAElvgrlqqkllsegktgpewhepsrpeav  215
ident                 || | |    |                                 
Sbjct ITgswGVTPVKLGKKIAKILKVPXXVHVGEPP----------------------------  198
DSSP  HHlllLLHHHHHHHHHHHHHLLLEEEEELLLL----------------------------


DSSP  hhhHHHHHHHHHHhhllEEEELLL-------LLHH---HHHHHHHHHhlllLEEEEEEHH
Query eaeGTARFATFLEttgaTGYVVHL-------SCKP---ALDAAMAAKargvPIYIESVIP  265
ident            |        | |        |          |         |       
Sbjct --aLYDEVLEILG---pGDVVTHCfngksgsSIXEdedLFNLAERCE----GIRLDIGHG  249
DSSP  --lLHHHHHHHLL---lLLEEELLlllllllLLLLlhhHHHHHHHLL----LLEEELLLL


DSSP  hhhllhhhhhllhhhhhlllLLLLLlllHHHHHHHHHhhLLLLLEEELLLLLllhhhhhh
Query hflldktyaerggveamkyiMSPPLrdkRNQKVLWDAlaQGFIDTVGTDHCPfdteqkll  325
ident                                                ||           
Sbjct --------------------GASFS--fKVAEAAIAR--GLLPFSISTDLHG--------  277
DSSP  --------------------LLLLL--hHHHHHHHHL--LLLLLLLLLLLLL--------


DSSP  hlllhhhlllLLLL--lLLHHHHHhHHHLlLLLLLHHHHHHHHLHHHHHHLLLLLLllLL
Query gkeaftaipnGIPA--iEDRVNLLyTYGVsRGRLDIHRFVDAASTKAAKLFGLFPRkgTI  383
ident                   |                    | |     |    |       
Sbjct ----------HSXNfpvWDLATTX-SKLL-SVDXPFENVVEAVTRNPASVIRLDXE-nRL  324
DSSP  ----------LLLLlllLLHHHHH-HHHH-HLLLLHHHHHHLLLHHHHHHLLLLLL-lLL


DSSP  LLLLLLLEEEEELlLLEELLhhhlllllllllllLLEELLEEEEEEELLEEeEELLeell
Query AVGSDADLVVYDPqYRGTISvktqhvnndyngfeGFEIDGRPSVVTVRGKVaVRDGqfvg  443
ident  ||  ||  | |                             |                  
Sbjct DVGQRADFTVFDL-VDADLE-----atdsngdvsRLKRLFEPRYAVIGAEA-IAAS----  373
DSSP  LLLLLLEEEEEEE-EEEEEE-----eellllleeEEEEEEEEEEEEELLEE-EELL----


DSSP  lllllllllllllll
Query ekgwgkllrrepmyf  458
ident                
Sbjct ---------ryipra  379
DSSP  ---------llllll


No 14: Query=1gkpA Sbjct=3mtwA Z-score=24.8

back to top
DSSP  --LEEEELLEEEEL--LEEEE-LEEEELLLLLLEEEL-LLLLLLLLEEEELLLLEEEELE
Query --PLLIKNGEIITA--DSRYK-ADIYAEGETITRIGQ-NLEAPPGTEVIDATGKYVFPGF   54
ident                                || ||      | |    |  |    || 
Sbjct aeIKAVSAARLLDVasGKYVDnPLVIVTDGRITSIGKkGDAVPAGATAVDLPGVTLLPGL   60
DSSP  llEEEEEEEEEEELllLEEEElEEEEEELLEEEEEEElLLLLLLLLEEEEEEEEEEEELE


DSSP  EEEEELLLL-------eELLE---ELLLLHHHHHHHHHHLLEEEEEEEELllllllhhhh
Query IDPHVHIYL-------pFMAT---FAKDTHETGSKAALMGGTTTYIEMCCpsrnddaleg  104
ident || |||                  |         |  |  | ||                
Sbjct IDMHVHLDSlaevggynSLEYsdrFWSVVQTANAKKTLEAGFTTVRNVGA----------  110
DSSP  EEEEELLLLlllllhhhHHHLlhhHHHHHHHHHHHHHHHLLEEEEEELLL----------


DSSP  HHHH-HHHHLLL-----LLLEEEEE-EELL---------------------LLLL--LHH
Query YQLW-KSKAEGN-----SYCDYTFH-MAVS---------------------KFDE--KTE  134
ident          |                                           |      
Sbjct ADYDdVGLREAIdagyvPGPRIVTAaISFGatgghcdstffppsmdqknpfNSDSpdEAR  170
DSSP  LLLHhHHHHHHHhllllLLLEEEELlLLEEllllllllllllhhhllllllLLLLhhHHH


DSSP  HHHHHHHHLLLLEEEEEELL--------llllLLLHHHHHHHHHHHHHHLLEEEEEELlh
Query GQLREIVADGISSFXIFLSY--------knffGVDDGEMYQTLRLAKELGVIVTAHCEna  186
ident    |     |    ||                     ||      |   |  | ||    
Sbjct KAVRTLKKYGAQVIXICATGgvfsrgnepgqqQLTYEEMKAVVDEAHMAGIKVAAHAH--  228
DSSP  HHHHHHHHLLLLEEEEELLLllllllllllllLLLHHHHHHHHHHHHHLLLEEEEEEL--


DSSP  hhhhhhhhhhhhlllllhhhllllllhhhHHHHHHHHHHHHhhhllEEEELLLLLhhHHH
Query elvgrlqqkllsegktgpewhepsrpeavEAEGTARFATFLettgaTGYVVHLSCkpALD  246
ident                               | |                  | |     |
Sbjct -----------------------------GASGIREAVRAG-----VDTIEHASL--VDD  252
DSSP  -----------------------------LHHHHHHHHHLL-----LLEEEELLL--LLH


DSSP  HHHHHHHlLLLEEEEEEhhHHHLL--HHHHhllhHHHHL--lllllLLLLLHH-HHHHHH
Query AAMAAKArGVPIYIESVipHFLLD--KTYAerggVEAMK--yimspPLRDKRN-QKVLWD  301
ident             |          |                                    
Sbjct EGIKLAV-QKGAYFSMD--IYNTDytQAEG----KKNGVlednlrkDRDIGELqRENFRK  305
DSSP  HHHHHHH-HHLLEEELL--LLLHHhhHHHH----HHHLLlhhhhhhHHHHHHHhHHHHHH


DSSP  HHHLLLLLEEELLLLlllhhhhhhhlllhhhllllLLLLLLHHhHHHHHHLlLLLLLHHH
Query ALAQGFIDTVGTDHCpfdteqkllgkeaftaipngIPAIEDRVnLLYTYGVsRGRLDIHR  361
ident ||  |     |||                      |    |         | |       
Sbjct ALKAGVKMVYGTDAG--------------------IYPHGDNA-KQFAVMV-RYGATPLQ  343
DSSP  HHHHLLEEELLLLLL--------------------LLLLLLHH-HHHHHHH-HLLLLHHH


DSSP  HHHHHLHHHHHHLLLLLLLLLLLLLLLLLEEEEELLlleellhhhlllllllllllllEE
Query FVDAASTKAAKLFGLFPRKGTIAVGSDADLVVYDPQyrgtisvktqhvnndyngfegfEI  421
ident     |   ||   |     |  |||   |                               
Sbjct AIQSATLTAAEALGRSKDVGQVAVGRYGDMIAVAGD-------------------plaDV  384
DSSP  HHHHLLHHHHHHHLLLLLLLLLLLLLLLLEEEELLL-------------------lllLH


DSSP  LL--EEEEEEELLEEEEELleelllllllllllllllll
Query DG--RPSVVTVRGKVAVRDgqfvgekgwgkllrrepmyf  458
ident      |  |   | |                        
Sbjct TTleKPVFVMKGGAVVKAP-------------------x  404
DSSP  HHhhLLLEEEELLEEEELL-------------------l


No 15: Query=1gkpA Sbjct=2oofA Z-score=24.1

back to top
DSSP  ---LEEEELLEEEEL------LEEE-ELEEEELLLLLLEEELL-lllLLLLeEEELLLLE
Query ---PLLIKNGEIITA------DSRY-KADIYAEGETITRIGQN-leaPPGTeVIDATGKY   49
ident         |    |                      |           |     |  || 
Sbjct lncERVWLNVTPATLrsdladYGLLePHALGVHEGRIHALVPXqdlkYPAH-WQDXKGKL   59
DSSP  lllLEEEEEEEELLLllllllLLLLlLEEEEEELLEEEEEEEHhhllLLLL-LEELLLLE


DSSP  EEELEEEEEELLLLE----------------------------ELLEE-------lllLH
Query VFPGFIDPHVHIYLP----------------------------FMATF-------akdTH   74
ident | || || | |                                                 
Sbjct VTPGLIDCHTHLIFAgsraeefelrqkgvpyaeiarkgggiisTVRATraasedqlfeLA  119
DSSP  EEELEEEEEELLLLLlllhhhhhhhhhlllhhhhhhllllhhhHHHHHhhllhhhhhhHH


DSSP  HHHHHHHHHLLEEEEEEEELLLllLLHHHHHHHHHHHHL--LLLLLEEEEEEELL-----
Query ETGSKAALMGGTTTYIEMCCPSrnDDALEGYQLWKSKAE--GNSYCDYTFHMAVS-----  127
ident     |     | ||                                              
Sbjct LPRVKSLIREGVTTVEIKSGYG--LTLEDELKXLRVARRlgEALPIRVKTTLLAAhavpp  177
DSSP  HHHHHHHHHHLEEEEEEELLLL--LLHHHHHHHHHHHHHhhHHLLLEEEEEEEEEllllh


DSSP  -------lLLLLH-HHHHHHHHHLL-LLEEEEEELLLlllLLLHHHHHHHHHHHHHHLLE
Query -------kFDEKT-EGQLREIVADG-ISSFXIFLSYKnffGVDDGEMYQTLRLAKELGVI  178
ident           |             |       |       |       |    |   |  
Sbjct eyrddpdsWVETIcQEIIPAAAEAGlADAVDVFCEHI---GFSLAQTEQVYLAADQYGLA  234
DSSP  hhlllhhhHHHHHhHLHHHHHHHLLlLLEEEEEELLL---LLLHHHHHHHHHHHHHLLLE


DSSP  EEEEELlhhhhhhhhhhhhhlllllhhhllllllhhHHHHHHHHHHHhhhhhlLEEE-EL
Query VTAHCEnaelvgrlqqkllsegktgpewhepsrpeaVEAEGTARFATflettgATGY-VV  237
ident |  |                                    |    |            | 
Sbjct VKGHXD----------------------------qlSNLGGSTLAAN------FGALsVD  260
DSSP  EEEEEL----------------------------llLLLLHHHHHHH------LLLLeEE


DSSP  LLLLhhHHHHHHHHHHlLLLEEEEEEHHHHHLLHhhhhllhhhhhlllllllllLLHHhh
Query HLSCkpALDAAMAAKArGVPIYIESVIPHFLLDKtyaerggveamkyimspplrDKRNqk  297
ident ||           | |             |   |                          
Sbjct HLEY--LDPEGIQALA-HRGVVATLLPTAFYFLK--------------------ETKL--  295
DSSP  ELLL--LLHHHHHHHH-HHLLEEEELHHHHHHLL--------------------LLLL--


DSSP  HHHHHHHL-LLLLEEELLLLLllhhhhhhhlllhhhllLLLLLLlLHHHHHhHHHLlllL
Query VLWDALAQ-GFIDTVGTDHCPfdteqkllgkeaftaipNGIPAIeDRVNLLyTYGVsrgR  356
ident     ||   |    |  |  |                    |                  
Sbjct PPVVALRKaGVPXAVSSDINP-----------------GTAPIV-SLRXAX-NXACtlfG  336
DSSP  LLHHHHHHlLLLEEELLLLLL-----------------LLLLLL-LHHHHH-HHHHhhhL


DSSP  LLHHHHHHHHLHHHHHHLLLLLLLLLLLLLLLLLEEEEELLlleellhhhllllllllll
Query LDIHRFVDAASTKAAKLFGLFPRKGTIAVGSDADLVVYDPQyrgtisvktqhvnndyngf  416
ident |            ||   |     |   ||  ||  |                       
Sbjct LTPVEAXAGVTRHAARALGEQEQLGQLRVGXLADFLVWNCG---------------hpae  381
DSSP  LLHHHHHHHLLHHHHHHLLLLLLLLLLLLLLLLLEEEELLL---------------lllh


DSSP  lllEELL-EEEEEEELLEEEEElleelllllllllllllllll
Query egfEIDG-RPSVVTVRGKVAVRdgqfvgekgwgkllrrepmyf  458
ident     |         | |                          
Sbjct lsyLIGVdQLVSRVVNGEETLH---------------------  403
DSSP  hhhLLLLlLEEEEEELLEELLL---------------------


No 16: Query=1gkpA Sbjct=1a5kC Z-score=23.8

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct snisrqayadmfgptvgdkvrladtelwieveddlttygeevkfgggkvirdgmgqgqml   60
DSSP  leeehhhhhhhhlllllleeelllllleeelleellllllllllllllllllllllllll


DSSP  -----LEEEELLEEEELLEEEELEEEELLLLLLEEELL----------LLLLLLLEEEEL
Query -----PLLIKNGEIITADSRYKADIYAEGETITRIGQN----------LEAPPGTEVIDA   45
ident       |   |  |       ||||      |  ||                  |||| |
Sbjct aadcvDLVLTNALIVDHWGIVKADIGVKDGRIFAIGKAgnpdiqpnvtIPIGAATEVIAA  120
DSSP  hhhllLEEEEEEEEEELLEEEEEEEEEELLEEEEEELEelllllllllEELLLLLEEEEL


DSSP  LLLEEEELEEEEEELLlleelleellLLHHhHHHHHHHLLEEEEEE------------EE
Query TGKYVFPGFIDPHVHIylpfmatfakDTHEtGSKAALMGGTTTYIE------------MC   93
ident  || |  | || | |                    ||  | ||                |
Sbjct EGKIVTAGGIDTHIHW----------ICPQ-QAEEALVSGVTTMVGggtgpaagthatTC  169
DSSP  LLLEEEELEEEEEEEL----------LLLL-HHHHHHHHLEEEEEEelllllhhhhhlLL


DSSP  LLlllllHHHHHHHHHHHHLlLLLLEEEEEEELLLLlllHHHHHHHHHHLLLLEEEEEEL
Query CPsrnddALEGYQLWKSKAEgNSYCDYTFHMAVSKFdekTEGQLREIVADGISSFXIFLS  153
ident  |                |                        ||| || |     |   
Sbjct TP-----GPWYISRMLQAAD-SLPVNIGLLGKGNVS---QPDALREQVAAGVIGLEIHED  220
DSSP  LL-----HHHHHHHHHHHHL-LLLLEEEEEEELLLL---LHHHHHHHHHHLLLEEEEEHH


DSSP  llllLLLLHHHHHHHHHHHHHHLLEEEEEELLHHHhhhhhhhhhhlllllhhhllllllh
Query yknfFGVDDGEMYQTLRLAKELGVIVTAHCENAELvgrlqqkllsegktgpewhepsrpe  213
ident      |         |  | |    |  |                               
Sbjct ----WGATPAAIDCALTVADEMDIQVALHSDTLNE-------------------------  251
DSSP  ----HLLLHHHHHHHHHHHHHHLLEEEEELLLLLL-------------------------


DSSP  hhhhHHHHHHHHHHHhhLLEEEELLLLL------hHHHHhHHHHHhlllLEEEEEEHHHH
Query aveaEGTARFATFLEttGATGYVVHLSC------kPALDaAMAAKargvPIYIESVIPHF  267
ident                  | |    |               | |       |   |  |  
Sbjct ---sGFVEDTLAAIG--GRTIHTFHTEGaggghapDIIT-ACAHP----NILPSSTNPTL  301
DSSP  ---lLLHHHHHHHHL--LLLEEELLLLLlllllllLHHH-HHHLL----LEEEEEEHHHL


DSSP  HL---LHHHHhllhhhhHLLL---------------lllllLLLHHHHHHHHHHHLLLLL
Query LL---DKTYAerggveaMKYI---------------mspplRDKRNQKVLWDALAQGFID  309
ident                                                         |   
Sbjct PYtlnTIDEH-------LDMLmvchhldpdiaedvafaesrIRRETIAAEDVLHDLGAFS  354
DSSP  LLlllHHHHH-------HHHHhhhhllllllhhhhhlllllLLHHHHHHHHHHHHLLLLL


DSSP  EEELLLLlllhhhhhhhlllhhhlllLLLLLLLHHHHHHhHHLLLLL-------------
Query TVGTDHCpfdteqkllgkeaftaipnGIPAIEDRVNLLYtYGVSRGR-------------  356
ident     |                                       |               
Sbjct LTSSDSQ-------------------AMGRVGEVILRTW-QVAHRMKvqrgalaeetgdn  394
DSSP  EEELLLL-------------------LLLLLLLHHHHHH-HHHHHHHhhhllllllllll


DSSP  --lLHHHHHHHHLHHHHHHLLLLLLLLLLLLLLLLLEEEEELLLleellhhhllllllll
Query --lDIHRFVDAASTKAAKLFGLFPRKGTIAVGSDADLVVYDPQYrgtisvktqhvnndyn  414
ident       |         |   |     | | ||  |||||  |                  
Sbjct dnfRVKRYIAKYTINPALTHGIAHEVGSIEVGKLADLVVWSPAF----------------  438
DSSP  lhhHHHHHHHLLLHHHHHHLLLLLLLLLLLLLLLLLEEEELHHH----------------


DSSP  llllleelLEEEEEEELLEEEEEL---------------LEEL-LLLL-----LLLLLL-
Query gfegfeidGRPSVVTVRGKVAVRD---------------GQFV-GEKG-----WGKLLR-  452
ident           |  |   |  |                       |  |            
Sbjct ------fgVKPATVIKGGMIAIAPmgdinasiptpqpvhYRPMfGALGsarhhCRLTFLs  492
DSSP  ------llLLLLEEEELLEEEEEEellllllllllllleEEELhHHLHhhhhhHLEEEEl


DSSP  --------------------LLLLLL----------------------------------
Query --------------------REPMYF----------------------------------  458
ident                                                             
Sbjct qaaaangvaerlnlrsaiavVKGCRTvqkadmvhnslqpnitvdaqtyevrvdgelitse  552
DSSP  hhhhhhlhhhhllllleeeeLLLLLLllhhhllllllllleeelllllleeelleellll


DSSP  --------------
Query --------------  458
ident               
Sbjct padvlpmaqryflf  566
DSSP  llllllllllllll


No 17: Query=1gkpA Sbjct=3mkvA Z-score=23.6

back to top
DSSP  --LEEEELLEEEELL--EEEE-LEEEELLLLLLEEEL-LLLLLlLLEEEELLLLEEEELE
Query --PLLIKNGEIITAD--SRYK-ADIYAEGETITRIGQ-NLEAPpGTEVIDATGKYVFPGF   54
ident     |  ||     |         |  |   |               |||  ||   || 
Sbjct ltTFLFRNGALLDPDhpDLLQgFEILIEDGFIREVSDkPIKSS-NAHVIDVKGKTIMPGL   59
DSSP  llEEEEEEEEELLLLllLLEEeEEEEEELLEEEEEELlLLLLL-LLEEEELLLLEEEELE


DSSP  EEEEELLLL------eELLE----ELLLLHhHHHHHHHHLLEEEEEEEELllllllhhhh
Query IDPHVHIYL------pFMAT----FAKDTHeTGSKAALMGGTTTYIEMCCpsrnddaleg  104
ident || |||                             | |  | ||                
Sbjct IDLHVHVVAiefnlprVATLpnvlVTLRAV-PIMRAMLRRGFTTVRDAGG----------  108
DSSP  EEEEELLLLllllhhhHLLLlhhhHHHHHH-HHHHHHHHLLEEEEEELLL----------


DSSP  hhhHHHHHLL-----LLLLEEEEE-EELLL------------------------------
Query yqlWKSKAEG-----NSYCDYTFH-MAVSK------------------------------  128
ident                           | |                               
Sbjct --aGYPFKQAvesglVEGPRLFVSgRALSQtgghadprarsdymppdspcgccvrvgalg  166
DSSP  --lLHHHHHHhhlllLLLLEEEELlLEEELllllllllllllllllllllllllllllle


DSSP  ----LLLLHHHHHHHHHHLLLLEEEEEELL--------llllLLLHHHHHHHHHHHHHHL
Query ----FDEKTEGQLREIVADGISSFXIFLSY--------knffGVDDGEMYQTLRLAKELG  176
ident              ||    |    ||  |             |    |       |   |
Sbjct rvadGVDEVRRAVREELQMGADQIXIMASGgvasptdpvgvfGYSEDEIRAIVAEAQGRG  226
DSSP  eellLHHHHHHHHHHHHHHLLLLEEEELLLllllllllllllLLLHHHHHHHHHHHHLLL


DSSP  LEEEEEELlhhhhhhhhhhhhhlllllhhhllllllhhhHHHHHHHHHHHHhhhllEEEE
Query VIVTAHCEnaelvgrlqqkllsegktgpewhepsrpeavEAEGTARFATFLettgaTGYV  236
ident   | ||                                      ||              
Sbjct TYVLAHAY-------------------------------TPAAIARAVRCG-----VRTI  250
DSSP  LLEEEEEL-------------------------------LHHHHHHHHHLL-----LLEE


DSSP  LLLLLhhHHHHHHHHHHlLLLEEEEEEHHHHHLLHHHHhllhHHHHL-lllllLLLL-LH
Query VHLSCkpALDAAMAAKArGVPIYIESVIPHFLLDKTYAerggVEAMK-yimspPLRD-KR  294
ident  |       |      |     |                                 |   
Sbjct EHGNL--IDDETARLVA-EHGAYVVPTLVTYDALASEG----EKYGLppesiaKIADvHG  303
DSSP  EELLL--LLHHHHHHHH-HHLLEEELLHHHHHHHHHHL----LLLLLlhhhhlLHHHhHL


DSSP  HHHHHHHHHHL-LLLLEEELLLLlllhhhhhhhlllhhhlllLLLLlLLHHhHHHHHHLl
Query NQKVLWDALAQ-GFIDTVGTDHCpfdteqkllgkeaftaipnGIPAiEDRVnLLYTYGVs  353
ident             |     |||                     |                 
Sbjct AGLHSIEIMKRaGVKMGFGTDLL-------------------GEAQ-RLQS-DEFRILA-  341
DSSP  LHHHHHHHHHHhLLLLLLLLLLL-------------------HHHH-HHLL-HHHHHHH-


DSSP  lLLLLHHHHHHHHLHHHHHHLLLLLLLLLLLLLLLLLEEEEELLlleellhhhlllllll
Query rGRLDIHRFVDAASTKAAKLFGLFPRKGTIAVGSDADLVVYDPQyrgtisvktqhvnndy  413
ident    |        |    |   |     | |  |  ||  | |                  
Sbjct -EVLSPAEVIASATIVSAEVLGMQDKLGRIVPGAHADVLVVDGN----------------  384
DSSP  -LLLLHHHHHHHLLHHHHHHLLLLLLLLLLLLLLLLLEEEELLL----------------


DSSP  lllllleELLE------EEEEEELLEEEEELleelllllllllllllllll
Query ngfegfeIDGR------PSVVTVRGKVAVRDgqfvgekgwgkllrrepmyf  458
ident         |           |   |   |                      
Sbjct ---plksVDCLlgqgehIPLVMKDGRLFVNE------------------le  414
DSSP  ---llllLLLLllllllLLEEEELLEEEEEL------------------ll


No 18: Query=1gkpA Sbjct=3ls9A Z-score=23.3

back to top
DSSP  LEEEELL-EEEEL---LEEEE-LEEEELLLLLLEEELLLLLLLLLEEEELLLLEEEELEE
Query PLLIKNG-EIITA---DSRYK-ADIYAEGETITRIGQNLEAPPGTEVIDATGKYVFPGFI   55
ident   ||      ||          |||   |  |   |  |        ||  |    || |
Sbjct MILIRGLtRVITFddqERELEdADILIDGPKIVAVGKDLSDRSVSRTIDGRGMIALPGLI   60
DSSP  LEEEEEEeEEELLlllLLEEEeEEEEEELLEEEEEELLLLLLLLLEEEELLLEEEEELEE


DSSP  EEEELLLL--------------------EELLE------------ellLLHHHHHHHHHH
Query DPHVHIYL--------------------PFMAT------------fakDTHETGSKAALM   83
ident   | | |                                                   | 
Sbjct NSHQHLYEgamraipqlervtmaswlegVLTRSagwwrdgkfgpdvirEVARAVLLESLL  120
DSSP  EEEELHHHhhhlllhhhllllhhhhhhhHHHHHhhhhhlllllhhhhhHHHHHHHHHHHH


DSSP  LLEEEEEEEELLLlLLLHHHhhHHHHhHHLLLL---LLEEEEEEELLL------------
Query GGTTTYIEMCCPSrNDDALEgyQLWKsKAEGNS---YCDYTFHMAVSK------------  128
ident || ||                                                       
Sbjct GGITTVADQHLFF-PGATAD--SYID-ATIEAAtdlGIRFHAARSSMTlgkseggfcddl  176
DSSP  LLEEEEEEEELLL-LLLLLL--LHHH-HHHHHHhhhLLEEEEEELLLLllhhhlllllhh


DSSP  ---LLLLHHHHHHHHHHLL---------LLEEE-EEELlllllLLLHHHHHHHHHHHHHH
Query ---FDEKTEGQLREIVADG---------ISSFX-IFLSyknffGVDDGEMYQTLRLAKEL  175
ident                                                         |   
Sbjct fvePVDRVVQHCLGLIDQYhepepfgmvRIALGpCGVP-----YDKPELFEAFAQMAADY  231
DSSP  hllLHHHHHHHHHHHHHHHlllllllleEEEELlLLLL-----LLLHHHHHHHHHHHHHH


DSSP  LLEEEEEEllhhhhhhhhhhhhhlllllhhhllllllHHHH--------hHHHHHHH-HH
Query GVIVTAHCenaelvgrlqqkllsegktgpewhepsrpEAVE--------aEGTARFA-TF  226
ident  |    |                                                     
Sbjct DVRLHTHF---------------------------yePLDAgmsdhlygmTPWRFLEkHG  264
DSSP  LLEEEEEE---------------------------llLLHHhhhhhhhllLHHHHHHhLL


DSSP  HHhhllEEEELLLLLHHhhHHHHHHHHlLLLEEEEEEHHHHHLlhhhhhllhhhhhllll
Query LEttgaTGYVVHLSCKPalDAAMAAKArGVPIYIESVIPHFLLdktyaerggveamkyim  286
ident            |    |         |      |   |   |                  
Sbjct WA--sdRVWLAHAVVPP--REEIPEFA-DAGVAIAHLIAPDLR-----------------  302
DSSP  LL--llLEEEEELLLLL--HHHHHHHH-HHLLEEEELHHHHHH-----------------


DSSP  llLLLLlhhHHHHHHHHhLLLLLEEELLLLLllhhhhhhhlllhhhlllLLLLLlLHHHH
Query spPLRDkrnQKVLWDALaQGFIDTVGTDHCPfdteqkllgkeaftaipnGIPAIeDRVNL  346
ident                 |  |     ||                                 
Sbjct --MGWG---LAPIREYLdAGITVGFGTTGSA------------------SNDGG-NLLGD  338
DSSP  --LLLL---LLLHHHHHhLLLEEEELLLLLL------------------LLLLL-LHHHH


DSSP  HhHHHLL----------llLLLHHHHHHHHLHHHHHHLLLLlLLLLLLLLLLLLEEEEEL
Query LyTYGVS----------rgRLDIHRFVDAASTKAAKLFGLFpRKGTIAVGSDADLVVYDP  396
ident |                   |        |    |   |     |    |  ||      
Sbjct L-RLAALahrpadpnepekWLSARELLRMATRGSAECLGRP-DLGVLEEGRAADIACWRL  396
DSSP  H-HHHHHhlhhhllllhhhLLLHHHHHHHLLHHHHHHLLLL-LLLLLLLLLLLLEEEEEL


DSSP  LL---------------LEELlhhhllllllllllllleelLEEEEEEELLEEEEELLEE
Query QY---------------RGTIsvktqhvnndyngfegfeidGRPSVVTVRGKVAVRDGQF  441
ident                   |                       | | | | | | |     
Sbjct DGvdrvgvhdpaiglimTGLS--------------------DRASLVVVNGQVLVENERP  436
DSSP  LLhhhlllllhhhhhhhLLLL--------------------LLLLEEEELLEEEEELLEE


DSSP  LLLLlllllllllllll
Query VGEKgwgkllrrepmyf  458
ident |                
Sbjct VLADlerivanttalip  453
DSSP  LLLLhhhhhhhhhhhll


No 19: Query=1gkpA Sbjct=1j6pA Z-score=22.9

back to top
DSSP  -LEEEELLEEE-ELLE-EEELEEEELLLLLLEEEL-LLLLlllleEEELLLLEEEELEEE
Query -PLLIKNGEII-TADS-RYKADIYAEGETITRIGQ-NLEAppgteVIDATGKYVFPGFID   56
ident     | |  |     |         |  || |  |            |  || | |    
Sbjct hHXIIGNCLILkDFSSePFWGAVEIENGTIKRVLQgEVKV-----DLDLSGKLVXPALFN   55
DSSP  lEEEEEEEEELlLLLLlLEEEEEEEELLEEEEEEElLLLL-----LEELLLEEEEELEEE


DSSP  EEELLLL------------------eELLEE-------llLLHHHHHHHHHHLLEEEEEE
Query PHVHIYL------------------pFMATF-------akDTHETGSKAALMGGTTTYIE   91
ident  | |                                                 |      
Sbjct THTHAPXtllrgvaedlsfeewlfskVLPIEdrltekxayYGTILAQXEXARHGIAGFVD  115
DSSP  EEELHHHhhhllllllllhhhhhhllHHHHHllllhhhhhHHHHHHHHHHHLLLEEEEEE


DSSP  EELllllllhhhHHHHHHHHHLLlLLLEEEEEEELLL---lLLLHHHHHHHHHHLLL---
Query MCCpsrnddaleGYQLWKSKAEGnSYCDYTFHMAVSK---fDEKTEGQLREIVADGI---  145
ident                                          |                  
Sbjct XYF---------HEEWIAKAVRD-FGXRALLTRGLVDsngdDGGRLEENLKLYNEWNgfe  165
DSSP  EEL---------LHHHHHHHHHH-HLLEEEEEEEELLllllLLLHHHHHHHHHHHHLlhh


DSSP  ----LEEE-EEELlllllLLLHHHHHHHHHHHHHHLLEEEEEELlhhhhhhhhhhhhhll
Query ----SSFX-IFLSyknffGVDDGEMYQTLRLAKELGVIVTAHCEnaelvgrlqqkllseg  200
ident       |                        || |   || |                  
Sbjct grifVGFGpHSPY-----LCSEEYLKRVFDTAKSLNAPVTIHLY----------------  204
DSSP  hleeEEEEeLLLL-----LLLHHHHHHHHHHHHHHLLLEEEEEL----------------


DSSP  lllhhhllllLLHHhhhHHHHHHH-HHHHhhLLEEEELLLLLhhHHHHHHHHHHlLLLEE
Query ktgpewhepsRPEAveaEGTARFA-TFLEttGATGYVVHLSCkpALDAAMAAKArGVPIY  259
ident             |              |          |                  |  
Sbjct --------etSKEE---YDLEDILnIGLK--EVKTIAAHCVH--LPERYFGVLK-DIPFF  248
DSSP  --------llLLLL---LLLHHHHlLLLL--LLLEEEEELLL--LLHHHHHHHL-LLLEE


DSSP  EEEEHHHHHLlhhhhhllhhhhhllllllLLLLlhhHHHHHHHHHLLLLLEEELLLLLll
Query IESVIPHFLLdktyaerggveamkyimspPLRDkrnQKVLWDALAQGFIDTVGTDHCPfd  319
ident         |                                     |   | |||     
Sbjct VSHNPASNLK-------------------LGNG---IAPVQRXIEHGXKVTLGTDGAA--  284
DSSP  EEELHHHHHH-------------------LLLL---LLLHHHHHHLLLEEEELLLLLL--


DSSP  hhhhhhhlllhhhlllLLLLLlLHHHHHHHHH-----llllLLLHHHHHHHHLHHHHHHL
Query teqkllgkeaftaipnGIPAIeDRVNLLYTYG-----vsrgRLDIHRFVDAASTKAAKLF  374
ident                                           ||            |   
Sbjct ----------------SNNSL-NLFFEXRLASllqkaqnprNLDVNTCLKXVTYDGAQAX  327
DSSP  ----------------LLLLL-LHHHHHHHHHhhhhlllllLLLHHHHHHHHLHHHHHHH


DSSP  LLllLLLLLLLLLLLLEEEEELLLLEellhhhlllllllllllllEELL-EEEEEEELLE
Query GLfpRKGTIAVGSDADLVVYDPQYRGtisvktqhvnndyngfegfEIDG-RPSVVTVRGK  433
ident |     | |  |  ||||| |                                   | ||
Sbjct GF--KSGKIEEGWNADLVVIDLDLPE-------xfpvqniknhlvHAFSgEVFATXVAGK  378
DSSP  LL--LLLLLLLLLLLLEEEEELLLHH-------hllhhhhhhhhhHLLLlLLLEEEELLE


DSSP  EEEELlEELLLL-----lllllllllllll
Query VAVRDgQFVGEK-----gwgkllrrepmyf  458
ident     |                         
Sbjct WIYFD-GEYPTIdseevkrelariekelys  407
DSSP  EEEEL-LLLLLLlhhhhhhhhhhhhhhhhl


No 20: Query=1gkpA Sbjct=3ooqA Z-score=22.9

back to top
DSSP  LEEEELLEEE-ELLEEEELEEEELLLLLLEEELLLLLLLlLEEEELLLLEEEELEEEEEE
Query PLLIKNGEII-TADSRYKADIYAEGETITRIGQNLEAPPgTEVIDATGKYVFPGFIDPHV   59
ident   | ||           | |           | | | |   |  | |||  |||| | | 
Sbjct KILFKNATVFpITSRPFKGDVLVSNGKVEKVGENIEDPD-AEIVDLTGKFLFPGFVDAHS   59
DSSP  LEEEEEEEELlLLLLLEEEEEEEELLEEEEEELLLLLLL-LEEEELLLLEEEELEEEEEE


DSSP  L-LLLE---ELLEEL----------------LLLHH-HHHHHHHHLLEEEEEEEEL-lll
Query H-IYLP---FMATFA----------------KDTHE-TGSKAALMGGTTTYIEMCC-psr   97
ident |                                         || || |           
Sbjct HiGLFEegvGYYYSDgneatdpvtphvkaldGFNPQdPAIERALAGGVTSVXIVPGsanp  119
DSSP  LlLLLLlllLHHHLLlllllllllllllhhhHLLLLlHHHHHHHLLLEEEEEELLLllll


DSSP  lllhhhhhhhhhhHHLLllllEEEEeeelllllllhhhhhhhhhhlLLLEEEEEEL--LL
Query nddalegyqlwksKAEGnsycDYTFhmavskfdektegqlreivadGISSFXIFLS--YK  155
ident                |                                           |
Sbjct vggqgsvikfrsiIVEE----CIVK---------------------DPAGLKXAFGenPK  154
DSSP  eeeeeeeeellllLHHH----HEEE---------------------EEEEEEEELLhhHH


DSSP  LL----------lllLHHHHHH------------------------------hhHHHHHH
Query NF----------fgvDDGEMYQ------------------------------tlRLAKEL  175
ident                  |                                          
Sbjct RVygerkqtpstrxgTAGVIRDyftkvknyxkkkelaqkegkeftetdlkxevgEXVLRK  214
DSSP  HHhhhlllllllhhhHHHHHHHhhhhhhhhhhhhhhhhhlllllllllhhhhhhHHHHLL


DSSP  LLEEEEEEllhhhhhhhhhhhhhlllllhhhllllllhhhHHHHHHHHHHHHHHHLLEEE
Query GVIVTAHCenaelvgrlqqkllsegktgpewhepsrpeavEAEGTARFATFLETTGATGY  235
ident       |                                  |          |  |    
Sbjct KIPARXHA-------------------------------hRADDILTAIRIAEEFGFNLV  243
DSSP  LLLEEEEE-------------------------------lLHHHHHHHHHHHHHHLLLEE


DSSP  ELLLLLhhHHHHhHHHHHLlLLEEEEEEHhHHHLLHhhhhllhhhhhllllllLLLLlhH
Query VVHLSCkpALDAaMAAKARgVPIYIESVIpHFLLDKtyaerggveamkyimspPLRDkrN  295
ident   |     |        |    |                               | |   
Sbjct IEHGTE--AYKI-SKVLAE-KKIPVVVGP-LLTFRT---------------klELKD--L  281
DSSP  EEELLL--HHHH-HHHHHH-HLLLEEELL-LLLLLL---------------lhHHLL--L


DSSP  HHHHHHHHHL-LLLLEEELLLLlllhhhhhhhlllhhhllllLLLLLLHHHHHhHHHLlL
Query QKVLWDALAQ-GFIDTVGTDHCpfdteqkllgkeaftaipngIPAIEDRVNLLyTYGVsR  354
ident        |   |       ||                         |            |
Sbjct TXETIAKLLKdGVLIALXCDHP--------------------VIPLEFATVQA-ATAX-R  319
DSSP  LLLHHHHHHHlLLLEEELLLLL--------------------LLLHHHHHHHH-HHHH-H


DSSP  LLLLHHHHHHHHLHHHHHHLLLLLLLLLLLLLLLLLEEEEELllleellhhhllllllll
Query GRLDIHRFVDAASTKAAKLFGLFPRKGTIAVGSDADLVVYDPqyrgtisvktqhvnndyn  414
ident                 ||  ||  | | |  | ||||||                     
Sbjct YGAKEEDLLKILTVNPAKILGLEDRIGSIEPGKDADLVVWSG------------------  361
DSSP  HLLLHHHHHHLLLHHHHHHLLLLLLLLLLLLLLLLLEEEELL------------------


DSSP  lllllEELLEEEEEEELLEEEEELleelllllllllllllllll
Query gfegfEIDGRPSVVTVRGKVAVRDgqfvgekgwgkllrrepmyf  458
ident              |   |    |                     
Sbjct --hpfDXKSVVERVYIDGVEVFRR-------------------e  384
DSSP  --lllLLLLLEEEEEELLEEEEEL-------------------l


No 21: Query=1gkpA Sbjct=1k6wA Z-score=22.9

back to top
DSSP  -LEEEELLEEeelLEEE-ELEEEELLLLLLEEELL-lllllLLEEEELLLLEEEELEEEE
Query -PLLIKNGEIitaDSRY-KADIYAEGETITRIGQN-leappGTEVIDATGKYVFPGFIDP   57
ident     | |              |      |  |              ||    | | |  |
Sbjct aLQTIINARL---PGEEgLWQIHLQDGKISAIDAQsgvmpiTENSLDAEQGLVIPPFVEP   57
DSSP  lLLEEEEELL---LLLLlEEEEEEELLEEEEEEEEllllllLLLEEELLLLEEELLEEEE


DSSP  EELLLL--------------------eELLE-------elllLHHHHHHHHHHLLEEEEE
Query HVHIYL--------------------pFMAT-------fakdTHETGSKAALMGGTTTYI   90
ident | |                                             |     |     
Sbjct HIHLDTtqtagqpnwnqsgtlfegierWAERkallthddvkqRAWQTLKWQIANGIQHVR  117
DSSP  EELLLLllllllllllllllhhhhhhhHHLLhhhllhhhhhhHHHHHHHHHHHLLEEEEE


DSSP  EEELLLllLLHHHHHHHHHHHHLLLL-LLEEEEEEEL-LLLL--LLHHHHHHHHHHLLLL
Query EMCCPSrnDDALEGYQLWKSKAEGNS-YCDYTFHMAV-SKFD--EKTEGQLREIVADGIS  146
ident      |  |  |                 |                 |  | |    |  
Sbjct THVDVS--DATLTALKAMLEVKQEVApWIDLQIVAFPqEGILsyPNGEALLEEALRLGAD  175
DSSP  EEEELL--LLLLHHHHHHHHHHHHHLlLLEEEEEEELlLLLLllLLHHHHHHHHHHLLLL


DSSP  EEEEEELLLLlllLLHHHHHHHHHHHHHHLLEEEEEELlhhhhhhhhhhhhhlllllhhh
Query SFXIFLSYKNffgVDDGEMYQTLRLAKELGVIVTAHCEnaelvgrlqqkllsegktgpew  206
ident                      |  ||         ||                       
Sbjct VVGAIPHFEFtreYGVESLHKTFALAQKYDRLIDVHCD----------------------  213
DSSP  EEEELHHHLLlhhHHHHHHHHHHHHHHHHLLEEEEEEL----------------------


DSSP  llllLLHHHhhHHHHHHHHHHHHHLL--EEEELLLL-LHHH----hhhHHHHHHlLLLEE
Query hepsRPEAVeaEGTARFATFLETTGA--TGYVVHLS-CKPA----ldaAMAAKArGVPIY  259
ident       |          |      |        |                        | 
Sbjct --eiDDEQS--RFVETVAALAHHEGMgaRVTASHTTaMHSYngaytsrLFRLLK-MSGIN  268
DSSP  --llLLLLL--LHHHHHHHHHHHHLLhhHEEEEELHhHHHLlhhhhhhHHHHHH-HHLLE


DSSP  EEEEHHHHHLlhhhhhllhhhhhllllllLLLL------LHHHhHHHHHHHLLLLLEEEL
Query IESVIPHFLLdktyaerggveamkyimspPLRD------KRNQkVLWDALAQGFIDTVGT  313
ident                                         |        |  |     | 
Sbjct FVANPLVNIH-------------------LQGRfdtypkRRGItRVKEMLESGINVCFGH  309
DSSP  EEELHHHHHH-------------------HLLLllllllLLLLlLHHHHHHLLLLEEELL


DSSP  LLLLLlhhhhhhhlllhhhlLLLL-LLLLlHHHHHHHHH----llllLLLHHhHHHHHLH
Query DHCPFdteqkllgkeaftaiPNGI-PAIEdRVNLLYTYG----vsrgRLDIHrFVDAAST  368
ident |                   |             |                         
Sbjct DDVFD---------------PWYPlGTAN-MLQVLHMGLhvcqlmgyGQIND-GLNLITH  352
DSSP  LLLLL---------------LLLLlLLLL-HHHHHHHHHhhlllllhHHHHH-HHHHHLH


DSSP  HHHHHLLlLLLLlLLLLLLLLLEEEEELllleellhhhlllllllllllllEELLEEEEE
Query KAAKLFGlFPRKgTIAVGSDADLVVYDPqyrgtisvktqhvnndyngfegfEIDGRPSVV  428
ident   |           || |  | |                                     
Sbjct HSARTLN-LQDY-GIAAGNSANLIILPA----------------engfdalRRQVPVRYS  394
DSSP  HHHHHLL-LLLL-LLLLLLLLLEEEELL----------------llhhhhhHHLLLLLEE


DSSP  EELLEEEEELLeelllllllllllllllll
Query TVRGKVAVRDGqfvgekgwgkllrrepmyf  458
ident    |||                        
Sbjct VRGGKVIASTQ-paqttvyleqpeaidykr  423
DSSP  EELLEEEEELL-llleeeellleeeellll


No 22: Query=1gkpA Sbjct=3icjA Z-score=22.7

back to top
DSSP  -LEEEELLEEE-ELLE-EEELEEEELLLLLLEE-ELLL---LLLL-LLEEEELLLLEEEE
Query -PLLIKNGEII-TADS-RYKADIYAEGETITRI-GQNL---EAPP-GTEVIDATGKYVFP   52
ident       || |                 |              |   | | ||  || | |
Sbjct cMKALINGTIYtSFSPvKKVSGLVISNERVLYAgDSSTalrIAELaGGEIIDLKGKFVMP   60
DSSP  lEEEEELLEEEeEELLeEEELEEEEELLEEEEEeLHHHhhhHHHHhLLEEEELLLLEEEE


DSSP  LEEEEEELLLL-------------------------------------------------
Query GFIDPHVHIYL-------------------------------------------------   63
ident  | | | |                                                    
Sbjct AFFDSHLHLDElgmslemvdlrgvksmeelvervkkgrgriifgfgwdqdelgrwptred  120
DSSP  LEEEEEELHHHhhhhhhleellllllhhhhhhhhhlllllleeeeeelhhhhlllllhhh


DSSP  --------------------------------------------------eELLEE----
Query --------------------------------------------------pFMATF----   69
ident                                                             
Sbjct ldvidrpvflyrrcfhvavmnskmidllnlkpskdfdestgivreraleesRKIINekil  180
DSSP  hlllllleeeeelllleeeelhhhhhhhllllllleelllleeehhhhhhhHHHHHhlll


DSSP  ----lllLHHHHHHHHHHLLEEEEEEEELLlllllhHHHHHHHHHHHL-LLLLLEEEEEE
Query ----akdTHETGSKAALMGGTTTYIEMCCPsrnddaLEGYQLWKSKAE-GNSYCDYTFHM  124
ident          |      |  |      |                      |          
Sbjct tvkdykhYIESAQEHLLSLGVHSVGFMSVG------EKALKALFELEReGRLKMNVFAYL  234
DSSP  lhhhhhhHHHHHHHHHHHLLEEEEEEEEEL------HHHHHHHHHHHHlLLLLLEEEEEE


DSSP  ELLlllllHHHHHH--HHHHLL-----LLEEEEEELL-------------------llll
Query AVSkfdekTEGQLR--EIVADG-----ISSFXIFLSY-------------------knff  158
ident             |              |   | |                          
Sbjct SPE-----LLDKLEelNLGKFEgrrlrIWGVXLFVDGslgartallsepytdnpttsgel  289
DSSP  LHH-----HHHHHHhhLLLLEEllleeEEEEEEELLLlllllllllllllllllllllll


DSSP  LLLHHHHHHHHHHHHHHLLEEEEEELlhhhhhhhhhhhhhlllllhhhllllllhhhHHH
Query GVDDGEMYQTLRLAKELGVIVTAHCEnaelvgrlqqkllsegktgpewhepsrpeavEAE  218
ident      |       || ||  |  |                                    
Sbjct VMNKDEIVEVIERAKPLGLDVAVHAI-------------------------------GDK  318
DSSP  LLLHHHHHHHHHHHLLLLLEEEEEEL-------------------------------LHH


DSSP  HHHHHHHHHHHHLLEEEELLLLLhhHHHHHHHHHHlLLLEEEEEEHHHHHLLhhhhhllh
Query GTARFATFLETTGATGYVVHLSCkpALDAAMAAKArGVPIYIESVIPHFLLDktyaergg  278
ident          |     |   | |     |             |         |        
Sbjct AVDVALDAFEEAEFSGRIEHASL--VRDDQLERIK-ELKVRISAQPHFIVSD--------  367
DSSP  HHHHHHHHHHHHLLLLEEEELLL--LLHHHHHHHH-HHLLEEEELLLHHHHL--------


DSSP  hhhhllllllllLLLH-------HHHHHhhHHHLLL---lLEEELLLLlllhhhhhhhll
Query veamkyimspplRDKR-------NQKVLwdALAQGF---iDTVGTDHCpfdteqkllgke  328
ident                                |            ||              
Sbjct ------------WWIVnrvgeerAKWAY--RLKTLSsitkLGFSTDSP------------  401
DSSP  ------------LLHHhhhhhhhHHHLL--LHHHHHhhllEEELLLLL------------


DSSP  lhhhllllLLLLllHHHHHHHHHLL------llLLLHHHHHHHHLHHHHHHLLLLlLLLL
Query aftaipngIPAIedRVNLLYTYGVS------rgRLDIHRFVDAASTKAAKLFGLFpRKGT  382
ident         |              |         |              |         | 
Sbjct --------IEPA--DPWVSIDAAVNryvvdpgeRVSREEALHLYTHGSAQVTLAE-DLGK  450
DSSP  --------LLLL--LHHHHHHHHHHlllllhhhLLLHHHHHHHLLHHHHHHLLLL-LLLL


DSSP  LLLLLLLLEEEEELLlleellhhhllllllllllllleelleeeeeeelleeeeelleel
Query IAVGSDADLVVYDPQyrgtisvktqhvnndyngfegfeidgrpsvvtvrgkvavrdgqfv  442
ident    |  |     |                                               
Sbjct LERGFRAEYIILDRD---------------------------------------------  465
DSSP  LLLLLLLLEEEELLL---------------------------------------------


DSSP  llllllllllllllll
Query gekgwgkllrrepmyf  458
ident                 
Sbjct -------------plk  468
DSSP  -------------lll


No 23: Query=1gkpA Sbjct=4c5yA Z-score=21.4

back to top
DSSP  ----LEEEELLEEE-ELLEEEE-LEEEELLLLLLEEE--LLLL--LLLLL-EEEELllLE
Query ----PLLIKNGEII-TADSRYK-ADIYAEGETITRIG--QNLE--APPGT-EVIDAtgKY   49
ident        |  |  |         |        |   |            |          
Sbjct deakVTIIYAGLLIpGDGEPLRnAALVISDKIIAFVGseADIPkkYLRSTqSTHRV--PV   58
DSSP  llllEEEEEEEEELlLLLLLEEeEEEEEELLEEEEEEehHHLLhhHHHHLlLEEEE--EE


DSSP  EEELEEEEEELLLLE---------ELLEE---LLLLHHHHHHHHHHLLEEEEEEEELlll
Query VFPGFIDPHVHIYLP---------FMATF---AKDTHETGSKAALMGGTTTYIEMCCpsr   97
ident   ||  | | |               ||           |   ||  | | |        
Sbjct LMPGLWDCHMHFGGDddyyndytsGLATHpasSGARLARGCWEALQNGYTSYRDLAG---  115
DSSP  EEELEEEEEELLLLLlllllllhhHHHLLhhhHHHHHHHHHHHHHHLLEEEEEELLL---


DSSP  lllhhhhhhhHHHHHLLL-----LLLEEEEE-EELL------------------------
Query nddalegyqlWKSKAEGN-----SYCDYTFH-MAVS------------------------  127
ident               |                  | |                        
Sbjct ---------yGCEVAKAIndgtiVGPNVYSSgAALSqtaghgdifalpagevlgsygvmn  166
DSSP  ---------lHHHHHHHHhllllLLLEEEELlLEEEllllllllllllhhhhhhhhllll


DSSP  ------------LLLL--LHHHHHHHHHHLLLLEEEEEELL--------llllLLLHHHH
Query ------------KFDE--KTEGQLREIVADGISSFXIFLSY--------knffGVDDGEM  165
ident               |         |     |    |   |                  | 
Sbjct prpgywgagplcIADGveEVRRAVRLQIRRGAKVIXVMASGgvmsrddnpnfaQFSPEEL  226
DSSP  lllllllllleeELLLhhHHHHHHHHHHHHLLLLEEEELLLllllllllllllLLLHHHH


DSSP  HHHHHHHHHHLLEEEEEELlhhhhhhhhhhhhhlllllhhhllllllhhhHHHHHHHHHH
Query YQTLRLAKELGVIVTAHCEnaelvgrlqqkllsegktgpewhepsrpeavEAEGTARFAT  225
ident       |     || ||                                    |      
Sbjct KVIVEEAARQNRIVSAHVH-------------------------------GKAGIMAAIK  255
DSSP  HHHHHHHHHLLLLEEEEEL-------------------------------LHHHHHHHHH


DSSP  HHhhhllEEEELLLLLhhHHHHHHHHHHlLLLEEEEEEHHHHHLLHHHHhllhhhHHLL-
Query FLettgaTGYVVHLSCkpALDAAMAAKArGVPIYIESVIPHFLLDKTYAerggveAMKY-  284
ident             | |   |             |                           
Sbjct AG-----CKSLEHVSY--ADEEVWELMK-EKGILYVATRSVIEIFLASN------GEGLv  301
DSSP  HL-----LLEEEELLL--LLHHHHHHHH-HHLLEEELLHHHHHHHHHHL------LLLLl


DSSP  --llllllLLLHH-HHHHHHHHHLLLLLEEELLLLlllhhhhhhhlllhhhlllllllLL
Query --imspplRDKRN-QKVLWDALAQGFIDTVGTDHCpfdteqkllgkeaftaipngipaIE  341
ident                |    |   |     |||                           
Sbjct keswaklqALADShLKAYQGAIKAGVTIALGTDTA----------------------pGG  339
DSSP  llhhhlllHHHHHhHHHHHHHHHLLLLEELLLLLL----------------------lLL


DSSP  LHHhHHHHHHLlllLLLHHHHHHHHLHHHHHHL--LLLLlLLLLLLLLLLLEEEEELLll
Query DRVnLLYTYGVsrgRLDIHRFVDAASTKAAKLF--GLFPrKGTIAVGSDADLVVYDPQyr  399
ident     |     |            ||   |            |    |  ||         
Sbjct PTA-LELQFAVergGMTPLEAIKAATANAPLSVgpQAPL-TGQLREGYEADVIALEEN--  395
DSSP  LLH-HHHHHHHhllLLLHHHHHHHHLLLHHHHHhhHLLL-LLLLLLLLLLLEEEELLL--


DSSP  eellhhhlllllllllllllEELL-----EEEEEEELLEEEEEL-lEELLLlllllllll
Query gtisvktqhvnndyngfegfEIDG-----RPSVVTVRGKVAVRD-gQFVGEkgwgkllrr  453
ident                      |           |   ||          ||         
Sbjct -----------------pleDIKVfqepkAVTHVWKGGKLFKGPgiGPWGE-------da  431
DSSP  -----------------lllLHHHhhlhhHEEEEEELLEEEELLllLLLLL-------ll


DSSP  lllll
Query epmyf  458
ident      
Sbjct rnpfl  436
DSSP  lllll


No 24: Query=1gkpA Sbjct=2uz9A Z-score=20.1

back to top
DSSP  --LEEEELlEEEEL-----LEEEE-LEEEELL-LLLLEEE-LLLL------LLLL-lEEE
Query --PLLIKNgEIITA-----DSRYK-ADIYAEG-ETITRIG-QNLE------APPG-tEVI   43
ident                                    |                     |  
Sbjct plAHIFRG-TFVHStwtcpMEVLRdHLLGVSDsGKIVFLEeASQQeklakeWCFKpcEIR   59
DSSP  llLEEEEE-EEEELlllllLEEEEeEEEEELLlLLEEEEEeHHHHhhhhhhHLLLhhHEE


DSSP  ELL-LLEEEELEEEEEELLLL--------------eELLEE------------lllLHHH
Query DAT-GKYVFPGFIDPHVHIYL--------------pFMATF------------akdTHET   76
ident          ||  | | |                                          
Sbjct ELShHEFFMPGLVDTHIHASQysfagssidlpllewLTKYTfpaehrfqnidfaeeVYTR  119
DSSP  ELLlLLEEEELEEEEEEEHHHhhhllllllllhhhhHHHLHhhhhhhhhlhhhhhhHHHH


DSSP  HHHHHHHLLEEEEEEEELLlllllhhhHHHHHHHHHLL--LLLLEEEEEEELLL------
Query GSKAALMGGTTTYIEMCCPsrnddaleGYQLWKSKAEG--NSYCDYTFHMAVSK------  128
ident      |  ||||                       |                        
Sbjct VVRRTLKNGTTTACYFATI--------HTDSSLLLADItdKFGQRAFVGKVCMDlndtfp  171
DSSP  HHHHHHHLLEEEEEEELLL--------LHHHHHHHHHHhhHHLLEEEEELEELLllllll


DSSP  ----LLLLHHHHHHHHHHLL--------LLEEE-EEELlllllLLLHHHHHHHHHHHHHH
Query ----FDEKTEGQLREIVADG--------ISSFX-IFLSyknffGVDDGEMYQTLRLAKEL  175
ident       |         |                  |             |      ||  
Sbjct eykeTTEESIKETERFVSEMlqknysrvKPIVTpRFSL-----SCSETLMGELGNIAKTR  226
DSSP  llllLHHHHHHHHHHHHHHHhhhlllleEEEEEeLLHH-----HLLHHHHHHHHHHHHHH


DSSP  LLEEEEEE-------lLHHHHHHhhhhhhhlllllhhhllllllhhhhhHHHHHHHHHHh
Query GVIVTAHC-------eNAELVGRlqqkllsegktgpewhepsrpeaveaEGTARFATFLe  228
ident       |                                            |        
Sbjct DLHIQSHIsenrdeveAVKNLYP-----------------------sykNYTSVYDKNN-  262
DSSP  LLEEEEEElllhhhhhHHHHHLL-----------------------lllLHHHHHHHLL-


DSSP  hhllEEEELLLLLhhHHHHHHHHHHlLLLEEEEEEHHHHHLlhhhhhllhhhhhlllllL
Query ttgaTGYVVHLSCkpALDAAMAAKArGVPIYIESVIPHFLLdktyaerggveamkyimsP  288
ident          |                     |       |                    
Sbjct lltnKTVMAHGCY--LSAEELNVFH-ERGASIAHCPNSNLS------------------L  301
DSSP  llllLEEEEELLL--LLHHHHHHHH-HHLLEEEELHHHHHH------------------L


DSSP  LLLllhhhhhHHHHHHL-LLLLEEELLLLlllhhhhhhhlllhhhlllLLLLLlLHHHHH
Query PLRdkrnqkvLWDALAQ-GFIDTVGTDHCpfdteqkllgkeaftaipnGIPAIeDRVNLL  347
ident                         |||                     |           
Sbjct SSG-----flNVLEVLKhEVKIGLGTDVA-------------------GGYSY-SMLDAI  336
DSSP  LLL-----llLHHHHHHlLLEEEELLLLL-------------------LLLLL-LHHHHH


DSSP  HHHH----------llllLLLHHHHHHHHLHHHHHHLLLLLLLLLLLLLLLLLEEEEELL
Query YTYG----------vsrgRLDIHRFVDAASTKAAKLFGLFPRKGTIAVGSDADLVVYDPQ  397
ident                    |        |        ||    |   ||   |     | 
Sbjct RRAVmvsnillinkvnekSLTLKEVFRLATLGGSQALGLDGEIGNFEVGKEFDAILINPK  396
DSSP  HHHHhhhhhhhhllllllLLLHHHHHHHHLHHHHHHLLLLLLLLLLLLLLLLLEEEELLL


DSSP  ---LLEEllhhhllllllllllllleELLE---EEEEEELLEEEeelleELLLlllllll
Query ---YRGTisvktqhvnndyngfegfeIDGR---PSVVTVRGKVAvrdgqFVGEkgwgkll  451
ident                             |       | | ||                  
Sbjct asdSPIDlfygdffgdiseaviqkflYLGDdrnIEEVYVGGKQV-----VPFS-------  444
DSSP  lllLLLLlllhhhhlllllhhhhhhhHHLLhhhEEEEEELLEEE-----ELLL-------


DSSP  lllllll
Query rrepmyf  458
ident        
Sbjct -------  444
DSSP  -------


No 25: Query=1gkpA Sbjct=2ob3A Z-score=18.9

back to top
DSSP  leeeelleeeelleeeeleeeelllllleeellllllllleeeelllleeeeLEEEEEEL
Query pllikngeiitadsrykadiyaegetitrigqnleappgtevidatgkyvfpGFIDPHVH   60
ident                                                     ||   | |
Sbjct -------------------------------------drintvrgpitiseaGFTLTHEH   23
DSSP  -------------------------------------lleeelleeelhhhhLLEEEEEL


DSSP  LLLEE-------LLEE-----lllLHHHHHHHHHHLLEEEEEEEELLLllllhhhhhhhH
Query IYLPF-------MATF-----akdTHETGSKAALMGGTTTYIEMCCPSrnddalegyqlW  108
ident |              |            |   |   |  |                    
Sbjct ICGSSagflrawPEFFgsrkalaeKAVRGLRRARAAGVRTIVDVSTFD--------igrD   75
DSSP  LEELLllhhhhlHHHHllhhhhhhHHHHHHHHHHHLLLLEEEELLLHH--------hllL


DSSP  HHHHLLLL---LLEEEEEEELL------LLLL---LHHHHHHHHHHL-------LLLEEE
Query KSKAEGNS---YCDYTFHMAVS------KFDE---KTEGQLREIVAD-------GISSFX  149
ident  |     |                                                   |
Sbjct VSLLAEVSraaDVHIVAATGLWfdpplsMRLRsveELTQFFLREIQYgiedtgiRAGIIX  135
DSSP  HHHHHHHHhhhLLEEELEEELLllllhhHHLLlhhHHHHHHHHHHHLlllllllLLLEEE


DSSP  EEELllllllLLHHHHHHHHHHHHHHLLEEEEEELlhhhhhhhhhhhhhlllllhhhlll
Query IFLSyknffgVDDGEMYQTLRLAKELGVIVTAHCEnaelvgrlqqkllsegktgpewhep  209
ident                     |     || || |                           
Sbjct VATT-gkatpFQELVLKAAARASLATGVPVTTHTA-------------------------  169
DSSP  EELL-llllhHHHHHHHHHHHHHHHHLLLEEEELL-------------------------


DSSP  lllhhHHHHHHHHHHHHHHHHLL---EEEELLL-LLHHhHHHHHHHHHllLLEEEEE-EH
Query srpeaVEAEGTARFATFLETTGA---TGYVVHL-SCKPaLDAAMAAKArgVPIYIES-VI  264
ident               |   |  |         |       |    |  |      |    |
Sbjct -----ASQRDGEQQAAIFESEGLspsRVCIGHSdDTDD-LSYLTALAA--RGYLIGLdHI  221
DSSP  -----HHHLHHHHHHHHHHHLLLlhhHEEELLHhHLLL-HHHHHHHHH--LLLEEEElLL


DSSP  HHhhlLHHHHHLlhhHHHLLLLllLLLLL--HHHHHHHHHHHL--LLLLEEELLLLLL--
Query PHfllDKTYAERggvEAMKYIMspPLRDK--RNQKVLWDALAQ--GFIDTVGTDHCPF--  318
ident |         |     |                         |       |  |      
Sbjct PY---SAIGLED---NASASAL--LGIRSwqTRALLIKALIDQgyMKQILVSNDWTFGfs  273
DSSP  LL---LLLLLLL---LHHHHHH--HLLLLhhHHHHHHHHHHHLllHHHEEELLLLLLEel


DSSP  -lHHHHhhhlllhhhllllllLLLLHHHHHHHHHLlLLLLLHHHHHHHHLHHHHHHLLll
Query -dTEQKllgkeaftaipngipAIEDRVNLLYTYGVsRGRLDIHRFVDAASTKAAKLFGlf  377
ident                                                   |  |      
Sbjct syVTNI-----mdvmdrvnpdGMAFIPLRVIPFLR-EKGVPQETLAGITVTNPARFLS--  325
DSSP  llLLLH-----hhhhhhhlllHHHHHHHLHHHHHH-HLLLLHHHHHHHHLHHHHHHHL--


DSSP  llllllllllllleeeeelllleellhhhllllllllllllleelleeeeeeelleeeee
Query prkgtiavgsdadlvvydpqyrgtisvktqhvnndyngfegfeidgrpsvvtvrgkvavr  437
ident                                                             
Sbjct ------------------------------------------------------------  325
DSSP  ------------------------------------------------------------


DSSP  lleelllllllllllllLLLL
Query dgqfvgekgwgkllrrePMYF  458
ident                  |   
Sbjct -----------------PTLR  329
DSSP  -----------------LLLL


No 26: Query=1gkpA Sbjct=4rdvB Z-score=18.9

back to top
DSSP  lEEEELLEEEELLEEEE-LEEEELL-LLLLEEE--LLLLLlllleEEELLlLEEEELEEE
Query pLLIKNGEIITADSRYK-ADIYAEG-ETITRIG--QNLEAppgteVIDATgKYVFPGFID   56
ident    |                           |    |                | ||   
Sbjct -SAIFAERALLPEGWARnVRFEISAdGVLAEIRpdANADG-----AERLG-GAVLPGMPN   53
DSSP  -LEEEEEEEEELLEEEEeEEEEELLlLLEEEEEllLLLLL-----LEELL-LLEEELEEE


DSSP  EEELLLL----------------------eELLEE-------llLLHHHHHHHHHHLLEE
Query PHVHIYL----------------------pFMATF-------akDTHETGSKAALMGGTT   87
ident  | |                                                  |  | |
Sbjct LHSHAFQramaglaevagnpndsfwtwrelMYRMVarlspeqieVIACQLYIEMLKAGYT  113
DSSP  EEELHHHhhhlllllllllllllhhhhhhhHHHHHllllhhhhhHHHHHHHHHHHHHLEE


DSSP  EEEEEELLL---llllhhHHHHHHHhHHLLLL---LLEEEEEEELLL-------------
Query TYIEMCCPS---rnddalEGYQLWKsKAEGNS---YCDYTFHMAVSK-------------  128
ident    |                  |                |                    
Sbjct AVAEFHYVHhdldgrsyaDPAELSL-RISRAAsaaGIGLTLLPVLYShagfggqpasegq  172
DSSP  EEEEEELLLlllllllllLLLHHHH-HHHHHHhhhLLEEEEEELLLLeeellleellhhh


DSSP  -----LLLLHHHHHHHHHHLL-----LLEEE-EEELlllllLLLHHHHHHHHHHhHHHLL
Query -----FDEKTEGQLREIVADG-----ISSFX-IFLSyknffGVDDGEMYQTLRLaKELGV  177
ident        |     |    |               |       |        |        
Sbjct rrfinGSEAYLELLQRLRAPLeaaghSLGLCfHSLR-----AVTPQQIATVLAA-GHDDL  226
DSSP  lllllLHHHHHHHHHHHHHHHhhhllEELEEeLLLL-----LLLHHHHHHHHLL-LLLLL


DSSP  EEEEEELlhhhhhhhhhhhhhlllllhhhllllLLHHH-------hhHHHHHHHHHHHhh
Query IVTAHCEnaelvgrlqqkllsegktgpewhepsRPEAV-------eaEGTARFATFLEtt  230
ident  |  |                                |                      
Sbjct PVHIHIA-------------------------eQQKEVddcqawsgrRPLQWLYENVA-v  260
DSSP  LEEEEEL-------------------------lLHHHHhhhhhhhllLHHHHHHHHLL-l


DSSP  llEEEELLLLLHH--HHHHHHHHHhllllEEEEEEHH-HHHLlhhhhhllhhhhhlllll
Query gaTGYVVHLSCKP--ALDAAMAAKargvpIYIESVIP-HFLLdktyaerggveamkyims  287
ident       ||          |                      |                  
Sbjct dqRWCLVHATHADpaEVAAMARSG-----AVAGLCLStEANL------------------  297
DSSP  llLEEEEELLLLLhhHHHHHHHHL-----LEEEELHHhHHHL------------------


DSSP  lLLLLlhhhhHHHHHHHLLLLLEEELLLllllhhhhhhhlllhhhllllLLLLllHHHHH
Query pPLRDkrnqkVLWDALAQGFIDTVGTDHcpfdteqkllgkeaftaipngIPAIedRVNLL  347
ident              | ||||     | |                             |   
Sbjct -GDGI----fPATDFLAQGGRLGIGSDS---------------------HVSL--SVVEE  329
DSSP  -LLLL----lLHHHHHHLLLEEEELLLL---------------------LLLL--LHHHH


DSSP  HHH--------hllLLLL-------LHHHHHHHHLHHHHHHLLLllLLLLLLLLLLLLEE
Query YTY--------gvsRGRL-------DIHRFVDAASTKAAKLFGLfpRKGTIAVGSDADLV  392
ident               | ||             |||    |   |     |  |||  ||| 
Sbjct LRWleygqrlrdrkRNRLyrddqpmIGRTLYDAALAGGAQALGQ--PIGSLAVGRRADLL  387
DSSP  HHHhhhhhhhhhllLLLLlllllllHHHHHHHHHHHHHHHHHLL--LLLLLLLLLLLLEE


DSSP  EEELLLleellhhhlllllllllllllEELL--EEEEEEELLEEEEELLEELLL-lllll
Query VYDPQYrgtisvktqhvnndyngfegfEIDG--RPSVVTVRGKVAVRDGQFVGE-kgwgk  449
ident | |                           |      | | |   ||||   ||      
Sbjct VLDGND-----pylasaegdallnrwlFAGGdrQVRDVMVAGRWVVRDGRHAGEersara  442
DSSP  EELLLL-----hhhhllllhhhhhhhhHHLLhhHEEEEEELLEEEELLLLLLLHhhhhhh


DSSP  lllllllll
Query llrrepmyf  458
ident          
Sbjct fvqvlgell  451
DSSP  hhhhhhhhl


No 27: Query=1gkpA Sbjct=3irsA Z-score=18.8

back to top
DSSP  leeeelleeeelleeeeleeeelllllleeellllllllleeeelllleeeELEEEEEEL
Query pllikngeiitadsrykadiyaegetitrigqnleappgtevidatgkyvfPGFIDPHVH   60
ident                                                       ||    
Sbjct ---------------------------------------------------LKIIDFRLR    9
DSSP  ---------------------------------------------------LLLEELLLL


DSSP  L----LLEEllEELL----------------------LLHHHHHHHHHHLLEEEEEEEEL
Query I----YLPFmaTFAK----------------------DTHETGSKAALMGGTTTYIEMCC   94
ident       |                                 |         |         
Sbjct PpamgFLNA--RIYTrpdirnrftrqlgfepapsaeeKSLELMFEEMAAAGIEQGVCVGR   67
DSSP  LllhhHHHL--HHHHlhhhhhhhhhhhlllllhhhhhLLHHHHHHHHHHLLLLEEEEELL


DSSP  LLLlllhhhHHHHHHHHHLLLllLEEEEEEELLLLL-LLHHHHHHHHHHLLLLEEEEEEL
Query PSRnddaleGYQLWKSKAEGNsyCDYTFHMAVSKFD-EKTEGQLREIVADGISSFXIFLS  153
ident  |               |                        |  ||   ||        
Sbjct NSS-vlgsvSNADVAAVAKAY-pDKFHPVGSIEAATrKEAMAQMQEILDLGIRIVNLEPG  125
DSSP  EEL-lleelLHHHHHHHHHHL-lLLEEEEEELLLLLhHHHHHHHHHHHHLLLLLEEELHH


DSSP  LLLlLLLL--HHHHHHHHHHHHHHLLEEEEEE--lLHHHHhhhhhhhhhlllllhhhlll
Query YKNfFGVD--DGEMYQTLRLAKELGVIVTAHC--eNAELVgrlqqkllsegktgpewhep  209
ident           |   |         |  |                                
Sbjct VWA-TPMHvdDRRLYPLYAFCEDNGIPVIMMTggnAGPDI--------------------  164
DSSP  HLL-LLLLllLHHHHHHHHHHHHLLLLEEEELlllLLLLH--------------------


DSSP  lllhhHHHHhhHHHHHHHHHHL-LEEEELLL---lLHHHHHHHHHHHhlllLEEEEEEhH
Query srpeaVEAEgtARFATFLETTG-ATGYVVHL---sCKPALDAAMAAKargvPIYIESViP  265
ident                  |      |    |            |          |      
Sbjct ----tYTNP--EHIDRVLGDFPdLTVVSSHGnwpwVQEIIHVAFRRP----NLYLSPD-M  213
DSSP  ----hHHLH--HHHHHHHHHLLlLLEEEEHHhlllHHHHHHHHHHLL----LEEEELH-H


DSSP  HHHLLhhhhhllhhhhhlllllllllllHHHHHHHHHHHLLL--LLEEELLLLlllhhhh
Query HFLLDktyaerggveamkyimspplrdkRNQKVLWDALAQGF--IDTVGTDHCpfdteqk  323
ident                                     |           ||          
Sbjct YLYNL-----------------------PGHADFIQAANSFLadRMLFGTAYP-------  243
DSSP  HHLLL-----------------------LLHHHHHHHHLLHHhhLLLLLLLLL-------


DSSP  hhhlllhhhllllLLLLLLHHHHHHHHHlllllLLHHHHHHHHLHHHHHHLLllllllll
Query llgkeaftaipngIPAIEDRVNLLYTYGvsrgrLDIHRFVDAASTKAAKLFGlfprkgti  383
ident                          |                    |  |          
Sbjct -------------MCPLKEYTEWFLTLP-----IKPDAMEKILHGNAERLLA--------  277
DSSP  -------------LLLHHHHHHHHHLLL-----LLHHHHHHHHLHHHHHHHH--------


DSSP  llllllleeeeelllleellhhhllllllllllllleelleeeeeeelleeeeelleell
Query avgsdadlvvydpqyrgtisvktqhvnndyngfegfeidgrpsvvtvrgkvavrdgqfvg  443
ident                                                             
Sbjct ------------------------------------------------------------  277
DSSP  ------------------------------------------------------------


DSSP  lllllllllLLLLll
Query ekgwgkllrREPMyf  458
ident                
Sbjct ---------QAGR--  281
DSSP  ---------HLLL--


No 28: Query=1gkpA Sbjct=3cjpA Z-score=18.8

back to top
DSSP  leeeelleeeelleeeeleeeelllllleeellllllllleeeelllleeeeLEEEEEEL
Query pllikngeiitadsrykadiyaegetitrigqnleappgtevidatgkyvfpGFIDPHVH   60
ident                                                       || | |
Sbjct ----------------------------------------------------LIIDGHTH    8
DSSP  ----------------------------------------------------LLEEEEEE


DSSP  LLleelleellLLHHHHHHHHHHLLEEEEEEEELL-------------------------
Query IYlpfmatfakDTHETGSKAALMGGTTTYIEMCCP-------------------------   95
ident               |   |     |    |                              
Sbjct VI---------LPVEKHIKIMDEAGVDKTILFSTSihpetavnlrdvkkemkklndvvng   59
DSSP  LL---------LLHHHHHHHHHHHLLLEEEEELLLllhhhlllhhhhhhhhhhhhhhhll


DSSP  --LLLL-LHHHHHHHHHHHHLLLLlLEEEEEEELLLLLL--LHHHHHHHH-HHLLLLEEE
Query --SRND-DALEGYQLWKSKAEGNSyCDYTFHMAVSKFDE--KTEGQLREI-VADGISSFX  149
ident                            |     |        |     |  |        
Sbjct ktNSMIdVRRNSIKELTNVIQAYP-SRYVGFGNVPVGLSenDTNSYIEENiVNNKLVGIG  118
DSSP  llLLLHhHHHHHHHHHHHHHHHLL-LLEEEEELLLLLLLhhHHHHHHHHHlLLLLLLEEE


DSSP  -EEELlllllllLHHHHHHHHHHHHHH-LLEEEEEELLHhhhhhhhhhhhhlllllhhhl
Query -IFLSyknffgvDDGEMYQTLRLAKEL-GVIVTAHCENAelvgrlqqkllsegktgpewh  207
ident                                   |  |                      
Sbjct eLTPA-----sgQIKSLKPIFKYSMDSgSLPIWIHAFNP---------------------  152
DSSP  eELLL-----llLHHHHHHHHHHHHHLlLLLEEELLLLL---------------------


DSSP  lllllhhHHHHHHHHHHHHHHHHL-LEEEELLLLLHhHHHHHHHHHHLLLLEEEEEEhHH
Query epsrpeaVEAEGTARFATFLETTG-ATGYVVHLSCKpALDAAMAAKARGVPIYIESViPH  266
ident                 |              |         |          |       
Sbjct -------LVLQDIKEIAELCKAFPkVPVILGHMGGS-NWMTAVELAKEIQNLYLDTS-AY  203
DSSP  -------LLHHHHHHHHHHHHHLLlLLEEEHHHHHH-HHHHHHHHHHHLLLEEEELL-LL


DSSP  HHllhhhhhllhhhhhlllllllllllhhHHHHHHHHHLLL-LLEEELLLLlllhhhhhh
Query FLldktyaerggveamkyimspplrdkrnQKVLWDALAQGF-IDTVGTDHCpfdteqkll  325
ident |                              ||             |||           
Sbjct FS---------------------------TFVLKIVINELPlKCIFGTDMP---------  227
DSSP  LL---------------------------HHHHHHHHHHLLlLEELLLLLL---------


DSSP  hlllhhhllllLLLLLLHHHHHHHHHlllllLLHHHHHHHHLHHHHHHLLLlllllllll
Query gkeaftaipngIPAIEDRVNLLYTYGvsrgrLDIHRFVDAASTKAAKLFGLfprkgtiav  385
ident                                 |              |            
Sbjct -----------FGDLQLSIEAIKKMS-----NDSYVANAVLGDNISRLLNI---------  262
DSSP  -----------LLLHHHHHHHHHHHL-----LLHHHHHHHHLHHHHHHHLL---------


DSSP  llllleeeeelllleellhhhllllllllllllleelleeeeeeelleeeeelleellll
Query gsdadlvvydpqyrgtisvktqhvnndyngfegfeidgrpsvvtvrgkvavrdgqfvgek  445
ident                                                             
Sbjct ------------------------------------------------------------  262
DSSP  ------------------------------------------------------------


DSSP  lllllllllllll
Query gwgkllrrepmyf  458
ident              
Sbjct -------------  262
DSSP  -------------


No 29: Query=1gkpA Sbjct=1bf6A Z-score=18.1

back to top
DSSP  leeeelleeeelleeeeleeeelllllleeellllllllleeeelllleeeELEEEEEEL
Query pllikngeiitadsrykadiyaegetitrigqnleappgtevidatgkyvfPGFIDPHVH   60
ident                                                     |    | |
Sbjct -----------------------------------------------sfdpTGYTLAHEH   13
DSSP  -----------------------------------------------llllLLEEEEEEL


DSSP  LLLEELL------EELLLL--HHHHHHHHHHLLEEEEEEEELLLllllhhhhhhhHHHHH
Query IYLPFMA------TFAKDT--HETGSKAALMGGTTTYIEMCCPSrnddalegyqlWKSKA  112
ident                                 |    |||                    
Sbjct LHIDLSGfknnvdCRLDQYafICQEMNDLMTRGVRNVIEMTNRY--------mgrNAQFM   65
DSSP  LLEELHHhhllhhHEELLHhhHHHHHHHHHHLLEEEEEELLLHH--------hllLHHHH


DSSP  LLLL---LLEEEEEEELL-----------llLLLHHHHHHHHHHL-------LLLEEE-E
Query EGNS---YCDYTFHMAVS-----------kfDEKTEGQLREIVAD-------GISSFX-I  150
ident                                                            |
Sbjct LDVMretGINVVACTGYYqdaffpehvatrsVQELAQEMVDEIEQgidgtelKAGIIAeI  125
DSSP  HHHHhhhLLEEEEEELLLlhhhlllhhhhllHHHHHHHHHHHHHLlllllllLEEEEEeE


DSSP  EELLlllllLLHHHHHHHHHHHHHHLLEEEEEELlhhhhhhhhhhhhhlllllhhhllll
Query FLSYknffgVDDGEMYQTLRLAKELGVIVTAHCEnaelvgrlqqkllsegktgpewheps  210
ident   |                      |     |                            
Sbjct GTSEgkitpLEEKVFIAAALAHNQTGRPISTHTS--------------------------  159
DSSP  ELLLllllhHHHHHHHHHHHHHHHHLLLEEEELH--------------------------


DSSP  llhhhHHHHHHHHHHHHHHHLL---EEEELLLL---LHHHHHHHHHHHhllllEEEEEEH
Query rpeavEAEGTARFATFLETTGA---TGYVVHLS---CKPALDAAMAAKargvpIYIESVI  264
ident                 |   |       | |                       |     
Sbjct -----FSTMGLEQLALLQAHGVdlsRVTVGHCDlkdNLDNILKMIDLG-----AYVQFDT  209
DSSP  -----HHLLHHHHHHHHHHLLLlhhHEEELLLLlllLHHHHHHHHHLL-----LEEEELL


DSSP  HhhHLLHhhhhllhhhhhllllllLLLLLHHHHHHHHHH--hLLLLLEEELLLLLLLhhh
Query PhfLLDKtyaerggveamkyimspPLRDKRNQKVLWDAL--aQGFIDTVGTDHCPFDteq  322
ident                            |      |                |        
Sbjct I--GKNS-----------------YYPDEKRIAMLHALRdrgLLNRVMLSMDITRRS---  247
DSSP  L--LLLL-----------------LLLHHHHHHHHHHHHhllLHHHEEELLLLLLHH---


DSSP  hhhhlllhhhlllllLLLLLHHHHHHHHHLlLLLLLHHHHHHHHLHHHHHHLLlllllll
Query kllgkeaftaipngiPAIEDRVNLLYTYGVsRGRLDIHRFVDAASTKAAKLFGlfprkgt  382
ident                                                    |        
Sbjct --------hlkanggYGYDYLLTTFIPQLR-QSGFSQADVDVMLRENPSQFFQ-------  291
DSSP  --------hlhhhllLLLLHHHHLHHHHHH-HLLLLHHHHHHHHLHHHHHHLL-------


DSSP  lllllllleeeeelllleellhhhllllllllllllleelleeeeeeelleeeeelleel
Query iavgsdadlvvydpqyrgtisvktqhvnndyngfegfeidgrpsvvtvrgkvavrdgqfv  442
ident                                                             
Sbjct ------------------------------------------------------------  291
DSSP  ------------------------------------------------------------


DSSP  llllllllllllllll
Query gekgwgkllrrepmyf  458
ident                 
Sbjct ----------------  291
DSSP  ----------------


No 30: Query=1gkpA Sbjct=2dvtA Z-score=17.4

back to top
DSSP  leeeelleeeelleeeeleeeelllllleeellllllllleeeelllleeEELEEEEEEL
Query pllikngeiitadsrykadiyaegetitrigqnleappgtevidatgkyvFPGFIDPHVH   60
ident                                                     |      |
Sbjct --------------------------------------------------MQGKVALEEH   10
DSSP  --------------------------------------------------LLLEEEEEEE


DSSP  lLLEE--LLEE---------------LLLLHHHHHHHHHHLLEEEEEEEEL--LLLL---
Query iYLPF--MATF---------------AKDTHETGSKAALMGGTTTYIEMCC--PSRN---   98
ident                             |   |  |     |  | |             
Sbjct -FAIPetLQDSagfvpgdywkelqhrLLDIQDTRLKLMDAHGIETMILSLNapAVQAipd   69
DSSP  -ELLHhhHHHHlllllllhhhhhhhhHHLLLLHHHHHHHHLLEEEEEEEELllHHHHlll


DSSP  -----LLHHHHHHHHHHHHLLLLlLEEEEEEELLL-LLLLHHHHHHHHHHL-LLLEEEEE
Query -----DDALEGYQLWKSKAEGNSyCDYTFHMAVSK-FDEKTEGQLREIVAD-GISSFXIF  151
ident        |                       |            |   | | |       
Sbjct rrkaiEIARRANDVLAEECAKRP-DRFLAFAALPLqDPDAATEELQRCVNDlGFVGALVN  128
DSSP  hhhhhHHHHHHHHHHHHHHHHLL-LLEEEEELLLLlLHHHHHHHHHHHHHLlLLLEEEEE


DSSP  ELLLL----llLLLH-HHHHHHHHHHHHHLLEEEEEEllhhhHHHHHHHHhhlllLLHHH
Query LSYKN----ffGVDD-GEMYQTLRLAKELGVIVTAHCenaelVGRLQQKLlsegkTGPEW  206
ident               |             | |    |                    |  |
Sbjct GFSQEgdgqtpLYYDlPQYRPFWGEVEKLDVPFYLHP---rnPLPQDSRI----yDGHPW  181
DSSP  LLLLLllllllLLLLlHHHHHHHHHHHHHLLLEEEEL---llLLHHHLHH----hLLLHH


DSSP  LL--llLLHHHHHHHHHHHH--HHHHHHL-LEEEELLLLLHhHHHH--------------
Query HE--psRPEAVEAEGTARFA--TFLETTG-ATGYVVHLSCKpALDA--------------  247
ident             |    |                  |                       
Sbjct LLgptwAFAQETAVHALRLMasGLFDEHPrLNIILGHMGEG-LPYMmwridhrnawvklp  240
DSSP  HLhhhlHHHHHHHHHHHHHHhlLHHHHLLlLLEEELHHHLL-HHHHhhhhhhllllllll


DSSP  --------hHHHHHllLLEEEEEEhHHHHllhhhhhllhhhhhlllllllllllhhHHHH
Query --------aMAAKArgVPIYIESViPHFLldktyaerggveamkyimspplrdkrnQKVL  299
ident          |          |      |                               |
Sbjct prypakrrfMDYFN--ENFHITTS-GNFR---------------------------TQTL  270
DSSP  llllllllhHHHHH--HHEEEELL-LLLL---------------------------HHHH


DSSP  HHHH--hLLLLLEEELLLLlllhhhhhhhlllhhhllllLLLLLLHHHHHHHHHlllllL
Query WDAL--aQGFIDTVGTDHCpfdteqkllgkeaftaipngIPAIEDRVNLLYTYGvsrgrL  357
ident  ||            ||                         |                 
Sbjct IDAIleiGADRILFSTDWP--------------------FENIDHASDWFNATS-----I  305
DSSP  HHHHlllLHHHEELLLLLL--------------------LLLHHHHHHHHHHLL-----L


DSSP  LHHHHHHHHLHHHHHHLLLLllllllllllllleeeeelllleellhhhlllllllllll
Query DIHRFVDAASTKAAKLFGLFprkgtiavgsdadlvvydpqyrgtisvktqhvnndyngfe  417
ident      |    | |  || |                                         
Sbjct AEADRVKIGRTNARRLFKLD----------------------------------------  325
DSSP  LHHHHHHHHLHHHHHHLLLL----------------------------------------


DSSP  lleelleeeeeeelleeeeelleelllllllllllllllll
Query gfeidgrpsvvtvrgkvavrdgqfvgekgwgkllrrepmyf  458
ident                                          
Sbjct -----------------------------------------  325
DSSP  -----------------------------------------


No 31: Query=1gkpA Sbjct=4dlfA Z-score=17.4

back to top
DSSP  leeeelleeeelleeeeleeeelllllleeellllllllleeeelllleeeELEEEEEEL
Query pllikngeiitadsrykadiyaegetitrigqnleappgtevidatgkyvfPGFIDPHVH   60
ident                                                       || | |
Sbjct ---------------------------------------------------ALRIDSHQH    9
DSSP  ---------------------------------------------------LLLEEEEEL


DSSP  LlLEELL-------------EELLlLHHHHHHHHHHLLEEEEEEEELLLllllHHHHHHH
Query IyLPFMA-------------TFAKdTHETGSKAALMGGTTTYIEMCCPSrnddALEGYQL  107
ident       |                                   |                 
Sbjct F-WRYRAadypwigagmgvlARDY-LPDALHPLMHAQALGASIAVQARA----GRDETAF   63
DSSP  L-LLLLHhhllllllllhhhLLLL-LHHHHHHHHHHLLLLEEEEELLLL----LHHHHHH


DSSP  HHHHHLLLLlLEEEEEEELLLLLLLHHHHHHHhHHLL-LLEEEEEELLLL-lllLLHH-H
Query WKSKAEGNSyCDYTFHMAVSKFDEKTEGQLREiVADG-ISSFXIFLSYKN-ffgVDDG-E  164
ident     |                          |         |   |          |   
Sbjct LLELACDEA-RIAAVVGWEDLRAPQLAERVAE-WRGTkLRGFRHQLQDEAdvraFVDDaD  121
DSSP  HHHHHLLLL-LEEEEEELLLLLLLLHHHHHHL-LLLLlEEEEEELHHHLLlhhhHHHLhH


DSSP  HHHHHHHHHHHLLEEEEEELlhhhhhhhhhhhhhlllllhhhllllllhhhHHHHhHHHH
Query MYQTLRLAKELGVIVTAHCEnaelvgrlqqkllsegktgpewhepsrpeavEAEGtARFA  224
ident                                                    |        
Sbjct FARGVAWLQANDYVYDVLVF-------------------------------ERQL-PDVQ  149
DSSP  HHHHHHHHHHLLLEEEELLL-------------------------------HHHH-HHHH


DSSP  HHHHHHL-LEEEELL-LLLH------------HHHHHHHHHHHlLLLEEEEEEHHHhhLL
Query TFLETTG-ATGYVVH-LSCK------------PALDAAMAAKArGVPIYIESVIPHflLD  270
ident  |            |                     |     |                 
Sbjct AFCARHDaHWLVLDHaGKPAlaefdrddtalaRWRAALRELAA-LPHVVCKLSGLV-tEA  207
DSSP  HHHHHLLlLLEEEHHhHLLLhhhllllllhhhHHHHHHHHHHL-LLLEEEEELLLL-lLL


DSSP  HHHHHllhhhhhlllllllllLLHHHHHHHHHHHLLL---LLEEELLLLlllhhhhhhhl
Query KTYAErggveamkyimspplrDKRNQKVLWDALAQGF---IDTVGTDHCpfdteqkllgk  327
ident                      | |      ||    |       | |             
Sbjct DWRRG------------lrasDLRHIEQCLDAALDAFgpqRLMFGSDWP-----------  244
DSSP  LLLLL------------llhhHHHHHHHHHHHHHHHHlhhHEEELLLLL-----------


DSSP  llhhhlllLLLL---LLLHHHHHHHHHLllLLLLHHHHHHHHLHHHHHHLLLLlllllll
Query eaftaipnGIPA---IEDRVNLLYTYGVsrGRLDIHRFVDAASTKAAKLFGLFprkgtia  384
ident                      |         ||            ||    |        
Sbjct --------VCLLaasYDEVASLVERWAE--SRLSAAERSALWGGTAARCYALP-------  287
DSSP  --------HHHHlllHHHHHHHHHHHHH--HHLLHHHHHHHLLHHHHHHLLLL-------


DSSP  lllllleeeeelllleellhhhllllllllllllleelleeeeeeelleeeeelleelll
Query vgsdadlvvydpqyrgtisvktqhvnndyngfegfeidgrpsvvtvrgkvavrdgqfvge  444
ident                                                             
Sbjct ------------------------------------------------------------  287
DSSP  ------------------------------------------------------------


DSSP  llllllllllllll
Query kgwgkllrrepmyf  458
ident               
Sbjct --------------  287
DSSP  --------------


No 32: Query=1gkpA Sbjct=2vc5A Z-score=17.3

back to top
DSSP  leeeelleeeelleeeeleeeelllllleeellllllllleeeelllleeeeLEEEEEEL
Query pllikngeiitadsrykadiyaegetitrigqnleappgtevidatgkyvfpGFIDPHVH   60
ident                                                     ||   | |
Sbjct ------------------------------------mriplvgkdsieskdiGFTLIHEH   24
DSSP  ------------------------------------llllllllllllhhhlLLEELLLL


DSSP  LLLEELLE-----------elllLHHHHHHHHHHLLEEEEEEEELLLllllhhhhhhhHH
Query IYLPFMAT-----------fakdTHETGSKAALMGGTTTYIEMCCPSrnddalegyqlWK  109
ident       |                      | |   |  |                     
Sbjct LRVFSEAVrqqwphlynedeefrNAVNEVKRAMQFGVKTIVDPTVMG--------lgrDI   76
DSSP  LLLLLHHHhhhlhhhllhhhhhhHHHHHHHHHHHLLLLEEEELLLLL--------lllLH


DSSP  HHHLLLL---LLEEEEEEELLL-----------lLLLHHHHHHHHHHL-------LLLEE
Query SKAEGNS---YCDYTFHMAVSK-----------fDEKTEGQLREIVAD-------GISSF  148
ident    |                                                        
Sbjct RFMEKVVkatGINLVAGTGIYIyidlpfyflnrsIDEIADLFIHDIKEgiqgtlnKAGFV  136
DSSP  HHHHHHHhllLLEEEELEELLLlllllhhhllllHHHHHHHHHHHHHLlllllllLLLLE


DSSP  EEEELLLllllLLHHHHHHHHHHHHHHLLEEEEEELlhhhhhhhhhhhhhlllllhhhll
Query XIFLSYKnffgVDDGEMYQTLRLAKELGVIVTAHCEnaelvgrlqqkllsegktgpewhe  208
ident ||                      ||  |    |                          
Sbjct XIAADEPgitkDVEKVIRAAAIANKETKVPIITHSN------------------------  172
DSSP  EEELLLLlllhHHHHHHHHHHHHHHHHLLLEEEELL------------------------


DSSP  llllhhHHHHHHHHHHHHHHHHLL---EEEELLL-LLHH--HHHHHHHHHhllllEEEEE
Query psrpeaVEAEGTARFATFLETTGA---TGYVVHL-SCKP--ALDAAMAAKargvpIYIES  262
ident                   |   |         ||                       |  
Sbjct ------AHNNTGLEQQRILTEEGVdpgKILIGHLgDTDNidYIKKIADKG-----SFIGL  221
DSSP  ------LLLLHHHHHHHHHHHLLLlhhHEEELLHhHLLLhhHHHHHHHLL-----LEEEE


DSSP  -EHHHhhllhhhhhllhhhhhllllllLLLL-LHHHHHHHHHHHLLL--LLEEELLLLLL
Query -VIPHflldktyaerggveamkyimspPLRD-KRNQKVLWDALAQGF--IDTVGTDHCPF  318
ident                                              |         | |  
Sbjct dRYGL---------------------dLFLPvDKRNETTLRLIKDGYsdKIMISHDYCCT  260
DSSP  lLLLL---------------------lLLLLhHHHHHHHHHHHHLLLllLEEELLLLLLL


DSSP  lhhhhhhhlllhHHLL--------lllLLLLLHHHHHHHHHLlLLLLLHHHHHHHHLHHH
Query dteqkllgkeafTAIP--------ngiPAIEDRVNLLYTYGVsRGRLDIHRFVDAASTKA  370
ident                              |             |                
Sbjct ----------idWGTAkpeykpklaprWSITLIFEDTIPFLK-RNGVNEEVIATIFKENP  309
DSSP  ----------llLLLLlhhhhhhhlllLLLLHHHHLHHHHHH-LLLLLHHHHHHHHLHHH


DSSP  HHHLLllllllllllllllleeeeelllleellhhhllllllllllllleelleeeeeee
Query AKLFGlfprkgtiavgsdadlvvydpqyrgtisvktqhvnndyngfegfeidgrpsvvtv  430
ident  | |                                                        
Sbjct KKFFS-------------------------------------------------------  314
DSSP  HHHLL-------------------------------------------------------


DSSP  lleeeeelleelllllllllllllllll
Query rgkvavrdgqfvgekgwgkllrrepmyf  458
ident                             
Sbjct ----------------------------  314
DSSP  ----------------------------


No 33: Query=1gkpA Sbjct=3k2gB Z-score=17.3

back to top
DSSP  leeeelleeeelleeeeleeeelllllleeellllllllleeeelllleeeeLEEEEEEL
Query pllikngeiitadsrykadiyaegetitrigqnleappgtevidatgkyvfpGFIDPHVH   60
ident                                                     |    | |
Sbjct -------------------------slselspchvrsgrixtvdgpipssalGHTLXHEH   35
DSSP  -------------------------llllllllllllleeeelleeeehhhlLLEELLLL


DSSP  LLLEELL------------------------------------EELLLL--HHHHHHHHH
Query IYLPFMA------------------------------------TFAKDT--HETGSKAAL   82
ident                                                |        |   
Sbjct LQNDCRCwwnppqeperqylaeapisieilselrqdpfvnkhnIALDDLdlAIAEVKQFA   95
DSSP  LLEELHHhllllllhhhhhhhhllllhhhhhhhhllhhhllllLEELLHhhHHHHHHHHH


DSSP  HLLEEEEEEEELLLllllhhhhhhhHHHHHLLLL---LLEEEEEEELL-------lLLLL
Query MGGTTTYIEMCCPSrnddalegyqlWKSKAEGNS---YCDYTFHMAVS-------kFDEK  132
ident   |        |                |    |                          
Sbjct AVGGRSIVDPTCRG--------igrDPVKLRRISaetGVQVVXGAGYYlassxpetAARL  147
DSSP  HLLLLEEEELLLLL--------lllLHHHHHHHHhhhLLEEEELLLLLlhhhllhhHHLL


DSSP  ----HHHHHHHHHHL-------LLLEEE-EEELLLllllLLHHHHHHHHHHHHHHLLEEE
Query ----TEGQLREIVAD-------GISSFX-IFLSYKnffgVDDGEMYQTLRLAKELGVIVT  180
ident                        |     |  |                |     |    
Sbjct saddIADEIVAEALEgtdgtdaRIGLIGeIGVSSD-ftaEEEKSLRGAARAQVRTGLPLX  206
DSSP  lhhhHHHHHHHHHHLlllllllLLLLEEeELLLLL-llhHHHHHHHHHHHHHHHHLLLEE


DSSP  EEELlhhhhhhhhhhhhhlllllhhhllllllhhHHHHhHHHHHHHHHHHLLE---EEEL
Query AHCEnaelvgrlqqkllsegktgpewhepsrpeaVEAEgTARFATFLETTGAT---GYVV  237
ident  |                                       |     |  ||        
Sbjct VHLP-----------------------------gWFRL-AHRVLDLVEEEGADlrhTVLC  236
DSSP  ELLL-----------------------------lLLLL-HHHHHHHHHHLLLLhhhEEEL


DSSP  LL--LLHH--HHHHHHHHHhllllEEEEE-EHHHhhllhhhhhllhhhhhLLLL---llL
Query HL--SCKP--ALDAAMAAKargvpIYIES-VIPHflldktyaerggveamKYIM---spP  289
ident |   |                      |   |                            
Sbjct HXnpSHXDpvYQATLAQRG-----AFLEFdXIGX----------------DFFYadqgvQ  275
DSSP  LLhhHLLLhhHHHHHHHHL-----LEEEElLLLL----------------LLEElllleE


DSSP  LLL-LHHHHHHHHHH--hLLLLLEEELLLLLLLhhhhhhhlllhhhlllllLLLLLHHHH
Query LRD-KRNQKVLWDAL--aQGFIDTVGTDHCPFDteqkllgkeaftaipngiPAIEDRVNL  346
ident                            |                                
Sbjct CPSdDEVARAILGLAdhgYLDRILLSHDVFVKX-----------xltryggNGYAFVTKH  324
DSSP  LLLhHHHHHHHHHHHhllLHHHEEELLLLLLHH-----------hlhhhllLLLLHHHHL


DSSP  HHHHHLlLLLLLHHHHHHHHLHHHHHHLLllllllllllllllleeeeelllleellhhh
Query LYTYGVsRGRLDIHRFVDAASTKAAKLFGlfprkgtiavgsdadlvvydpqyrgtisvkt  406
ident        |  ||         |     |                                
Sbjct FLPRLR-RHGLDDAALETLXVTNPRRVFD-------------------------------  352
DSSP  HHHHHH-HLLLLHHHHHHHHLHHHHHHHL-------------------------------


DSSP  llllllllllllleelleeeeeeelleeeeelleelllllllllllllllll
Query qhvnndyngfegfeidgrpsvvtvrgkvavrdgqfvgekgwgkllrrepmyf  458
ident                                                     
Sbjct ----------------------------------------------asiegh  358
DSSP  ----------------------------------------------llllll


No 34: Query=1gkpA Sbjct=4ofcA Z-score=17.2

back to top
DSSP  leeeelleeeelleeeeleeeelllllleeellllllllleeeelllleeeeLEEEEEEL
Query pllikngeiitadsrykadiyaegetitrigqnleappgtevidatgkyvfpGFIDPHVH   60
ident                                                       || | |
Sbjct ----------------------------------------------------MKIDIHSH    8
DSSP  ----------------------------------------------------LLEEEEEE


DSSP  LLL--------------eELLE------------------ELLL--LHHHHHHHHHHLLE
Query IYL--------------pFMAT------------------FAKD--THETGSKAALMGGT   86
ident |                                               |         | 
Sbjct ILPkewpdlkkrfgyggwVQLQhhskgeakllkdgkvfrvVRENcwDPEVRIREMDQKGV   68
DSSP  LLLlllllhhhhhlllllEEEEeeelleeeeeelleeeeeEEHHhlLHHHHHHHHHHHLL


DSSP  EEEEEEEL--LLLL--------LLHHHHHHHHHHHHLLLllLEEEEEEELLLLL-LLHHH
Query TTYIEMCC--PSRN--------DDALEGYQLWKSKAEGNsyCDYTFHMAVSKFD-EKTEG  135
ident |                                |                     |    
Sbjct TVQALSTVpvMFSYwakpedtlNLCQLLNNDLASTVVSY-pRRFVGLGTLPMQApELAVK  127
DSSP  LEEEEELLhhHHLLlllhhhhhHHHHHHHHHHHHHHHHL-lLLEEEEELLLLLLhHHHHH


DSSP  HHHHHHHL-LLLEEEEEELLLLllllLHHHhHHHHHHHHHHLLEEEEEEllhhhhhhHHH
Query QLREIVAD-GISSFXIFLSYKNffgvDDGEmYQTLRLAKELGVIVTAHCenaelvgrLQQ  194
ident      |   |     |                     |  |      |            
Sbjct EMERCVKElGFPGVQIGTHVNEwdlnAQEL-FPVYAAAERLKCSLFVHP-----wdmQMD  181
DSSP  HHHHHHHLlLLLEEEEELEELLeellLHHH-HHHHHHHHHHLLEEEEEL-----lllLLL


DSSP  HHhhllllLHHHLL-llLLHHHHHHHHHHHH--HHHHHHL-LEEEELLLLLhHHHH----
Query KLlsegktGPEWHE-psRPEAVEAEGTARFA--TFLETTG-ATGYVVHLSCkPALD----  246
ident            |        |               |          |            
Sbjct GR-----mAKYWLPwlvGMPAETTIAICSMImgGVFEKFPkLKVCFAHGGG-AFPFtvgr  235
DSSP  HH-----hHLLLHHhhlHHHHHHHHHHHHHHllLHHHHLLlLLEEELHHHL-LHHHhhhh


DSSP  ------------------hhHHHHhlllLEEEEEehHHHHllhhhhhllhhhhhllllll
Query ------------------aaMAAKargvPIYIESviPHFLldktyaerggveamkyimsp  288
ident                               |                             
Sbjct ishgfsmrpdlcaqdnpmnpKKYL---gSFYTDA--LVHD--------------------  270
DSSP  hhhhhhhlhhhhlllllllhHHHL---lLLEEEL--LLLL--------------------


DSSP  lllllhhHHHHHHHHH--LLLLLEEELLLLLllhhhhhhhlllhhhlllLLLLllLHHHH
Query plrdkrnQKVLWDALA--QGFIDTVGTDHCPfdteqkllgkeaftaipnGIPAieDRVNL  346
ident           |              |||                               |
Sbjct -------PLSLKLLTDviGKDKVILGTDYPF------------------PLGE-lEPGKL  304
DSSP  -------HHHHHHHHHhhLLLLEELLLLLLL------------------LLLL-lLLLHH


DSSP  HhHHHLlllLLLHHHHHHHHLHHHHHHLLLLLLLlllllllllleeeeelllleellhhh
Query LyTYGVsrgRLDIHRFVDAASTKAAKLFGLFPRKgtiavgsdadlvvydpqyrgtisvkt  406
ident            |           |    ||                              
Sbjct I-ESME---EFDEETKNKLKAGNALAFLGLERKQ--------------------------  334
DSSP  H-HHLL---LLLHHHHHHHHLHHHHHHHLLLHHH--------------------------


DSSP  llllllllllllleelleeeeeeelleeeeelleelllllllllllllllll
Query qhvnndyngfegfeidgrpsvvtvrgkvavrdgqfvgekgwgkllrrepmyf  458
ident                                                     
Sbjct ---------------------------------------------------f  335
DSSP  ---------------------------------------------------l


No 35: Query=1gkpA Sbjct=2imrA Z-score=17.1

back to top
DSSP  --LEEEElLEEEElLEEEELEEEELLLLLLEE--ELLL--LLLLlLEEEELLlLEEEELE
Query --PLLIKnGEIITaDSRYKADIYAEGETITRI--GQNL--EAPPgTEVIDATgKYVFPGF   54
ident   | |                    |||         |    |       |      |  
Sbjct htPRLLT-CDVLYtGAQSPGGVVVVGETVAAAghPDELrrQYPH-AAEERAG-AVIAPPP   57
DSSP  llEEEEE-ELEEElLEELLEEEEEELLEEEEEelHHHHhhHLLL-LEEEELL-LEELLLL


DSSP  EEEEELLLLEEL-----------------lEELL--lLHHHHHHHHHHLLEEEEEEEELl
Query IDPHVHIYLPFM-----------------aTFAK--dTHETGSKAALMGGTTTYIEMCCp   95
ident    | |                                   |       |          
Sbjct VNAHTHLDMSAYefqalpyfqwipevvirgRHLRgvaAAQAGADTLTRLGAGGVGDIVW-  116
DSSP  LEEEEELLLLHHhhhhlhhhhllhhhhhhhLLLLhhhHHHHHHHHHHHLLLLLEEEEEL-


DSSP  lllllhhhhHHHHHHHHLLLLLLEEEEEEELLL--------LLLLHHHHHHHHHHLL---
Query srnddalegYQLWKSKAEGNSYCDYTFHMAVSK--------FDEKTEGQLREIVADG---  144
ident                          |    |                  |          
Sbjct ---------APEVMDALLAREDLSGTLYFEVLNpfpdkadeVFAAARTHLERWRRLErpg  167
DSSP  ---------LHHHHHHHHLLLLLLEEEEEEELLllhhhhhhHHHHHHHHHHHHHLLLlll


DSSP  -LLEEE-EEELlllllLLLHHHHHHHHHHHHHHLLEEEEEEL-----------lhhHHHH
Query -ISSFX-IFLSyknffGVDDGEMYQTLRLAKELGVIVTAHCE-----------naeLVGR  191
ident                  |    |      |   |     |                    
Sbjct lRLGLSpHTPF-----TVSHRLMRLLSDYAAGEGLPLQIHVAehptelemfrtgggPLWD  222
DSSP  eEEEEEeLLLL-----LLLHHHHHHHHHHHHHHLLLLEEEELllhhhhhhhhhlllLLHH


DSSP  HHHHhhhlllllhhhllllllhhhhhHHHHHHH--HHHHhhlLEEEELLLLLHHhhHHHH
Query LQQKllsegktgpewhepsrpeaveaEGTARFA--TFLEttgATGYVVHLSCKPalDAAM  249
ident                                      |    |    ||       |   
Sbjct NRMP---alyphtlaevigrepgpdlTPVRYLDelGVLA---ARPTLVHMVNVT-pDDIA  275
DSSP  HLLH---hhllllhhhhhllllllllLHHHHHHhhLLHH---HLLEEEELLLLL-hHHHH


DSSP  HHHHllLLEEEEEEHHHHHLlhhhhhllhhhhhllllllLLLLlhhhhhHHHHHHL-LLL
Query AAKArgVPIYIESVIPHFLLdktyaerggveamkyimspPLRDkrnqkvLWDALAQ-GFI  308
ident                                                   | | |  |  
Sbjct RVAR--AGCAVVTCPRSNHH-------------------LECG----tfDWPAFAAaGVE  310
DSSP  HHHH--HLLLEEELHHHHHH-------------------LLLL----llLHHHHHHlLLL


DSSP  LEEELLLLLllhhhhhhhlllhhhlllLLLLLlLHHHHHHHhHLLL-LLLLHHHHHHHHL
Query DTVGTDHCPfdteqkllgkeaftaipnGIPAIeDRVNLLYTyGVSR-GRLDIHRFVDAAS  367
ident    |||                                           ||    | || 
Sbjct VALGTDSVA------------------SGETL-NVREEVTF-ARQLyPGLDPRVLVRAAV  350
DSSP  EEELLLLHH------------------HHLLL-LLHHHHHH-HHHHlLLLLHHHHHHHHH


DSSP  HHHHHHLLlllllLLLLL-LLLL-lEEEEelllleellhhhllllllllllllleelleE
Query TKAAKLFGlfprkGTIAV-GSDA-dLVVYdpqyrgtisvktqhvnndyngfegfeidgrP  425
ident        |           |                                        
Sbjct KGGQRVVG-----TPFLRrGETWqeGFRW------------------------------E  375
DSSP  HHHHHHHL-----LLLLLlLLLLlhHHLH------------------------------H


DSSP  EEEeelleeeeelleelllllllllllllllll
Query SVVtvrgkvavrdgqfvgekgwgkllrrepmyf  458
ident                                  
Sbjct LSR----------------------------dl  380
DSSP  HLL----------------------------ll


No 36: Query=1gkpA Sbjct=4hk5D Z-score=16.9

back to top
DSSP  leeeelleeeelleeeeleeeelllllleeellllllllleeeelllleeEELEEEEEEL
Query pllikngeiitadsrykadiyaegetitrigqnleappgtevidatgkyvFPGFIDPHVH   60
ident                                                    |   | | |
Sbjct --------------------------------------------------TPVVVDIHTH   10
DSSP  --------------------------------------------------LLLLEEEEEE


DSSP  LLLE------------ELLE-----------------------------------ELLL-
Query IYLP------------FMAT-----------------------------------FAKD-   72
ident  | |                                                        
Sbjct MYPPsyiamlekrqtiPLVRtfpqadeprlillsselaaldaaladpaaklpgrpLSTHf   70
DSSP  ELLHhhhhhhhlllllLEEEeelleeeeeeellhhhhhhhhhhhhlllllllleeLLHHh


DSSP  -LHHHHHHHHHHLLEEEEEEEE--lLLLLL-------LHHHHHHHHHHHHLLLlllEEEE
Query -THETGSKAALMGGTTTYIEMC--cPSRND-------DALEGYQLWKSKAEGNsycDYTF  122
ident              |                        |                    |
Sbjct aSLAQKMHFMDTNGIRVSVISLanpWFDFLapdeapgIADAVNAEFSDMCAQH-vgRLFF  129
DSSP  lLHHHHHHHHHHLLLLEEEEEElllLLLLLllllhhhHHHHHHHHHHHHHHLL-llLEEE


DSSP  EEELLL--lLLLHHHHHHHHHHLL-LLEEEEEElllllLLLL----HHHHHHHHHHHHHH
Query HMAVSK--fDEKTEGQLREIVADG-ISSFXIFLsyknfFGVD----DGEMYQTLRLAKEL  175
ident   |                                    |      |             
Sbjct FAALPLsapVDAVKASIERVKNLKyCRGIILGT-----SGLGkgldDPHLLPVFEAVADA  184
DSSP  EEELLLlllHHHHHHHHHHHHLLLlEEEEEELL-----LLLLllllLHHHHHHHHHHHHL


DSSP  LLEEEEEELLhhhHHHHhHHHHhLLLLLHHhLLLL---LLHHHHHHHHHHHH--HHHHHH
Query GVIVTAHCENaelVGRLqQKLLsEGKTGPEwHEPS---RPEAVEAEGTARFA--TFLETT  230
ident    |  |                        |                ||          
Sbjct KLLVFLHPHY---GLPN-EVYG-PRSEEYG-HVLPlalGFPMETTIAVARMYmaGVFDHV  238
DSSP  LLEEEELLLL---LLLH-HHHL-LLHHHLL-LHHHhhlHHHHHHHHHHHHHHhlLHHHHL


DSSP  L-LEEEELLLLLhHHHH--------------------------hhHHHHHllLLEEEEEE
Query G-ATGYVVHLSCkPALD--------------------------aaMAAKArgVPIYIESV  263
ident         |                                             ||   |
Sbjct RnLQMLLAHSGG-TLPFlagriescivhdghlvktgkvpkdrrtiWTVLK--EQIYLDAV  295
DSSP  LlLLEEEHHHHL-LHHHhhhhhhhhhhllhhhhhllllllllllhHHHHH--HLEEEELL


DSSP  hhHHHLlhhhhhllhhhhhlllllllllllhhhHHHHHHH--hLLLLLEEELLLLlllhh
Query ipHFLLdktyaerggveamkyimspplrdkrnqKVLWDAL--aQGFIDTVGTDHCpfdte  321
ident                                    |  |           ||||      
Sbjct --IYSE---------------------------VGLQAAIassGADRLMFGTDHP-----  321
DSSP  --LLLH---------------------------HHHHHHHhhhLHHHEELLLLLL-----


DSSP  hhhhhlllhhhlllLLLL-------lLLHHHHHHHHHLllLLLL--HHHHHHHHLHHHHH
Query qkllgkeaftaipnGIPA-------iEDRVNLLYTYGVsrGRLD--IHRFVDAASTKAAK  372
ident                 |          |   |                         |  
Sbjct --------------FFPPieedvqgpWDSSRLNAQAVI--KAVGegSSDAAAVMGLNAVR  365
DSSP  --------------LLLLllllllllLHHHHHHHHHHH--HHHLllLHHHHHHHLHHHHH


DSSP  HLLLLLLLlllllLLLLleeeeelllleellhhhllllllllllllleelleeeeeeell
Query LFGLFPRKgtiavGSDAdlvvydpqyrgtisvktqhvnndyngfegfeidgrpsvvtvrg  432
ident    |                                                        
Sbjct VLSLKAEL-----EHHH-------------------------------------------  377
DSSP  HLLLHHHH-----HHHH-------------------------------------------


DSSP  eeeeelleelllllllllllllllll
Query kvavrdgqfvgekgwgkllrrepmyf  458
ident                           
Sbjct -----------------------hhh  380
DSSP  -----------------------hhl


No 37: Query=1gkpA Sbjct=2ffiA Z-score=16.8

back to top
DSSP  leeeelleeeelleeeeleeeelllllleeellllllllleeeelllleeeELEEEEEEL
Query pllikngeiitadsrykadiyaegetitrigqnleappgtevidatgkyvfPGFIDPHVH   60
ident                                                       || | |
Sbjct -------------------------------------------------lhLTAIDSHAH   11
DSSP  -------------------------------------------------llLLLEELLLL


DSSP  LL-------leELLEE-LLLLHHHHHHHHHHLLEEEEEEEELLLllllhhhHHHHHHHHH
Query IY-------lpFMATF-AKDTHETGSKAALMGGTTTYIEMCCPSrnddaleGYQLWKSKA  112
ident                                 |                        |  
Sbjct VFsrglnlasqRRYAPnYDAPLGDYLGQLRAHGFSHGVLVQPSF----lgtDNRYLLSAL   67
DSSP  LLlhhhhhhllLLLLLlLLLLHHHHHHHHHHLLLLEELLLLLHH----hllLLHHHHHHH


DSSP  LLLlllEEEEEEELlLLLLlHHHHHHHHHHLLLLEEEEEELLLLllLLLH--HHHHHHHH
Query EGNsycDYTFHMAVsKFDEkTEGQLREIVADGISSFXIFLSYKNffGVDD--GEMYQTLR  170
ident                  |      | |    |       |        |         | 
Sbjct QTV-pgQLRGVVXL-ERDV-EQATLAEXARLGVRGVRLNLXGQD--XPDLtgAQWRPLLE  122
DSSP  HHL-llLLLLLLLL-LLLL-LHHHHHHHHLLLLLEEELLLLLLL--LLLLllLLLHHHHH


DSSP  HHHHHLLEEEEEELlhhhhhhhhhhhhhlllllhhhllllllhhhHHHHhHHHHHHHHHH
Query LAKELGVIVTAHCEnaelvgrlqqkllsegktgpewhepsrpeavEAEGtARFATFLETT  230
ident    | |  |  |                                  |         |   
Sbjct RIGEQGWHVELHRQ-------------------------------VADI-PVLVRALQPY  150
DSSP  HHHHHLLEEEELLL-------------------------------LLLH-HHHHHHHLLL


DSSP  LLEEEELL-LLLH-------HHHHHH-HHHHhlLLLEEEEEEHHHhhllhhhhhllhhhh
Query GATGYVVH-LSCK-------PALDAA-MAAKarGVPIYIESVIPHflldktyaerggvea  281
ident |      |            |                                       
Sbjct GLDIVIDHfGRPDarrglgqPGFAELlTLSG--RGKVWVKVSGIY---------------  193
DSSP  LLLEEELHhHLLLlllllllLLHHHHlLLLL--LLLEEEEEELHH---------------


DSSP  hllllllLLLLL-----HHHHHHHHHHHLLL---lLEEELLLLLllhhhhhhhlllhhhl
Query mkyimspPLRDK-----RNQKVLWDALAQGF---iDTVGTDHCPfdteqkllgkeaftai  333
ident         |                ||           | |                   
Sbjct -------RLQGSpeenlAFARQALCALEAHYgaerLXWGSDWPH----------------  230
DSSP  -------HLLLLhhhhhHHHHHHHHHHHHHLlhhhEEEELLLLL----------------


DSSP  LLLL--LLLLLHHHHHHHHHlllllLLHHHHHHHHLHHHHHHLLLLLLllllllllllle
Query PNGI--PAIEDRVNLLYTYGvsrgrLDIHRFVDAASTKAAKLFGLFPRkgtiavgsdadl  391
ident             |      |                  |  |||                
Sbjct TQHEseVSFGSAVEQFEALG-----CSAQLRQALLLDTARALFGFELE------------  273
DSSP  LLLLllLLHHHHHHHHHHHL-----LLHHHHHHHHLHHHHHHLLLLLL------------


DSSP  eeeelllleellhhhllllllllllllleelleeeeeeelleeeeelleellllllllll
Query vvydpqyrgtisvktqhvnndyngfegfeidgrpsvvtvrgkvavrdgqfvgekgwgkll  451
ident                                                             
Sbjct ------------------------------------------------------------  273
DSSP  ------------------------------------------------------------


DSSP  lllllll
Query rrepmyf  458
ident        
Sbjct -------  273
DSSP  -------


No 38: Query=1gkpA Sbjct=4qrnA Z-score=16.7

back to top
DSSP  leeeelleeeelleeeeleeeelllllleeellllllllleeeellllEEEELEEEEEEL
Query pllikngeiitadsrykadiyaegetitrigqnleappgtevidatgkYVFPGFIDPHVH   60
ident                                                       |     
Sbjct --------------------------------------smtqdlktggEQGYLRIATEEA   22
DSSP  --------------------------------------llllllllllLLLLLLEEEEEE


DSSP  lLLEE----------------------LLEE-----------LLLL---HHHHHHHHHHL
Query iYLPF----------------------MATF-----------AKDT---HETGSKAALMG   84
ident                                                   |         
Sbjct -FATReiidvylrmirdgtadkgmvslWGFYaqspseratqiLERLldlGERRIADMDAT   81
DSSP  -ELLHhhhhhhhhhhhhllllhhhhhhHHHHhhlllhhhhhhHHHHhllLHHHHHHHHHL


DSSP  LEEEEEEEEL--LLLL--------LLHHHHHHHHHHHHLLLllLEEEEEEELLLLL-LLH
Query GTTTYIEMCC--PSRN--------DDALEGYQLWKSKAEGNsyCDYTFHMAVSKFD-EKT  133
ident |    |                    |                        |   | |  
Sbjct GIDKAILALTspGVQPlhdldearTLATRANDTLADACQKY-pDRFIGMGTVAPQDpEWS  140
DSSP  LLLEEEEEELllLLLLlllhhhhhHHHHHHHHHHHHHHHHL-lLLEEELLLLLLLLhHHH


DSSP  HHHHHHHHHL-LLLEEEEEELLLLllllLHHHhHHHHHHHHHHLLEEEEEEllhhHHHHH
Query EGQLREIVAD-GISSFXIFLSYKNffgvDDGEmYQTLRLAKELGVIVTAHCenaeLVGRL  192
ident            |     |                   |   |       |          
Sbjct AREIHRGARElGFKGIQINSHTQGryldEEFF-DPIFRALVEVDQPLYIHP--atSPDSM  197
DSSP  HHHHHHHHHLlLLLLEEELLLLLLllllLHHH-HHHHHHHHHHLLLEEELL--llLLLLL


DSSP  HHHhhhlllllHHHLL--llLLHHHHHHHHHHHH--HHHHHHL-LEEEELLLLLHhHHHH
Query QQKllsegktgPEWHE--psRPEAVEAEGTARFA--TFLETTG-ATGYVVHLSCKpALDA  247
ident                                |                | |         
Sbjct IDP------mlEAGLDgaifGFGVETGMHLLRLItiGIFDKYPsLQIMVGHMGEA-LPYW  250
DSSP  LHH------hhHHLLLllllHHHHHHHHHHHHHHhhLHHHHLLlLLEEELHHHHL-HHHH


DSSP  --------------------------hHHHHHllLLEEEEEEhHHHHllhhhhhllhhhh
Query --------------------------aMAAKArgVPIYIESViPHFLldktyaerggvea  281
ident                                                             
Sbjct lyrldymhqagvrsqryermkplkktiEGYLK--SNVLVTNS-GVAW-------------  294
DSSP  hhhhhhhhhhhhhlllllllllllllhHHHHH--HLEEEELL-LLLL-------------


DSSP  hlllllllllllhhHHHHHHHHH--LLLLLEEELLLLlllhhhhhhhlllhhhlllLLLL
Query mkyimspplrdkrnQKVLWDALA--QGFIDTVGTDHCpfdteqkllgkeaftaipnGIPA  339
ident                                   |                         
Sbjct --------------EPAIKFCQQvmGEDRVMYAMDYP-------------------YQYV  321
DSSP  --------------HHHHHHHHHhhLHHHEELLLLLL-------------------LLLL


DSSP  lLLHHHHHHHHhllllLLLHHHHHHHHLHHHHHHLLLlllllllllllllleeeeellll
Query iEDRVNLLYTYgvsrgRLDIHRFVDAASTKAAKLFGLfprkgtiavgsdadlvvydpqyr  399
ident   | |                       | | | | |                       
Sbjct -ADEVRAMDAM-----DMSAQTKKKFFQTNAEKWFKL-----------------------  352
DSSP  -HHHHHHHHLL-----LLLHHHHHHHHLHHHHHHLLL-----------------------


DSSP  eellhhhllllllllllllleelleeeeeeelleeeeelleelllllllllllllllll
Query gtisvktqhvnndyngfegfeidgrpsvvtvrgkvavrdgqfvgekgwgkllrrepmyf  458
ident                                                            
Sbjct -----------------------------------------------------------  352
DSSP  -----------------------------------------------------------


No 39: Query=1gkpA Sbjct=2y1hB Z-score=16.7

back to top
DSSP  leeeelleeeelleeeeleeeelllllleeellllllllleeeelllleeEELEEEEEEL
Query pllikngeiitadsrykadiyaegetitrigqnleappgtevidatgkyvFPGFIDPHVH   60
ident                                                     |  | | |
Sbjct --------------------------------------------------GVGLVDCHCH   10
DSSP  --------------------------------------------------LLLEEEEEEL


DSSP  LLLeelleELLL-LHHHHHHHHHHLLEEEEEEEELLlllllhHHHHHHHHHHHLLLLllE
Query IYLpfmatFAKD-THETGSKAALMGGTTTYIEMCCPsrnddaLEGYQLWKSKAEGNSycD  119
ident            |         |                               |      
Sbjct LSA-----PDFDrDLDDVLEKAKKANVVALVAVAEH------SGEFEKIMQLSERYN-gF   58
DSSP  LLL-----HHHLlLHHHHHHHHHHLLEEEEEELLLL------HHHHHHHHHHHHHLL-lL


DSSP  EEEEEELL-------------LLLLlHHHHHHHHHhLLLLEE-EEEELLL-------lll
Query YTFHMAVS-------------KFDEkTEGQLREIVaDGISSF-XIFLSYK-------nff  158
ident       |                |            |         |             
Sbjct VLPCLGVHpvqgldqrsvtlkDLDV-ALPIIENYK-DRLLAIgEVGLDFSprfagtgeqk  116
DSSP  EEEEELLLleelllleellhhHHHH-HHHHHHHHL-LLLLEEeEEEEELLllllllhhhh


DSSP  llLHHHHHHHHHHHHHHLLEEEEEELLhhhhhhhhhhhhhlllllhhhllllllhhhhhh
Query gvDDGEMYQTLRLAKELGVIVTAHCENaelvgrlqqkllsegktgpewhepsrpeaveae  218
ident             ||| |   |  |                                    
Sbjct eeQRQVLIRQIQLAKRLNLPVNVHSRS---------------------------------  143
DSSP  hhHHHHHHHHHHHHHHHLLLEEEEEEL---------------------------------


DSSP  HHHHHHHHHHHHLLE-EEELLLLLHhhHHHHHHHHHllLLEEEEEEHHhHHLLhhhhhll
Query GTARFATFLETTGAT-GYVVHLSCKpaLDAAMAAKArgVPIYIESVIPhFLLDktyaerg  277
ident         |   ||                ||                            
Sbjct AGRPTINLLQEQGAEkVLLHAFDGR--PSVAMEGVR--AGYFFSIPPS-IIRS-------  191
DSSP  LHHHHHHHHHHLLLLlEEEELLLLL--HHHHHHHHH--LLLEEEELHH-HHLL-------


DSSP  hhhhhlllllllllllHHHHHHHHHHhLLLLLEEELLLLlllhhhhhhhlllhhhllLLL
Query gveamkyimspplrdkRNQKVLWDALaQGFIDTVGTDHCpfdteqkllgkeaftaipNGI  337
ident                      |   |         ||                       
Sbjct ----------------GQKQKLVKQL-PLTSICLETDSP------------algpekQVR  222
DSSP  ----------------HHHHHHHHHL-LHHHEEELLLLL------------llllllLLL


DSSP  LLLLLHHhHHHHHHLllLLLL---HHHHHHHhLHHHHHHLL-LLLLLlllllllllleee
Query PAIEDRVnLLYTYGVsrGRLD---IHRFVDAaSTKAAKLFG-LFPRKgtiavgsdadlvv  393
ident             |                      | |||  |                 
Sbjct NEPWNIS-ISAEYIA--QVKGisvEEVIEVT-TQNALKLFPkLRHLL-------------  265
DSSP  LLHHHHH-HHHHHHH--HHHLllhHHHHHHH-HHHHHHHLLlHHHHL-------------


DSSP  eelllleellhhhllllllllllllleelleeeeeeelleeeeelleellllllllllll
Query ydpqyrgtisvktqhvnndyngfegfeidgrpsvvtvrgkvavrdgqfvgekgwgkllrr  453
ident                                                             
Sbjct ------------------------------------------------------------  265
DSSP  ------------------------------------------------------------


DSSP  lllll
Query epmyf  458
ident      
Sbjct -----  265
DSSP  -----


No 40: Query=1gkpA Sbjct=4dziC Z-score=16.4

back to top
DSSP  leeeelleeeelleeeeleeeelllllleeellllllllleeeellllEEEELEEEEEEL
Query pllikngeiitadsrykadiyaegetitrigqnleappgtevidatgkYVFPGFIDPHVH   60
ident                                                       ||   |
Sbjct ------------------------------------------------ALNYRVIDVDNH   12
DSSP  ------------------------------------------------LLLLLEEEEEEE


DSSP  LLLE-------------------------------------ELLE---------------
Query IYLP-------------------------------------FMAT---------------   68
ident  | |                                                        
Sbjct YYEPldsftrhldkkfkrrgvqmlsdgkrtwavigdrvnhfIPNPtfdpiivpgcldllf   72
DSSP  LLLLlllllllllhhhlllleeeeelllleeeeelleelllLLLLlllleelllllhhhh


DSSP  ----------------------elLLLHHHHHHHHHHLLEEEEEEEE-------------
Query ----------------------faKDTHETGSKAALMGGTTTYIEMC-------------   93
ident                                          |                  
Sbjct rgeipdgvdpaslmkverladhpeYQNRDARIAVMDEQDIETAFMLPtfgcgveealkhd  132
DSSP  hllllllllhhhllleelhhhlhhHLLHHHHHHHHHHHLEEEEEEELlhhhhhhhhllll


DSSP  lllLLLLHHHHHHHHHHHHL-llllLEEEEEEELLLLL-LLHHHHHHHHHHLLLLEEEEE
Query cpsRNDDALEGYQLWKSKAE-gnsyCDYTFHMAVSKFD-EKTEGQLREIVADGISSFXIF  151
ident                                  ||  |            | |       
Sbjct ieaTMASVHAFNLWLDEDWGfdrpdHRIIAAPIVSLADpTRAVEEVDFVLARGAKLVLVR  192
DSSP  hhhHHHHHHHHHHHHHHHLLlllllLLEEELLLLLLLLhHHHHHHHHHHHHLLLLLEELL


DSSP  ELLLL----lllllHHHHHHHHHHHHHHLLEEEEEelLHHHhHHHHHHHHHlllLLHHHL
Query LSYKN----ffgvdDGEMYQTLRLAKELGVIVTAHceNAELvGRLQQKLLSegkTGPEWH  207
ident               |           | || |  |                         
Sbjct PAPVPglvkprslgDRSHDPVWARLAEAGVPVGFHlsDSGY-LHIAAAWGG---AKDPLD  248
DSSP  LLLLLlllllllllLHHHHHHHHHHHHHLLLEEEEllLLLL-HHHHHHLLL---LLLHHH


DSSP  LLLLLHHHHHHHHHHHH--HHHHHHL-LEEEELLLLLHhHHHHHHH--------------
Query EPSRPEAVEAEGTARFA--TFLETTG-ATGYVVHLSCKpALDAAMA--------------  250
ident              |                                              
Sbjct QVLLDDRAIHDTMASMIvhGVFTRHPkLKAVSIENGSY-FVHRLIKrlkkaantqpqyfp  307
DSSP  HHHHLLHHHHHHHHHHHhlLHHHHLLlLLEEEELLLLL-HHHHHHHhhhhhhhhlhhhll


DSSP  -hhHLLL--LEEEEEehhHHHLlhhhhhllhhhhhlllllllllllhhhhHHHHHH--hL
Query -akARGV--PIYIESvipHFLLdktyaerggveamkyimspplrdkrnqkVLWDAL--aQ  305
ident             |                                      |        
Sbjct edpVEQLrnNVWIAP---YYED----------------------------DLPELArviG  336
DSSP  llhHHHHhhHEEELL---LLLL----------------------------LHHHHHhhhL


DSSP  LLLLEEELLLLLllhhhhhhhlllhhhlllLLLLllLHHHHHhHHHLlllLLLHHHHHHH
Query GFIDTVGTDHCPfdteqkllgkeaftaipnGIPAieDRVNLLyTYGVsrgRLDIHRFVDA  365
ident       | |                     |       |                     
Sbjct VDKILFGSDWPH------------------GEGL-aSPVSFT-AELK---GFSESDIRKI  373
DSSP  HHHLLLLLLLLL------------------LLLL-lLHHHHH-HHHL---LLLHHHHHHH


DSSP  HLHHHHHHLLllllllllllllllleeeeelllleellhhhllllllllllllleellee
Query ASTKAAKLFGlfprkgtiavgsdadlvvydpqyrgtisvktqhvnndyngfegfeidgrp  425
ident     |  | |                                                  
Sbjct MRDNALDLLG--------------------------------------------------  383
DSSP  HLHHHHHHHL--------------------------------------------------


DSSP  eeeeelleeeeelleelllllllllllllllll
Query svvtvrgkvavrdgqfvgekgwgkllrrepmyf  458
ident                                  
Sbjct ----------------------------vqvgs  388
DSSP  ----------------------------lllll


No 41: Query=1gkpA Sbjct=4mupB Z-score=16.0

back to top
DSSP  leeeelleeeelleeeeleeeelllllleeellllllllleeeelllleeEELEEEEEEL
Query pllikngeiitadsrykadiyaegetitrigqnleappgtevidatgkyvFPGFIDPHVH   60
ident                                                     |  |   |
Sbjct ------------------------------------lvrklsgtapnpafPRGAVDTQMH   24
DSSP  ------------------------------------llllllllllllllLLLLEELLLL


DSSP  LL-------leeLLEE--lLLLHHHHHHHHHHLLEEEEEEEEL--LLLLllhhhhHHHHH
Query IY-------lpfMATF--aKDTHETGSKAALMGGTTTYIEMCC--PSRNddalegYQLWK  109
ident  |                     |         |    |        |            
Sbjct MYlpgypalpggPGLPpgaLPGPEDYRRLMQWLGIDRVIITQGnaHQRD------NGNTL   78
DSSP  LLllllllllllLLLLlllLLLHHHHHHHHHHHLLLEEEEELLhhHLLL------LHHHH


DSSP  HHHLLLLllEEEEEEELlLLLLlHHHHHHHHHHLLLLEEEEEELLLllLLLLHhHHHHHH
Query SKAEGNSycDYTFHMAVsKFDEkTEGQLREIVADGISSFXIFLSYKnfFGVDDgEMYQTL  169
ident                        ||       | |     |             |     
Sbjct ACVAEMG-eAAHAVVII-DATT-TEKDMEKLTAAGTVGARIMDLPG-gAVNLS-ELDAVD  133
DSSP  HHHHHHH-hHEEEEELL-LLLL-LHHHHHHHHHLLEEEEEEELLLL-lLLLHH-HHHHHH


DSSP  HHHHHHLLEEEEEELlhhhhhhhhhhhhhlllllhhhllllllhhHHHHhhHHHHHHHhh
Query RLAKELGVIVTAHCEnaelvgrlqqkllsegktgpewhepsrpeaVEAEgtARFATFLet  229
ident   |      |                                                  
Sbjct ERAHAADWMVAVQFD-----------------------------gNGLLdhLPRLQKI--  162
DSSP  HHHHHLLLEEEEELL-----------------------------hHHHHhhHHHHHLL--


DSSP  hLLEEEELLLL--------lhHHHHHHHHHHHlLLLEEEEEEHHHhhllhhhhhllhhhh
Query tGATGYVVHLS--------ckPALDAAMAAKArGVPIYIESVIPHflldktyaerggvea  281
ident         |            |   |                                  
Sbjct -RSRWVFDHHGkffkgirtdgPEMAALLKLID-RGNLWFKFAGVY---------------  205
DSSP  -LLEEEELHHHhlllllllllHHHHHHHHHHH-HLLEEEEELLHH---------------


DSSP  hllllllLLLL-----LHHHHHHHHHHHLLL-LLEEELLLLL--LLHHhhhhhlllhhhl
Query mkyimspPLRD-----KRNQKVLWDALAQGF-IDTVGTDHCP--FDTEqkllgkeaftai  333
ident                            |        ||                      
Sbjct -------ESSRkswpyADVAAFSRVIAAHAPeRIVWGTNWPHnsVRET------------  246
DSSP  -------HLLLlllllHHHHHHHHHHHHHLHhHEEELLLLLLllLLLH------------


DSSP  llLLLLlLLHHHHHHHHHlllllLLHHHHHHHHLHHHHHHLLLLLLllllllllllleee
Query pnGIPAiEDRVNLLYTYGvsrgrLDIHRFVDAASTKAAKLFGLFPRkgtiavgsdadlvv  393
ident             |           |      |       || | |               
Sbjct aaYPDD-ARLAELTLGWL-----PDEAARHRALVENPEALFKLSPV--------------  286
DSSP  hhLLLH-HHHHHHHHLLL-----LLHHHHHHHHLHHHHHHHLLLLL--------------


DSSP  eelllleellhhhllllllllllllleelleeeeeeelleeeeelleellllllllllll
Query ydpqyrgtisvktqhvnndyngfegfeidgrpsvvtvrgkvavrdgqfvgekgwgkllrr  453
ident                                                             
Sbjct ------------------------------------------------------------  286
DSSP  ------------------------------------------------------------


DSSP  lllll
Query epmyf  458
ident      
Sbjct -----  286
DSSP  -----


No 42: Query=1gkpA Sbjct=2qpxA Z-score=15.8

back to top
DSSP  leeeelleeeelleeeeleeeelllllleeellllllllleeeelllleeEELEEEEEEL
Query pllikngeiitadsrykadiyaegetitrigqnleappgtevidatgkyvFPGFIDPHVH   60
ident                                                        | | |
Sbjct ----------------------------------------gxddlsefvdQVPLLDHHCH   20
DSSP  ----------------------------------------lllllhhhhhHLLEEEEEEL


DSSP  LlleelleeLLLL-----------------------------------------------
Query IylpfmatfAKDT-----------------------------------------------   73
ident            |                                                
Sbjct F--------LIDGkvpnrddrlaqvsteadkdypladtknrlayhgflalakefaldann   72
DSSP  L--------LLLLllllhhhhhhhhlllllllllhhhhlllhhhhhhhhhhhhhllllll


DSSP  ----------hhhHHHHHHHLLEEEEEEEELllllllhhhhhhhhhHHHLLLL---LLEE
Query ----------hetGSKAALMGGTTTYIEMCCpsrnddalegyqlwkSKAEGNS---YCDY  120
ident                                                             
Sbjct plaaxndpgyatyNHRIFGHFHFKELLIDTG--------fvpddpiLDLDQTAelvGIPV  124
DSSP  llllllhhhhhhhHHHHHHHLLEEEEEEELL--------lllllllLLHHHHHhhhLLLE


DSSP  EEEEELLL--------------lLLLHHHHHHHHHHLLLLEEEEE-ELLL----------
Query TFHMAVSK--------------fDEKTEGQLREIVADGISSFXIF-LSYK----------  155
ident                                    | |   ||                 
Sbjct KAIYRLEThaedfxlehdnfaawWQAFSNDVKQAKAHGFVGFXSIaAYRVglhlepvnvi  184
DSSP  EEEEEHHHhhhhhhlllllhhhhHHHHHHHHHLLLLLLLLLEEELhHHHLllllllllhh


DSSP  -----------------lllllLHHHHHHHHHHHHHHLLEEEEEELlhhhhhhhhhhhhh
Query -----------------nffgvDDGEMYQTLRLAKELGVIVTAHCEnaelvgrlqqklls  198
ident                        |   |               |                
Sbjct eaaagfdtwkhsgekrltskplIDYXLYHVAPFIIAQDXPLQFHVG--------------  230
DSSP  hhhhhhhhhhhhlllllllhhhHHHHHHHHHHHHHHHLLLEEEEEL--------------


DSSP  lllllhhhlLLLLLHHHHHhhHHHHHHHHHHHL---LEEEELLLLLhhHHHHHHHHHHLL
Query egktgpewhEPSRPEAVEAegTARFATFLETTG---ATGYVVHLSCkpALDAAMAAKARG  255
ident                             |             |         |       
Sbjct -------ygDADTDXYLGN--PLLXRDYLKAFTkkgLKVVLLHCYP--YHREAGYLASVF  279
DSSP  -------llLLLLLHHHLL--HHHHHHHHHHHHhhlLLEEEEELLL--LHHHHHHHHHHL


DSSP  LLEEEEEE--HHHHHLLhhhhhllhhhhhlllllllllllhhHHHHHHHH--hLLLLLEE
Query VPIYIESV--IPHFLLDktyaerggveamkyimspplrdkrnQKVLWDAL--aQGFIDTV  311
ident    |                                        |   |           
Sbjct PNLYFDISllDNLGPSG------------------------aSRVFNEAVelaPYTRILF  315
DSSP  LLEEEELLlhHHHLHHH------------------------hHHHHHHHLlllLHHHEEL


DSSP  ELLLLLllhhhhhhhlllhhhlllllLLLLLHHHHHHHHHlLLLL---------lLHHHH
Query GTDHCPfdteqkllgkeaftaipngiPAIEDRVNLLYTYGvSRGR---------lDIHRF  362
ident   |                                                         
Sbjct ASDAST------------------ypEXYGLAARQFKQAL-VAHFnqlpfvdlaqKKAWI  356
DSSP  LLLLLL------------------lhHHHHHHHHHHHHHH-HHHHhllllllhhhHHHHH


DSSP  HHHHLHHHHHHLLLLlLLLLLllllllleeeeelllleellhhhllllllllllllleel
Query VDAASTKAAKLFGLFpRKGTIavgsdadlvvydpqyrgtisvktqhvnndyngfegfeid  422
ident         |||     |                                           
Sbjct NAICWQTSAKLYHQE-RELRV---------------------------------------  376
DSSP  HHHHLHHHHHHLLLH-HHHLL---------------------------------------


DSSP  leeeeeeelleeeeelleelllllllllllllllll
Query grpsvvtvrgkvavrdgqfvgekgwgkllrrepmyf  458
ident                                     
Sbjct ------------------------------------  376
DSSP  ------------------------------------


No 43: Query=1gkpA Sbjct=1a4mA Z-score=15.5

back to top
DSSP  leeeelleeeelleeeeleeeelllllleeellllllllleeeelllleeeELEEEEEEL
Query pllikngeiitadsrykadiyaegetitrigqnleappgtevidatgkyvfPGFIDPHVH   60
ident                                                          |||
Sbjct ----------------------------------------------tpafnKPKVELHVH   14
DSSP  ----------------------------------------------lllllLLEEEEEEE


DSSP  LLL-------------------------------------------eELLEE--------
Query IYL-------------------------------------------pFMATF--------   69
ident                                                |            
Sbjct LDGaikpetilyfgkkrgialpadtveelrniigmdkplslpgflakFDYYMpviagcre   74
DSSP  HHHlllhhhhhhhhhhhllllllllhhhhhhhhlllllllhhhhhllHHHHHhhhlllhh


DSSP  ----lllLHHHHHHHHHhllEEEEEEEELLLLLL----------------LHHHHHHHHH
Query ----akdTHETGSKAALmggTTTYIEMCCPSRND----------------DALEGYQLWK  109
ident                              |                           |  
Sbjct aikriayEFVEMKAKEG---VVYVEVRYSPHLLAnskvdpmpwnqtegdvTPDDVVDLVN  131
DSSP  hhhhhhhHHHHHHHHLL---EEEEEEEELLHHHLlllllllhhhllllllLHHHHHHHHH


DSSP  HHHLLLL---LLEEEEEEELL--LLLL--LHHHHHHHHHHLLLLEEEEE-ELLLlllLLL
Query SKAEGNS---YCDYTFHMAVS--KFDE--KTEGQLREIVADGISSFXIF-LSYKnffGVD  161
ident                                                             
Sbjct QGLQEGEqafGIKVRSILCCMrhQPSWslEVLELCKKYNQKTVVAMDLAgDETI-egSSL  190
DSSP  HHHHHHHhhhLLEEEEEEEEEllLHHHhhHHHHHHHHLLLLLEEEEEEElLLLL-llHHH


DSSP  HHHHHHHHHHHHHHLLEEEEEELlhhhhhhhhhhhhhlllllhhhllllllhhHHHHHHH
Query DGEMYQTLRLAKELGVIVTAHCEnaelvgrlqqkllsegktgpewhepsrpeaVEAEGTA  221
ident           |   |   | |                                   |   
Sbjct FPGHVEAYEGAVKNGIHRTVHAG----------------------------evGSPEVVR  222
DSSP  LHHHHHHHHHHHHHLLEEEEEEL----------------------------llLLHHHHH


DSSP  HHHHHHhhhlLEEEELLLLlhHHHH---HHHHHHHLlllEEEEEEHHhhhllhhhhhllh
Query RFATFLettgATGYVVHLSckPALD---AAMAAKARgvpIYIESVIPhflldktyaergg  278
ident      |     |  | |                         |                 
Sbjct EAVDIL----KTERVGHGY--HTIEdeaLYNRLLKE--nMHFEVCPW-------------  261
DSSP  HHHHLL----LLLEEEELH--HHHHlhhHHHHHHHL--lLEEEELHH-------------


DSSP  hhhhllLLLLlLLLLHHHhHHHHHHHLLLLLEEELLLLLLlhhhhhhhlllhhhlllLLL
Query veamkyIMSPpLRDKRNQkVLWDALAQGFIDTVGTDHCPFdteqkllgkeaftaipnGIP  338
ident               |                   ||                        
Sbjct ---ssyLTGA-WDPKTTH-AVVRFKNDKANYSLNTDDPLI-----------------FKS  299
DSSP  ---hhhHLLL-LLLLLLL-HHHHHHHLLLLEEELLLLLLL-----------------LLL


DSSP  LLLLHHHHHHHHHLllllLLHHHHHHHhLHHHHHHLLL----LLLLL--LLLLlllllee
Query AIEDRVNLLYTYGVsrgrLDIHRFVDAaSTKAAKLFGL----FPRKG--TIAVgsdadlv  392
ident                        |       |||   |                      
Sbjct TLDTDYQMTKKDMG----FTEEEFKRL-NINAAKSSFLpeeeKKELLerLYRE-------  347
DSSP  LHHHHHHHHHHLLL----LLHHHHHHH-HHHHHHLLLLlhhhHHHHHhhHHHH-------


DSSP  eeelllleellhhhllllllllllllleelleeeeeeelleeeeelleelllllllllll
Query vydpqyrgtisvktqhvnndyngfegfeidgrpsvvtvrgkvavrdgqfvgekgwgkllr  452
ident                                                             
Sbjct ------------------------------------------------------------  347
DSSP  ------------------------------------------------------------


DSSP  llllll
Query repmyf  458
ident       
Sbjct ----yq  349
DSSP  ----ll


No 44: Query=1gkpA Sbjct=1itqA Z-score=15.1

back to top
DSSP  leeeelleeeelleeeeleeeelllllleeellllllllleeeelllleeEELEEEEEEL
Query pllikngeiitadsrykadiyaegetitrigqnleappgtevidatgkyvFPGFIDPHVH   60
ident                                                       || |  
Sbjct --------------------------------------dffrdeaerimrDSPVIDGHND   22
DSSP  --------------------------------------lhhhhhhhhhhlLLLEEEEEEL


DSSP  LLL--EELLEE----------llllhhhHHHHHHHLLEEEEEEEELLL-------LLLLH
Query IYL--PFMATF----------akdthetGSKAALMGGTTTYIEMCCPS-------RNDDA  101
ident        |                           |                        
Sbjct LPWqlLDMFNNrlqderanlttlagthtNIPKLRAGFVGGQFWSVYTPcdtqnkdAVRRT   82
DSSP  HHHhhHHHHLLllllhhhllllllllllLHHHHHHLLEEEEEEEELLLhhhllllHHHHH


DSSP  HHHHHHHHHHHL-LLLL------------------LEEEEEEE-LLLLLllHHHHHHHHH
Query LEGYQLWKSKAE-GNSY------------------CDYTFHMA-VSKFDekTEGQLREIV  141
ident ||                                              |    | ||   
Sbjct LEQMDVVHRMCRmYPETflyvtssagirqafregkVASLIGVEgGHSID-sSLGVLRALY  141
DSSP  HHHHHHHHHHHHhLLLLeeelllhhhhhhhhhlllEEEEEEEElHHHLL-lLHHHHHHHH


DSSP  HLLLLEEEEEELLllllLLLH-------------------HHHHHHHHHHHHHLLEEEEE
Query ADGISSFXIFLSYknffGVDD-------------------GEMYQTLRLAKELGVIVTAH  182
ident   |        |                                        |||     
Sbjct QLGMRYLTLTHSC----NTPWadnwlvdtgdsepqsqglsPFGQRVVKELNRLGVLIDLA  197
DSSP  HLLEEEEELLLLL----LLLLlllhhhlllllllllllllHHHHHHHHHHHHHLLEEELL


DSSP  ELlhhhhhhhhhhhhhlllllhhhllllllhhhhhhHHHHHHHHHHHHLLEEEELLLLLH
Query CEnaelvgrlqqkllsegktgpewhepsrpeaveaeGTARFATFLETTGATGYVVHLSCK  242
ident                                       |     |    |     | |  
Sbjct HV----------------------------------SVATMKATLQLSRAPVIFSHSSAY  223
DSSP  LL----------------------------------LHHHHHHHHHHLLLLLEELLLLLL


DSSP  H-------HHHHHHHHHHlLLLEEEEEEHHhhhLLHHHHhllhhhhhlllllllllllhH
Query P-------ALDAAMAAKArGVPIYIESVIPhflLDKTYAerggveamkyimspplrdkrN  295
ident           |                         |                       
Sbjct SvcasrrnVPDDVLRLVK-QTDSLVMVNFYnnyISCTNK----------------anlsQ  266
DSSP  LlllllllLLHHHHHHHH-HHLLEEEELLLhhhHLLLLL----------------llhhH


DSSP  HHHHHHHHHL---LLLLEEELLLLlllhhhhhhhlllhhhllLLLL-----LLLLhHHHH
Query QKVLWDALAQ---GFIDTVGTDHCpfdteqkllgkeaftaipNGIP-----AIEDrVNLL  347
ident      |             | |                                     |
Sbjct VADHLDHIKEvagARAVGFGGDFD-----------------gVPRVpegleDVSK-YPDL  308
DSSP  HHHHHHHHHHhllHHHEEELLLLL-----------------lLLLLlllllLLLL-HHHH


DSSP  HHHHLlLLLLLHHHHHHHHLHHHHHHLLllllllllllllllleeeeelllleellhhhl
Query YTYGVsRGRLDIHRFVDAASTKAAKLFGlfprkgtiavgsdadlvvydpqyrgtisvktq  407
ident       |          |        |                                 
Sbjct IAELL-RRNWTEAEVKGALADNLLRVFE--------------------------------  335
DSSP  HHHHH-HLLLLHHHHHHHHLHHHHHHHH--------------------------------


DSSP  lllllllllllleelleeeeeeelleeeeelleelllllllllllllLLLL---------
Query hvnndyngfegfeidgrpsvvtvrgkvavrdgqfvgekgwgkllrrePMYF---------  458
ident                                                             
Sbjct ---------------------------------------------avEQASnltqapeee  350
DSSP  ---------------------------------------------hhHHLLlllllllll


DSSP  -------------------
Query -------------------  458
ident                    
Sbjct pipldqlggscrthygyss  369
DSSP  lllhhhlllllllllllll


No 45: Query=1gkpA Sbjct=3gg7A Z-score=15.1

back to top
DSSP  leeeelleeeelleeeeleeeelllllleeellllllllleeeelllleeeeLEEEEEEL
Query pllikngeiitadsrykadiyaegetitrigqnleappgtevidatgkyvfpGFIDPHVH   60
ident                                                       || |||
Sbjct ----------------------------------------------------SLIDFHVH    8
DSSP  ----------------------------------------------------LLEEEEEL


DSSP  LLLeelleeLLLLHhHHHHHHHHLLEeEEEEEELLlllllhHHHHHHHHHHHLLllLLEE
Query IYLpfmatfAKDTHeTGSKAALMGGTtTYIEMCCPsrnddaLEGYQLWKSKAEGnsYCDY  120
ident   |        |       |       |                       | |      
Sbjct LDL------YPDPV-AVARACEERQL-TVLSVTTT------PAAWRGTLALAAG--RPHV   52
DSSP  HHH------LLLHH-HHHHHHHHLLL-EEEELLLL------HHHHHHHHHHHLL--LLLE


DSSP  EEEEELL-----llLLLHhHHHHHHHHlLLLEEE-EEEL----LLLLlllLHHHHHHHHH
Query TFHMAVS-----kfDEKTeGQLREIVAdGISSFX-IFLS----YKNFfgvDDGEMYQTLR  170
ident                                      |                    ||
Sbjct WTALGFHpevvserAADL-PWFDRYLP-ETRFVGeVGLDgspsLRGTwtqQFAVFQHILR  110
DSSP  EELLLLLhhhllllHHHL-HHHHHHHH-HLLEEEeEELLllhhHHHHhhhHHHHHHHHHH


DSSP  HHHHH-LLEEEEEELLhhhhhhhhhhhhhlllllhhhllllllhhhhhhHHHHHHHHHHH
Query LAKEL-GVIVTAHCENaelvgrlqqkllsegktgpewhepsrpeaveaeGTARFATFLET  229
ident       | |   |                                            || 
Sbjct RCEDHgGRILSIHSRR---------------------------------AESEVLNCLEA  137
DSSP  HHHHLlLEEEEEELLL---------------------------------LHHHHHHHHHH


DSSP  -HLLE-EEELLLLLHHhhHHHHHHHHllLLEEEEEEHHHHHLlhhhhhllhhhhhlllll
Query -TGAT-GYVVHLSCKPalDAAMAAKArgVPIYIESVIPHFLLdktyaerggveamkyims  287
ident             |          |                                    
Sbjct nPRSGtPILHWYSGSV--TELRRAIS--LGCWFSVGPTMVRT------------------  175
DSSP  lHHHEeEEEELLLLLH--HHHHHHHH--LLLEEEELHHHHLL------------------


DSSP  llllllHHHHHHHHHHhLLLLLEEELLLLLllhhhhhhhlllhhhllllLLLLLLHHHHH
Query pplrdkRNQKVLWDALaQGFIDTVGTDHCPfdteqkllgkeaftaipngIPAIEDRVNLL  347
ident            |             ||                           |     
Sbjct ------QKGAALIRSM-PRDRVLTETDGPF-------------leldgqAALPWDVKSVV  215
DSSP  ------HHHHHHHHHL-LHHHEEELLLLLL-------------leelleELLHHHHHHHH


DSSP  HhHHLLlLLLL-HHHHHHHhLHHHHHHLLllllllllllllllleeeeelllleellhhh
Query YtYGVSrGRLD-IHRFVDAaSTKAAKLFGlfprkgtiavgsdadlvvydpqyrgtisvkt  406
ident                           | |                               
Sbjct E-GLSKiWQIPaSEVERIV-KENVSRLLG-------------------------------  242
DSSP  H-HHHHhHLLLhHHHHHHH-HHHHHHHHH-------------------------------


DSSP  llllllllllllleelleeeeeeelleeeeelleelllllllllllllllll
Query qhvnndyngfegfeidgrpsvvtvrgkvavrdgqfvgekgwgkllrrepmyf  458
ident                                                     
Sbjct ---------------------------------------------------t  243
DSSP  ---------------------------------------------------l


No 46: Query=1gkpA Sbjct=2gwgA Z-score=14.6

back to top
DSSP  leeeelleeeelleeeeleeeelllllleeellllllllleeeelllleeeeLEEEEEEL
Query pllikngeiitadsrykadiyaegetitrigqnleappgtevidatgkyvfpGFIDPHVH   60
ident                                                       || | |
Sbjct ----------------------------------------------------XIIDIHGH    8
DSSP  ----------------------------------------------------LLEEEEEE


DSSP  LLLE---ELLE-------------------------elllLHHH-HHHHHHHLLEEEEEE
Query IYLP---FMAT-------------------------fakdTHET-GSKAALMGGTTTYIE   91
ident                                                |     |      
Sbjct YTTApkaLEDWrnrqiagikdpsvxpkvselkisddelqaSIIEnQLKKXQERGSDLTVF   68
DSSP  LLLLlhhHHHHhhhhhhhhhlhhhlllhhhllllhhhhhhHHHLlHHHHHHHHLLLEEEE


DSSP  EEL----llLLLLHHHHHHHHHHHHLLLllLEEEEEEELLL----lLLLHHHHHHHHHHL
Query MCC----psRNDDALEGYQLWKSKAEGNsyCDYTFHMAVSK----fDEKTEGQLREIVAD  143
ident              |     |                                 |   |  
Sbjct SPRagdfnvSSTWAAICNELCYRVSQLF-pDNFIGAAXLPQspgvdPKTCIPELEKCVKE  127
DSSP  ELLlllhhhHHHHHHHHHHHHHHHHHHL-lLLEEEEEELLLlllllHHHHHHHHHHHHHL


DSSP  -LLLEEEEEELLLL----lllllHHHHHHHHHHHHHHLLEEEEEellhhhhhhhhhhhhh
Query -GISSFXIFLSYKN----ffgvdDGEMYQTLRLAKELGVIVTAHcenaelvgrlqqklls  198
ident  |                     |   |       ||      |                
Sbjct yGFVAINLNPDPSGghwtsppltDRIWYPIYEKXVELEIPAXIH----------------  171
DSSP  lLLLEEEELLLLLLlllllllllLHHHHHHHHHHHHHLLLEEEL----------------


DSSP  lllllhhhlLLLLlHHHHHHHHHHH--hHHHHHHL-LEEEELLLLLhHHHH---------
Query egktgpewhEPSRpEAVEAEGTARF--aTFLETTG-ATGYVVHLSCkPALD---------  246
ident                                           |                 
Sbjct -------vsTGAHyLNADTTAFXQCvagDLFKDFPeLKFVIPHGGG-AVPYhwgrfrgla  223
DSSP  -------llLLLHhHHHHHHHHHHHhhlLHHHHLLlLLEEELHHHL-LLHHhhhhhhhhh


DSSP  --hhhhhHHLLL--LEEEEEEhHHHHllhhhhhllhhhhhlllllllllllhHHHHHHHH
Query --aamaaKARGV--PIYIESViPHFLldktyaerggveamkyimspplrdkrNQKVLWDA  302
ident            |   |                                        |   
Sbjct qexkkplLEDHVlnNIFFDTC-VYHQ-------------------------pGIDLLNTV  257
DSSP  hhlllllHHHHLllLEEEELL-LLLH-------------------------hHHHHHHHH


DSSP  HhLLLLLEEELLLLlllhhhhhhhlllhhhllLLLL--------lllLHHHHHHHHhlll
Query LaQGFIDTVGTDHCpfdteqkllgkeaftaipNGIP--------aieDRVNLLYTYgvsr  354
ident                                                |            
Sbjct I-PVDNVLFASEXI------------------GAVRgidprtgfyydDTKRYIEAS----  294
DSSP  L-LHHHEELLLLLL------------------LLLLleelllleellLLHHHHHHL----


DSSP  LLLLHHHHHHHHLHHHHHHLL-LLLLLlllLLLLllleeeeelllleellhhhlllllll
Query GRLDIHRFVDAASTKAAKLFG-LFPRKgtiAVGSdadlvvydpqyrgtisvktqhvnndy  413
ident   |            |      |                                     
Sbjct TILTPEEKQQIYEGNARRVYPrLDAALkakGKLE--------------------------  328
DSSP  LLLLHHHHHHHHLHHHHHHLHhHHHHHhhhHHHL--------------------------


DSSP  lllllleelleeeeeeelleeeeelleelllllllllllllllll
Query ngfegfeidgrpsvvtvrgkvavrdgqfvgekgwgkllrrepmyf  458
ident                                              
Sbjct --------------------------------------------h  329
DSSP  --------------------------------------------l


No 47: Query=1gkpA Sbjct=3qy6A Z-score=13.8

back to top
DSSP  leeeelleeeelleeeeleeeelllllleeellllllllleeeelllleeeelEEEEEEL
Query pllikngeiitadsrykadiyaegetitrigqnleappgtevidatgkyvfpgFIDPHVH   60
ident                                                       || | |
Sbjct -----------------------------------------------------MIDIHCH    7
DSSP  -----------------------------------------------------LEELLLL


DSSP  LLLEE-lleELLLLHHHHHHHHHHLLEEEEEEEELLLLLL--lHHHHHHHH-HHHHLLL-
Query IYLPF-matFAKDTHETGSKAALMGGTTTYIEMCCPSRND--dALEGYQLW-KSKAEGN-  115
ident |                   ||   |  | |                             
Sbjct ILPAMddgaGDSADSIEMARAAVRQGIRTIIATPHHNNGVyknEPAAVREAaDQLNKRLi   67
DSSP  LLLLLllllLLHHHHHHHHHHHHHLLLLEEELLLEELLLLlllLHHHHHHHhHHHHHHHh


DSSP  ---LLLEEEEEEelllllllhhhhhhhhhhlllleeEEEElllllllllHHHHHHHHHH-
Query ---SYCDYTFHMavskfdektegqlreivadgissfXIFLsyknffgvdDGEMYQTLRL-  171
ident                                      |            ||  | |   
Sbjct kedIPLHVLPGQ------------------------EIRI---------YGEVEQDLAKr   94
DSSP  hllLLLEEELLL------------------------EEEL---------LLLHHHHHHLl


DSSP  ---hhhhlLEEEEEELlhhhhhhhhhhhhhlllllhhhllllllhhHHHHhhhHHHHHHH
Query ---akelgVIVTAHCEnaelvgrlqqkllsegktgpewhepsrpeaVEAEgtaRFATFLE  228
ident                                                             
Sbjct qllslndtKYILIEFP-----------------------------fDHVP--rYAEQLFY  123
DSSP  llllhhhlLEEEEELL-----------------------------lLLLL--lLHHHHHH


DSSP  HHL---LEEEELLLL-LHHH---HHHHHHHHHllLLEEEEEEHHHH-HLLHhhhhllhhh
Query TTG---ATGYVVHLS-CKPA---LDAAMAAKArgVPIYIESVIPHF-LLDKtyaerggve  280
ident             |                                               
Sbjct DLQlkgYIPVIAHPErNREIrenPSLLYHLVE--KGAASQITSGSLaGIFG---------  172
DSSP  HHHhllLEEEEELHHhLHHHhhlLHHHHHHHH--LLLEEEEEHHHHlLLLL---------


DSSP  hhllllllllllLHHHHHHHHHHHLLLLLEEELLLLLllhhhhhhhlllhhhlllLLLLl
Query amkyimspplrdKRNQKVLWDALAQGFIDTVGTDHCPfdteqkllgkeaftaipnGIPAi  340
ident             |              |  |  |                          
Sbjct ------------KQLKAFSLRLVEANLIHFVASDAHN----------------vkTRNF-  203
DSSP  ------------HHHHHHHHHHHHLLLLLEEELLLLL----------------llLLLL-


DSSP  lLHHHHHHhHHLLllLLLHHHHHHHhLHHHHHHLLLLllllllllllllleeeeelllle
Query eDRVNLLYtYGVSrgRLDIHRFVDAaSTKAAKLFGLFprkgtiavgsdadlvvydpqyrg  400
ident       ||                     |  |                           
Sbjct -HTQEALY-VLEK--EFGSELPYML-TENAELLLRNQ-----------------------  235
DSSP  -LHHHHHH-HHHH--HHLLHHHHHH-HHHHHHHHLLL-----------------------


DSSP  ellhhhllllllllllllleelleeeeeeelleeeeelleelllllllllllllllll
Query tisvktqhvnndyngfegfeidgrpsvvtvrgkvavrdgqfvgekgwgkllrrepmyf  458
ident                                                           
Sbjct ----------------------------------------------tifrqppqpvkr  247
DSSP  ----------------------------------------------llllllllllll


No 48: Query=1gkpA Sbjct=1j5sA Z-score=13.7

back to top
DSSP  -----------leeeelleEEELleeeeleeeelllllleeellllllllleeeelllle
Query -----------pllikngeIITAdsrykadiyaegetitrigqnleappgtevidatgky   49
ident                                                             
Sbjct hmflgedylltnraavrlfNEVK-------------------------------------   23
DSSP  llllllllllllhhhhhhhHHHL-------------------------------------


DSSP  eEELEEEEEELLLleelleelllLHHH---------------------------------
Query vFPGFIDPHVHIYlpfmatfakdTHET---------------------------------   76
ident       ||| |                                                 
Sbjct -DLPIVDPHNHLD--------akDIVEnkpwndiwevegatdhyvwelmrrcgvseeyit   74
DSSP  -LLLEEELLLLLL--------hhHHHHllllllhhhhhllllhhhhhhhhhllllhhhll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------   76
ident                                                             
Sbjct gsrsnkekwlalakvfprfvgnptyewihldlwrrfnikkviseetaeeiweetkkklpe  134
DSSP  llllhhhhhhhhhhhhhhhlllhhhhhhhhhhhhhllllllllhhhhhhhhhhhhhhlll


DSSP  --HHHHHHHLLEEEEEEEELllllllHHHHhHHHHHHHL-LLLLLEEEEEEELLLL----
Query --GSKAALMGGTTTYIEMCCpsrnddALEGyQLWKSKAE-GNSYCDYTFHMAVSKF----  129
ident     |                               ||                      
Sbjct mtPQKLLRDMKVEILCTTDD------PVST-LEHHRKAKeAVEGVTILPTWRPDRAmnvd  187
DSSP  llHHHHHHHLLEEEEELLLL------LLLL-LHHHHHHHhHLLLLEEELLLLLHHHhlll


DSSP  -------------------------LLLHHHHHHHHHHLLLLEEEEEEL-----------
Query -------------------------DEKTEGQLREIVADGISSFXIFLS-----------  153
ident                                        |       |            
Sbjct kegwreyvekmgerygedtstldgfLNALWKSHEHFKEHGCVASDHALLepsvyyvdenr  247
DSSP  lllhhhhhhhhhhhhllllllhhhhHHHHHHHHHHHHLLLLLEEEEEELllllllllhhh


DSSP  ---------------lllllllLHHHHHHHHHHHHHHLLEEEEEELlhhhHHHHHHHHHH
Query ---------------yknffgvDDGEMYQTLRLAKELGVIVTAHCEnaelVGRLQQKLLS  198
ident                           | |      |       |             |  
Sbjct aravhekafsgekltqdeindyKAFMMVQFGKMNQETNWVTQLHIG---aLRDYRDSLFK  304
DSSP  hhhhhhhhlllllllhhhhhhhHHHHHHHHHHHHHHHLLEEEEEEL---eELLLLHHHHH


DSSP  LLlllhHHLLllLLHHHhhHHHHHHHHHHHHH--LLEEEELlLLLHHHHHHHHHHHHLLL
Query EGktgpEWHEpsRPEAVeaEGTARFATFLETT--GATGYVVhLSCKPALDAAMAAKARGV  256
ident                            ||                   |           
Sbjct TLgpdsGGDI--STNFL--RIAEGLRYFLNEFdgKLKIVLY-VLDPTHLPTISTIARAFP  359
DSSP  HLllllLLLE--ELLLL--LHHHHHHHHHHHLllLLLEEEE-ELLHHHHHHHHHHHHHLL


DSSP  LEEEEEE--hhHHHLlhhhhhllhhhhhlllllllllllhHHHHHHHH----hhLLLLLE
Query PIYIESV--ipHFLLdktyaerggveamkyimspplrdkrNQKVLWDA----laQGFIDT  310
ident   |                                                         
Sbjct NVYVGAPwwfnDSPF-------------------------GMEMHLKYlasvdlLYNLAG  394
DSSP  LEEELLLllllLLHH-------------------------HHHHHHHHhhllllHHHLLL


DSSP  EELLLLLllhhhhhhhlllhhhlllllLLLLLHHHHHHHHHLllLLLL------------
Query VGTDHCPfdteqkllgkeaftaipngiPAIEDRVNLLYTYGVsrGRLD------------  358
ident   ||                            |                           
Sbjct MVTDSRK-------------------lLSFGSRTEMFRRVLS--NVVGemvekgqipike  433
DSSP  LLLLLLL-------------------lLHHHHHHHHHHHHHH--HHHHhhhhlllllhhh


DSSP  -HHHHHHHHLHHHHHHLLllllllllllllllleeeeelllleellhhhlllllllllll
Query -IHRFVDAASTKAAKLFGlfprkgtiavgsdadlvvydpqyrgtisvktqhvnndyngfe  417
ident                ||                                           
Sbjct aRELVKHVSYDGPKALFF------------------------------------------  451
DSSP  hHHHHHHHHLHHHHHHHL------------------------------------------


DSSP  lleelleeeeeeelleeeeelleelllllllllllllllll
Query gfeidgrpsvvtvrgkvavrdgqfvgekgwgkllrrepmyf  458
ident                                          
Sbjct -----------------------------------------  451
DSSP  -----------------------------------------


No 49: Query=1gkpA Sbjct=3iacA Z-score=12.6

back to top
DSSP  ------------leeeellEEEElleeeeleeeelllllleeellllllllleeeellll
Query ------------pllikngEIITadsrykadiyaegetitrigqnleappgtevidatgk   48
ident                                                             
Sbjct atfxtedfllkndiartlyHKYA-------------------------------------   23
DSSP  llllllllllllhhhhhhhHHLL-------------------------------------


DSSP  eeEELEEEEEELLLleelleellLLHHH--------------------------------
Query yvFPGFIDPHVHIYlpfmatfakDTHET--------------------------------   76
ident        | | |                                                
Sbjct -aPXPIYDFHCHLS-------pqEIADDrrfdnlgqiwlegdhykwralrsagvdeslit   75
DSSP  -lLLLEEELLLLLL-------hhHHHHLlllllhhhhhhllllhhhhhhhhllllhhhll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------   76
ident                                                             
Sbjct gketsdyekyxawantvpktlgnplyhwthlelrrpfgitgtlfgpdtaesiwtqcnekl  135
DSSP  lllllhhhhhhhhhhhhhhllllhhhhhhhhhhhlllllllllllhhhhhhhhhhhhhhh


DSSP  ------HHHHHHHLLEEEEEEEELllllllHHHHhHHHHHHHLLL--LLLEEEEEEELLL
Query ------GSKAALMGGTTTYIEMCCpsrnddALEGyQLWKSKAEGN--SYCDYTFHMAVSK  128
ident                                                            |
Sbjct atpafsARGIXQQXNVRXVGTTDD------PIDS-LEYHRQIAADdsIDIEVAPSWRPDK  188
DSSP  llhhhlHHHHHHHLLEEEEELLLL------LLLL-LHHHHHHHHLllLLLEEELLLLLHH


DSSP  L-----------------------------LLLHHHHHHHHHHLLLLEEEEEELL-----
Query F-----------------------------DEKTEGQLREIVADGISSFXIFLSY-----  154
ident                                      |    | |               
Sbjct VfkieldgfvdylrkleaaadvsitrfddlRQALTRRLDHFAACGCRASDHGIETlrfap  248
DSSP  HhllllllhhhhhhhhhhhhllllllhhhhHHHHHHHHHHHHHLLLLEEEEEELLlllll


DSSP  ----------------------llllllLHHHHHHHHHHHHHHLLEEEEEELLhhhHHHH
Query ----------------------knffgvDDGEMYQTLRLAKELGVIVTAHCENaelVGRL  192
ident                                      |     |     |          
Sbjct vpddaqldailgkrlagetlseleiaqfTTAVLVWLGRQYAARGWVXQLHIGA---IRNN  305
DSSP  lllhhhhhhhhhhhhllllllhhhhhhhHHHHHHHHHHHHHHHLLEEEEEELE---ELLL


DSSP  hhHHHHllLLLHhhLLLLLLHHHhhHHHHHHHHHHHHH-----LLEEEELlLLLHHHHHH
Query qqKLLSegKTGPewHEPSRPEAVeaEGTARFATFLETT-----GATGYVVhLSCKPALDA  247
ident                                   |                         
Sbjct --NTRX-fRLLGpdTGFDSIGDN--NISWALSRLLDSXdvtneLPKTILY-CLNPRDNEV  359
DSSP  --LHHH-hHHHLllLLLLEELLL--LLHHHHHHHHHHHhllllLLEEEEE-ELLHHHHHH


DSSP  HHHHHHLLL------LEEEEE--ehhHHHLlhhhhhllhhhhhlllllllllllhHHHHH
Query AMAAKARGV------PIYIES--vipHFLLdktyaerggveamkyimspplrdkrNQKVL  299
ident                     |                                       
Sbjct LATXIGNFQgpgiagKVQFGSgwwfnDQKD-------------------------GXLRQ  394
DSSP  HHHHHHHLLllllllLEEELLllhhhLLHH-------------------------HHHHH


DSSP  HHH----hhLLLLLEEELLLLLllhhhhhhhlllhhhllllLLLLlLHHHHHHHHHlLLL
Query WDA----laQGFIDTVGTDHCPfdteqkllgkeaftaipngIPAIeDRVNLLYTYGvSRG  355
ident                  ||                            |            
Sbjct LEQlsqxglLSQFVGXLTDSRS-------------------FLSY-TRHEYFRRIL-CNL  433
DSSP  HHHhhhhllHHHLLLLLLLLLL-------------------LLLL-HHHHHHHHHH-HHH


DSSP  L--------------lLHHHHHHHHLHHHHHHLLllllllllllllllleeeeellllee
Query R--------------lDIHRFVDAASTKAAKLFGlfprkgtiavgsdadlvvydpqyrgt  401
ident                       |     |   |                           
Sbjct LgqwaqdgeipddeaxLSRXVQDICFNNAQRYFT--------------------------  467
DSSP  HhhhhhlllllllhhhHHHHHHHHHLHHHHHHLL--------------------------


DSSP  llhhhllllllllllllleelleeeeeeelleeeeelleelllllllllllllllll
Query isvktqhvnndyngfegfeidgrpsvvtvrgkvavrdgqfvgekgwgkllrrepmyf  458
ident                                                          
Sbjct -------------------------------------------------------ik  469
DSSP  -------------------------------------------------------ll


No 50: Query=1gkpA Sbjct=1v77A Z-score=11.6

back to top
DSSP  leeeelleeeelleeeeleeeelllllleeellllllllleeeelllleeeELEEEEEEL
Query pllikngeiitadsrykadiyaegetitrigqnleappgtevidatgkyvfPGFIDPHVH   60
ident                                                      ||     
Sbjct ---------------------------------------------------VKFIEMDIR    9
DSSP  ---------------------------------------------------LLLEEEEEL


DSSP  LLleelleellllhhHHHHHHHHLlEEEEEEEelllllllhhhhhhhhhhhhllllllee
Query IYlpfmatfakdtheTGSKAALMGgTTTYIEMccpsrnddalegyqlwkskaegnsycdy  120
ident                     |                                       
Sbjct DK-------------EAYELAKEW-FDEVVVS----------------------------   27
DSSP  LH-------------HHHHHHHHH-LLEEEEE----------------------------


DSSP  eeeEELLLLlllhhhhHHHHHHLLL-----lEEEEEElllllllLLHHHHHHHHHHHHhh
Query tfhMAVSKFdektegqLREIVADGI-----sSFXIFLsyknffgVDDGEMYQTLRLAKel  175
ident                   |                                 |    |  
Sbjct ---IKFNEE------vDKEKLREARkeygkvAILLSN-------PKPSLVRDTVQKFK--   69
DSSP  ---EEELLL------lLHHHHHHHHhhhlleEEEEEL-------LLHHHHHHHHHHLL--


DSSP  LLEEEEEELLhhhhhhhhhhhhhlllllhhhllllllhhhhHHHHHHHHHHHhhhllEEE
Query GVIVTAHCENaelvgrlqqkllsegktgpewhepsrpeaveAEGTARFATFLettgaTGY  235
ident                                                             
Sbjct SYLIYVESND-------------------------------LRVIRYSIEKG-----VDA   93
DSSP  LLEEEEELLL-------------------------------HHHHHHHHHLL-----LLE


DSSP  ELLLLL---HHHHH-hHHHHHHlLLLEEEEEEHHHHHLLHHHhhllhhhhhllllllllL
Query VVHLSC---KPALD-aAMAAKArGVPIYIESVIPHFLLDKTYaerggveamkyimspplR  291
ident           |  |                      |    |                  
Sbjct IISPWVnrkDPGIDhvLAKLMV-KKNVALGFSLRPLLYSNPY-----------------E  135
DSSP  EELLLLlllLLLLLhhHHHHHH-HHLLEEEEELHHHHHLLHH-----------------H


DSSP  LLHHHHHHHHHHHLLL----lLEEELLLLLllhhhhhhhlllhhhllllLLLLllHHHHH
Query DKRNQKVLWDALAQGF----iDTVGTDHCPfdteqkllgkeaftaipngIPAIedRVNLL  347
ident           |                                                |
Sbjct RANLLRFMMKAWKLVEkykvrRFLTSSAQE------------------kWDVR--YPRDL  175
DSSP  HHHHHHHHHHHHHHHHhhlllEEEELLLLL------------------hHHLL--LHHHH


DSSP  HHHHLlllLLLHHHHHHHHLHHHHHHLLllllllllllllllleeeeelllleellhhhl
Query YTYGVsrgRLDIHRFVDAASTKAAKLFGlfprkgtiavgsdadlvvydpqyrgtisvktq  407
ident    ||      |       |                                        
Sbjct ISLGV-viGMEIPQAKASISMYPEIILK--------------------------------  202
DSSP  HHHHH-hlLLLHHHHHHLLLHHHHHHHL--------------------------------


DSSP  lllllllllllleelleeeeeeelleeeeelleelllllllllllllllll
Query hvnndyngfegfeidgrpsvvtvrgkvavrdgqfvgekgwgkllrrepmyf  458
ident                                                    
Sbjct ---------------------------------------------------  202
DSSP  ---------------------------------------------------


No 51: Query=1gkpA Sbjct=2a3lA Z-score=9.7

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct qpdpiaadilrkepeqetfvrlnvplevptsdeveaykclqeclelrkryvfqetvapwe   60
DSSP  llllllllllllllllllllllllllllllllllllhhhhhhhhhhhhllllllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct keepfahypqgksdhcfemqdgvvhvfankdakedlfpvadatafftdlhhvlkviaagn  120
DSSP  lllllllllllllllllllllllllllllllllllllllllhhhhhhhhhhhhhhlllhh


DSSP  ----------------------------leeeELLEEEElleeeeleeeelllllleeel
Query ----------------------------plliKNGEIITadsrykadiyaegetitrigq   32
ident                                                             
Sbjct irtlchrrlvlleqkfnlhlmlnadkeflaqkSAPHRDF---------------------  159
DSSP  hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhHLLLLLL---------------------


DSSP  lllllllleeeelllleeEELEEEEEELLL------------------------------
Query nleappgtevidatgkyvFPGFIDPHVHIY------------------------------   62
ident                        | |||                                
Sbjct -----------------yNVRKVDTHVHHSacmnqkhllrfiksklrkepdevvifrdgt  202
DSSP  -----------------lLLLEEEEEEELLllllhhhhhhhhhhhhhllllllleeelle


DSSP  ------------------------------------------------leELLEE-----
Query ------------------------------------------------lpFMATF-----   69
ident                                                             
Sbjct yltlrevfesldltgydlnvdlldvhadkstfhrfdkfnlkynpcgqsrlREIFLkqdnl  262
DSSP  eelhhhhhhhhlllllllllllllllllllllllllllhhhhllllllhhHHHHLlllll


DSSP  -----lllLHHHHHHHHHHLLEEEEEEEELLLLLL-LHHHHHHHHHHhhLLLLLLEEEEE
Query -----akdTHETGSKAALMGGTTTYIEMCCPSRND-DALEGYQLWKSkaEGNSYCDYTFH  123
ident                                             |               
Sbjct iqgrflgeITKQVFSDLEASKYQMAEYRISIYGRKmSEWDQLASWIV-nNDLYSENVVWL  321
DSSP  lllllhhhHHHHHHHHHLLLLLEEEEEEEELLLLLlLHHHHHHHHHH-lLLLLLLLEEEE


DSSP  EELLL----------------LLLLHHHHHHH------------hhHLLLLEEEEEEL--
Query MAVSK----------------FDEKTEGQLRE------------ivADGISSFXIFLS--  153
ident                              | |                    |       
Sbjct IQLPRlyniykdmgivtsfqnILDNIFIPLFEatvdpdshpqlhvfLKQVVGFDLVDDes  381
DSSP  EEEELlhhhhlllllllllhhHHHHHLLHHHHhhhlhhhllllhhhHLLEEEEEEELLll


DSSP  ----------------lllllllLHHHHHHHHHHHHHHL----------LEEEEEELlhh
Query ----------------yknffgvDDGEMYQTLRLAKELG----------VIVTAHCEnae  187
ident                             |        |                |     
Sbjct kperrptkhmptpaqwtnafnpaFSYYVYYCYANLYVLNklreskgmttITLRPHSG---  438
DSSP  lllllllllllllllllllllllHHHHHHHHHHHHHHHHhhhlllllllLEELLLLL---


DSSP  hhhhhhhhhhhlllllhhhllllllHHHHhHHHHHHHHHHhhhlleEEELLLLlhHHHH-
Query lvgrlqqkllsegktgpewhepsrpEAVEaEGTARFATFLettgatGYVVHLSckPALD-  246
ident                                  |                |         
Sbjct ------------------------eAGDI-DHLAATFLTC------HSIAHGI--NLRKs  465
DSSP  ------------------------lLLLL-HHHHHHHHHL------LLLLLLH--HHHHl


DSSP  --HHHHHHHLlllEEEEEEHHHHHLlhhhhhllhhhhhllllllLLLLLHHHhHHHHHHH
Query --AAMAAKARgvpIYIESVIPHFLLdktyaerggveamkyimspPLRDKRNQkVLWDALA  304
ident              |                                 |            
Sbjct pvLQYLYYLA--qIGLAMSPLSNNS-------------------LFLDYHRN-PFPVFFL  503
DSSP  hhHHHHHHHH--lLLEEELHHHHLL-------------------LLLLLLLL-LHHHHHH


DSSP  LLLLLEEELLLLLLlhhhhhhhlllhhhllllllllLLHHHHHHHHHlLLLLLLHHHHHH
Query QGFIDTVGTDHCPFdteqkllgkeaftaipngipaiEDRVNLLYTYGvSRGRLDIHRFVD  364
ident  |      ||                          |  |        |   |       
Sbjct RGLNVSLSTDDPLQ-----------------ihltkEPLVEEYSIAA-SVWKLSACDLCE  545
DSSP  LLLLEEELLLLHHH-----------------hllllLHHHHHHHHHH-HHHLLLHHHHHH


DSSP  HhLHHHHHHLLL-LLLL-lLLLLLLllleeeeelllleellhhhllllllllllllleel
Query AaSTKAAKLFGL-FPRK-gTIAVGSdadlvvydpqyrgtisvktqhvnndyngfegfeid  422
ident           |     |   |                                       
Sbjct I-ARNSVYQSGFsHALKshWIGKDY------------------------ykrgpdgndih  580
DSSP  H-HHHHHHHLLLlHHHHhhHLLLLL------------------------llllhhhllhh


DSSP  leeeeeeelleeeeelleelllllllllllllllll
Query grpsvvtvrgkvavrdgqfvgekgwgkllrrepmyf  458
ident                                     
Sbjct ktnvphirvefrdtiwkeemqqvylgkavisdevvp  616
DSSP  hhlllhhhhhhhhhhhhhhhhhhlllllllllllll


No 52: Query=1gkpA Sbjct=3f2bA Z-score=9.4

back to top
DSSP  ------------------------------------------------------leeeel
Query ------------------------------------------------------pllikn    6
ident                                                             
Sbjct vrrletiveeerrvvvqgyvfdaevselksgrtlltmkitdytnsilvkmfsrdkedael   60
DSSP  lllhhhlllleeeeeeeeeeeeeeeeellllleeeeeeeelllleeeeeeelllhhhhhh


DSSP  leeeelleeeeleeeelllllleeellllllLLLEE--eellllEEEELEEEEEELL-LL
Query geiitadsrykadiyaegetitrigqnleapPGTEV--idatgkYVFPGFIDPHVHI-YL   63
ident                                                      | |    
Sbjct msgvkkgmwvkvrgsvqndtfvrdlviiandLNEIAanerqdtaPEGEKRVELHLHTpMS  120
DSSP  hhlllllleeeeeeeeeeelllleeeeeeeeEEEELllllllllLLLLLLLLLLLLLlLL


DSSP  EElleELLLLHHHHHHHHHHLLEEEEEEEELLlllllhhhhhhHHHHHHLLLL---LLEE
Query PFmatFAKDTHETGSKAALMGGTTTYIEMCCPsrnddalegyqLWKSKAEGNS---YCDY  120
ident       |          |   |                          |           
Sbjct QM---DAVTSVTKLIEQAKKWGHPAIAVTDHA---------vvQSFPEAYSAAkkhGMKV  168
DSSP  LL---LLLLLHHHHHHHHHHLLLLLEEELLLL---------llLLHHHHHHHHhhhLLLE


DSSP  EEEEelllllllhhhhhhhhhhlllleeEEEE----------------------------
Query TFHMavskfdektegqlreivadgissfXIFL----------------------------  152
ident                                                             
Sbjct IYGL------------------------EANIvddpfhvtllaqnetglknlfklvslsh  204
DSSP  EEEE------------------------EEEEellleeeeeeellhhhhhhhhhhhhhhh


DSSP  --lLLLLLLLlhhHHHHHHHHHhhHLLEEEeeellhhhhhhhhhhhhhlllllhhhllll
Query --sYKNFFGVddgEMYQTLRLAkeLGVIVTahcenaelvgrlqqkllsegktgpewheps  210
ident                          |  |                               
Sbjct iqyFHRVPRI---PRSVLVKHR--DGLLVG------------------------------  229
DSSP  lllLLLLLLE---EHHHHHHLL--LLEEEE------------------------------


DSSP  llhhhhhhhhhhhhhhhhhhlleeeELLLllhhHHHHhHHHHhllLLEE-EEEEHhHHHL
Query rpeaveaegtarfatflettgatgyVVHLsckpALDAaMAAKargVPIY-IESVIpHFLL  269
ident                                    |               |        
Sbjct -------------------------SGCD-kgeLFDN-VEDI--aRFYDfLEVHP-PDVY  259
DSSP  -------------------------LLLL-lllLLLL-LLLL--hHHLLlEEELL-HHHH


DSSP  LHHhhhllhhhhhllllllllLLLH-HHHHHHHHHHLLL----lLEEELLLLL-------
Query DKTyaerggveamkyimspplRDKR-NQKVLWDALAQGF----iDTVGTDHCP-------  317
ident                       |            | |                      
Sbjct KPL----------------yvKDEEmIKNIIRSIVALGEkldipVVATGNVHYlnpedki  303
DSSP  LLL----------------llLLHHhHHHHHHHHHHHHHhllllEEELLLLLLllhhhhh


DSSP  LLHHHHHHHLLLHHHL---lllLLLLllHHHHHHHHHLlllLLLHHHHHHHHLHHHHHHL
Query FDTEQKLLGKEAFTAI---pngIPAIedRVNLLYTYGVsrgRLDIHRFVDAASTKAAKLF  374
ident            |                  |           |              |  
Sbjct YRKILIHSQGGANPLNrhelpdVYFR--TTNEMLDCFS---FLGPEKAKEIVVDNTQKIA  358
DSSP  HHHHHHHLLHHHLLLLllllllLLLL--LHHHHHHHHH---HHHHHHHHHHHLHHHHHHH


DSSP  LL----------------------------------------------------------
Query GL----------------------------------------------------------  376
ident  |                                                          
Sbjct SLigdvkpikdelytpriegadeeiremsyrrakeiygdplpklveerlekelksiighg  418
DSSP  HLllllllllllllllllllhhhhhhhhhhhhhhhhhlllllhhhhhhhhhhhhhhhhll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  376
ident                                                             
Sbjct faviylishklvkkslddgylvgsrgsvgssfvatmteitevnplpphyvcpnckhseff  478
DSSP  lhhhhhhhhhhhhhhhhllllleelhhhhhlhhhhhllllllllllleeelllllleeel


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  376
ident                                                             
Sbjct ndgsvgsgfdlpdkncprcgtkykkdghdipfetflgfkgdkvpdidlnfsgeyqprahn  538
DSSP  lllllllhhhllllllllllllleeellllllhhhhllllllllleeeeeelllhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  376
ident                                                             
Sbjct ytkvlfgednvyragtigtvadktaygfvkayasdhnlelrgaeidrlaagctgvkrttg  598
DSSP  hhhhhhlllleeeeeeeeellhhhhhhhhhhhhhhllllllhhhhhhhhhhhllleeeee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  376
ident                                                             
Sbjct qhpggiivvpdymeiydftpiqypaddtssewrtthfdfhsihdnllkldilghddptvi  658
DSSP  eeeeeeeellllllhhhllleelhhhllllllleeeeehhhhllllleeeeeeehhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  376
ident                                                             
Sbjct rmlqdlsgidpktiptddpdvmgifssteplgvtpeqimcnvgtigipefgtrfvrqmle  718
DSSP  hhhhhhhlllhhhlllllhhhhhlllllhhhlllhhhhllllllllllllllhhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  376
ident                                                             
Sbjct etrpktfselvqisglshgtdvwlgnaqeliqngtctlsevigcrddimvyliyrgleps  778
DSSP  hhllllhhhhhhhhhhllllllllllhhhhhhlllllhhhllllhhhhhhhhhhllllhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  376
ident                                                             
Sbjct lafkimesvrkgkgltpefeaemrkhdvpewyidsckkikymfpkahaaayvlmavriay  838
DSSP  hhhhhhhhhlllllllhhhhhhhhhllllhhhhhhhhhllllllhhhhhhhhhhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  376
ident                                                             
Sbjct fkvhhpllyyasyftvraedfdldamikgsaairkrieeinakgiqatakekslltvlev  898
DSSP  hhhhlhhhhhhhhhhhllllllhhhhhhlhhhhhhhhhhhhhlhhhllhhhhhhhhhhhh


DSSP  --------------lllllllllllllleeeeelllleellhhhllllllllllllleel
Query --------------fprkgtiavgsdadlvvydpqyrgtisvktqhvnndyngfegfeid  422
ident                                                             
Sbjct alemcergfsfknidlyrsqatefvidgnslippfnaipglgtnvaqaivrareegefls  958
DSSP  hhhhhhllleellllllllllllleeelleeellhhhlllllhhhhhhhhhhhhllllll


DSSP  leeeeeeelleeeeelleelllllllllllllllll
Query grpsvvtvrgkvavrdgqfvgekgwgkllrrepmyf  458
ident                                     
Sbjct kedlqqrgklsktlleylesrgcldslpdhnqlslf  994
DSSP  hhhhhhhhlllhhhhhhhhhllllllllllllllll


No 53: Query=1gkpA Sbjct=3dcpA Z-score=9.3

back to top
DSSP  leeeelleeeelleeeeleeeelllllleeellllllllleeeelllleeeeLEEEEEEL
Query pllikngeiitadsrykadiyaegetitrigqnleappgtevidatgkyvfpGFIDPHVH   60
ident                                                        | | |
Sbjct ----------------------------------------------------XKRDGHTH    8
DSSP  ----------------------------------------------------LLEEEEEL


DSSP  L-LLEElleELLLLHHHHHHHHHHLLEEEEEEEEL-LLLL-----------------lLH
Query I-YLPFmatFAKDTHETGSKAALMGGTTTYIEMCC-PSRN-----------------dDA  101
ident     |       |  |     |       |      |                       
Sbjct TeFCPH---GTHDDVEEXVLKAIELDFDEYSIVEHaPLSSefxkntagdkeavttasxAX   65
DSSP  LlLLLL---LLLLLHHHHHHHHHHLLLLEEEEEEElLLLHhhhhllllllhhhhllllLH


DSSP  HHhHHHHHHHHLLLL-----LLEEEEEEelllllllhhhhhhhhhhlllleeEEEEllll
Query LEgYQLWKSKAEGNS-----YCDYTFHMavskfdektegqlreivadgissfXIFLsykn  156
ident          |                                                  
Sbjct SD-LPYYFKKXNHIKkkyasDLLIHIGF------------------------EVDY----   96
DSSP  HH-HHHHHHHHHHHHhhlllLLEEEEEE------------------------EEEL----


DSSP  lllLLHHhHHHHHHHHhHHLL----eeEEEELLHHhhHHHHhhhhhlllllHHHLLLL--
Query ffgVDDGeMYQTLRLAkELGV----ivTAHCENAElvGRLQqkllsegktgPEWHEPS--  210
ident            |                      |  |                      
Sbjct ---LIGY-EDFTRDFL-NEYGpqtddgVLSLHFLE--GQGG----frsidfSAEDYNEgi  145
DSSP  ---LLLL-HHHHHHHH-HHHHhhlleeEEELLEEE--ELLE----eeelllLHHHHHHhl


DSSP  --------lLHHHHHHHHHHHHHHhhHHLL--eEEELLLL-------------------l
Query --------rPEAVEAEGTARFATFleTTGA--tGYVVHLS-------------------c  241
ident                ||           |        | |                    
Sbjct vqfyggfeqAQLAYLEGVKQSIEA--DLGLfkpRRXGHISlcqkfqqffgedtsdfseev  203
DSSP  hhhhllhhhHHHHHHHHHHHHHHL--LLLLlllLEELLLLhhhllhhhhlllhhhllhhh


DSSP  hhhHHHHHHHHHLlLLEEEEEEHHHHHLLHhhhhllhhhhhlllllllllllhhhhhHHH
Query kpaLDAAMAAKARgVPIYIESVIPHFLLDKtyaerggveamkyimspplrdkrnqkvLWD  301
ident         |                                                   
Sbjct xekFRVILALVKK-RDYELDFNTAGLFKPL---------------------cgetypPKK  241
DSSP  hhhHHHHHHHHHH-HLLEEEEELHHHHLLL---------------------llllllLHH


DSSP  HHHLL----LLLEEELLLLLllhhhhhhhlllhhhlllllLLLLLHHHHHHHHHLlllll
Query ALAQG----FIDTVGTDHCPfdteqkllgkeaftaipngiPAIEDRVNLLYTYGVsrgrl  357
ident               | |                         |                 
Sbjct IVTLAselqIPFVYGSDSHG-------------------vQDIGRGYSTYCQKLE-----  277
DSSP  HHHHHhhllLLEEEELLLLL-------------------hHHLLLLHHHHHHHLL-----


DSSP  lhhhhhhhhlhhhhhhllllllllllllllllleeeeelllleellhhhlllllllllll
Query dihrfvdaastkaaklfglfprkgtiavgsdadlvvydpqyrgtisvktqhvnndyngfe  417
ident                                                             
Sbjct ------------------------------------------------------------  277
DSSP  ------------------------------------------------------------


DSSP  lleelleeeeeeelleeeeelleelllllllllllllllll
Query gfeidgrpsvvtvrgkvavrdgqfvgekgwgkllrrepmyf  458
ident                                          
Sbjct -----------------------------------------  277
DSSP  -----------------------------------------


No 54: Query=1gkpA Sbjct=3au2A Z-score=9.1

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct mrnqelarifeeiglmseflgdnpfrvrayhqaartlydldtpieeiaekgkealmelpg   60
DSSP  llhhhhhhhhhhhhhhhhhllllhhhhhhhhhhhhhhhhllllhhhhhlllhhhhlllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct vgpdlaekileflrtgkvrkheelsrkvprgvlevmevpgvgpktarllyeglgidslek  120
DSSP  llhhhhhhhhhhhhhlllhhhhhhhhhllhhhhhhhllllllhhhhhhhhhhhllllhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct lkaaldrgdltrlkgfgpkraerireglalaqaagkrrplgavlslarslleairalpgv  180
DSSP  hhhhhhhlhhhhlllllhhhhhhhhhhhhhhhhlllleehhhhhhhhhhhhhhhhlllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct eraelcgsarrykdtvgdldflvasregeravegfvrlpqvkevyakgkeratvflkngl  240
DSSP  leeeelhhhhlllleelleeeeeelllhhhhhhhhhlllleeeeeeellleeeeeellll


DSSP  -----------------------leeeelleeeelleeeeleeeelllllleeeLLLL--
Query -----------------------pllikngeiitadsrykadiyaegetitrigQNLE--   35
ident                                                          |  
Sbjct qvdlrvvppesygaglqyltgskahsirlralaqekglklseygvfrgekriagETEEev  300
DSSP  eeeeeeelhhhhhhhhhhhhllhhhhhhhhhhhhhllleeelleeeelleeeelLLHHhh


DSSP  -------------------llllleeeelllleeEELEEEEEELLLLEelleELLLLHHH
Query -------------------appgtevidatgkyvFPGFIDPHVHIYLPfmatFAKDTHET   76
ident                                        |  ||            | | 
Sbjct yaalglpwippplredqgeveaalegrlpkllelPQVKGDLQVHSTYS----DGQNTLEE  356
DSSP  hhhlllllllhhhlllllhhhhhhlllllllllhHHLLEEEEELLLLL----LLLLLHHH


DSSP  HHHHHHHLLEEEEEEEELLLL----LLLHHHHHHHHHHHHLLLL----lLEEEEEEELLL
Query GSKAALMGGTTTYIEMCCPSR----NDDALEGYQLWKSKAEGNS----yCDYTFHMAVSK  128
ident    ||   |                     |                          |  
Sbjct LWEAAKTMGYRYLAVTDHSPAvrvaGGPSPEEALKRVGEIRRFNethgpPYLLAGAEVDI  416
DSSP  HHHHHHHHLLLEEEEEEELHHhhllLLLLHHHHHHHHHHHHHHHhhhllLEEEEEEEEEL


DSSP  LlllhhhHHHHHHHlLLLEEEEEeLLLL---llllLHHHHHHHHHHHhhhlLEEEE-EEL
Query FdektegQLREIVAdGISSFXIFlSYKN---ffgvDDGEMYQTLRLAkelgVIVTA-HCE  184
ident                                            |             |  
Sbjct HpdgtldYPDWVLR-ELDLVLVS-VHSRfnlpkadQTKRLLKALENP----FVHVLaHPT  470
DSSP  LllllllLLHHHHL-LLLEEEEE-LLLLllllhhhHHHHHHHHHLLL----LLLEElLLL


DSSP  LhhhhhhhhhhhhhlllllhhhlLLLLLHhhhhhhHHHHHHHHHhhLLEEEELL------
Query NaelvgrlqqkllsegktgpewhEPSRPEaveaegTARFATFLEttGATGYVVH------  238
ident                           |                        |        
Sbjct A--------------------rlLGRRAP--ieadWEAVFQKAK--EKGVAVEIdgyydr  506
DSSP  L--------------------llLLLLLL--llllHHHHHHHHH--HHLLEEEEelllll


DSSP  --LLLHhHHHHHHHHHhllllEEEEeehhhhhllhhhhhllhhhhhlllllllllllhhh
Query --LSCKpALDAAMAAKargvpIYIEsviphflldktyaerggveamkyimspplrdkrnq  296
ident   |        |           |                                    
Sbjct mdLPDD-LARMAYGMG-----LWIS-----------------------------------  525
DSSP  llLLHH-HHHHHHHLL-----LLEE-----------------------------------


DSSP  hhhhhhhhllllleEELLLLLllhhhhhhhlllhhhlllllLLLLLHhhhhhhhhlllll
Query kvlwdalaqgfidtVGTDHCPfdteqkllgkeaftaipngiPAIEDRvnllytygvsrgr  356
ident                 ||                                          
Sbjct --------------LSTDAHQ-------------------tDHLRFM-----elavgtaq  547
DSSP  --------------EELLLLL-------------------hHHHHHH-----hhhhhhhh


DSSP  llhhhhhhhhLHHHH-HHLLllllllllllllllleeeeelllleellhhhlllllllll
Query ldihrfvdaaSTKAA-KLFGlfprkgtiavgsdadlvvydpqyrgtisvktqhvnndyng  415
ident            |     |                                          
Sbjct rawigpervlNTLDYeDLLS----------------------------------------  567
DSSP  hllllllllhHHLLHhHHHH----------------------------------------


DSSP  lllleelleeeeeeelleeeeelleelllllllllllllLLLL--
Query fegfeidgrpsvvtvrgkvavrdgqfvgekgwgkllrrePMYF--  458
ident                                              
Sbjct -------------------------------------wlKARRgv  575
DSSP  -------------------------------------hhHLLLll


No 55: Query=1gkpA Sbjct=1m65A Z-score=8.8

back to top
DSSP  leeeelleeeelleeeeleeeelllllleeellllllllleeeelllleeeelEEEEEEL
Query pllikngeiitadsrykadiyaegetitrigqnleappgtevidatgkyvfpgFIDPHVH   60
ident                                                        | | |
Sbjct ----------------------------------------------------yPVDLHMH    8
DSSP  ----------------------------------------------------lLEELLLL


DSSP  LLLEElleELLLLHHHHHHHHHHLLEEEEEEEELLLLLL--lhHHHHHHhHHHHL-lllL
Query IYLPFmatFAKDTHETGSKAALMGGTTTYIEMCCPSRND--daLEGYQLwKSKAE-gnsY  117
ident          |  |       |   |                                   
Sbjct TVAST---HAYSTLSDYIAQAKQKGIKLFAITDHGPDMEdaphHWHFIN-MRIWPrvvdG   64
DSSP  LLLLL---LLLLLHHHHHHHHHHHLLLEEEEEEELLLLLllllLHHHHH-HHHLLleelL


DSSP  LEEEEEEELLLLL-llhhhHHHHHHhLLLLEEEEEeLLLLL-----lllLHHHHHHHHHH
Query CDYTFHMAVSKFD-ektegQLREIVaDGISSFXIFlSYKNF-----fgvDDGEMYQTLRL  171
ident                           |                          |  |   
Sbjct VGILRGIEANIKNvdgeidCSGKMF-DSLDLIIAG-FHEPVfaphdkatNTQAMIATIAS  122
DSSP  EEEEEEEEEELLLllllllLLHHHH-HHLLEEEEE-LLLLLlllllhhhHHHHHHHHHHL


DSSP  HhhhlLEEEE-EELLHHHhhhhhhhhhhlllllhhhllllllhhhhhHHHHHHHHHHHhh
Query AkelgVIVTA-HCENAELvgrlqqkllsegktgpewhepsrpeaveaEGTARFATFLEtt  230
ident            |  |                                      |      
Sbjct G----NVHIIsHPGNPKY----------------------------eIDVKAVAEAAA--  148
DSSP  L----LLLEElLLLLLLL----------------------------lLLHHHHHHHHH--


DSSP  LLEEEELL---llLHHHHHHHHHHHhllllEEEEEE-----------HHHHhllhhhhhl
Query GATGYVVH---lsCKPALDAAMAAKargvpIYIESV-----------IPHFlldktyaer  276
ident              |     |   |                                    
Sbjct KHQVALEInnssnCREVAAAVRDAG-----GWVALGsdshtaftmgeFEEC---------  194
DSSP  HHLLEEEEellllHHHHHHHHHHHL-----LLEEEElllllhhhlllLHHH---------


DSSP  lhhhhhlllllllllllhhHHHHHHHhhLLLLLEEelllllllhhhhhhhlllhhhllll
Query ggveamkyimspplrdkrnQKVLWDAlaQGFIDTVgtdhcpfdteqkllgkeaftaipng  336
ident                     | |                                     
Sbjct -------------------LKILDAVdfPPERILN-------------------------  210
DSSP  -------------------HHHHHHLllLHHHLHH-------------------------


DSSP  llllllhhhhhhhhhlllllllhhhhhhHHLHHHHHHLL--------lLLLLllllllll
Query ipaiedrvnllytygvsrgrldihrfvdAASTKAAKLFG--------lFPRKgtiavgsd  388
ident                                                 |           
Sbjct ----------------------------VSPRRLLNFLEsrgmapiaeFADL--------  234
DSSP  ----------------------------HLHHHHHHHHHhllllllhhHLLL--------


DSSP  lleeeeelllleellhhhllllllllllllleelleeeeeeelleeeeelleelllllll
Query adlvvydpqyrgtisvktqhvnndyngfegfeidgrpsvvtvrgkvavrdgqfvgekgwg  448
ident                                                             
Sbjct ------------------------------------------------------------  234
DSSP  ------------------------------------------------------------


DSSP  llllllllll
Query kllrrepmyf  458
ident           
Sbjct ----------  234
DSSP  ----------


No 56: Query=1gkpA Sbjct=1bksA Z-score=7.7

back to top
DSSP  leeeelleeeelleeeeleeeelllllleeellllllllleeeelllleEEELEEEEeEL
Query pllikngeiitadsrykadiyaegetitrigqnleappgtevidatgkyVFPGFIDPhVH   60
ident                                                             
Sbjct -------------------------------------meryenlfaqlnDRREGAFV-PF   22
DSSP  -------------------------------------lhhhhhhhhhhhHLLLLEEE-EE


DSSP  LLLEEL-leelllLHHHHHHHHhhlleeeEEEEELLLLL--------------------l
Query IYLPFM-atfakdTHETGSKAAlmggtttYIEMCCPSRN--------------------d   99
ident   |             |   |                                       
Sbjct VTLGDPgieqslkIIDTLIDAG------aDALELGVPFSdpladgptiqnanlrafaagv   76
DSSP  EELLLLlhhhhhhHHHHHHHLL------lLLEEEELLLLllllllhhhhhhhhhhhhhll


DSSP  LHHHHHHHHHHHHLLLlllEEEEEEELLL---LLLLHHHHHHHHHHLLLLEEEEEellll
Query DALEGYQLWKSKAEGNsycDYTFHMAVSK---FDEKTEGQLREIVADGISSFXIFlsykn  156
ident              |                  |              |  |         
Sbjct TPAQCFEMLALIREKH--pTIPIGLLMYAnlvFNNGIDAFYARCEQVGVDSVLVA-----  129
DSSP  LHHHHHHHHHHHHHHL--lLLLEEEEELHhhhHLLLHHHHHHHHHHHLLLEEEEL-----


DSSP  llLLLHHHHHHHHHHHHHHLLEEEEEELlhhhhhhhhhhhhhlllllhhhllllllhhHH
Query ffGVDDGEMYQTLRLAKELGVIVTAHCEnaelvgrlqqkllsegktgpewhepsrpeaVE  216
ident    |   |       |          |                                 
Sbjct --DVPVEESAPFRQAALRHNIAPIFICP-----------------------------pNA  158
DSSP  --LLLHHHLHHHHHHHHHLLLEEEEEEL-----------------------------lLL


DSSP  HH-HHHHHHHHHhhhllEEEELLL--lLHHHHHHHHHHHhllllEEEEEEHHHhhllhhh
Query AE-GTARFATFLettgaTGYVVHL--sCKPALDAAMAAKargvpIYIESVIPHflldkty  273
ident         |         ||   |                                    
Sbjct DDdLLRQVASYG-----RGYTYLLalpLHHLIEKLKEYH----aAPALQGFGI-------  202
DSSP  LHhHHHHHHHHL-----LLLEEELlllHHHHHHHHHHHL----lLLEEELLLL-------


DSSP  hhllhhhhhlllllllllllhhhhhhhhhhhLLLLLEEELL-LLLL--LHHHHHHhlllh
Query aerggveamkyimspplrdkrnqkvlwdalaQGFIDTVGTD-HCPF--DTEQKLLgkeaf  330
ident                                                             
Sbjct ---------------------sspeqvsaavRAGAAGAISGsAIVKiiEKNLASP----k  237
DSSP  ---------------------llhhhhhhhhHHLLLEEEELlHHHHhhHHLLLLH----h


DSSP  hhllllllLLLLHHHHhhhhhlllllllhhhhhhhhlhhhhhhlllllllllllllllll
Query taipngipAIEDRVNLlytygvsrgrldihrfvdaastkaaklfglfprkgtiavgsdad  390
ident                                                             
Sbjct qmlaelrsFVSAMKAA--------------------------------------------  253
DSSP  hhhhhhhhHHHHHHHL--------------------------------------------


DSSP  eeeeelllleellhhhllllllllllllleelleeeeeeelleeeeelleelllllllll
Query lvvydpqyrgtisvktqhvnndyngfegfeidgrpsvvtvrgkvavrdgqfvgekgwgkl  450
ident                                                             
Sbjct ------------------------------------------------------------  253
DSSP  ------------------------------------------------------------


DSSP  llllllll
Query lrrepmyf  458
ident         
Sbjct ------sr  255
DSSP  ------ll


No 57: Query=1gkpA Sbjct=2yb1A Z-score=5.7

back to top
DSSP  leeeelleeeelleeeeleeeelllllleeellllllllleeeelllleeeelEEEEEEL
Query pllikngeiitadsrykadiyaegetitrigqnleappgtevidatgkyvfpgFIDPHVH   60
ident                                                       || | |
Sbjct ----------------------------------------------------aNIDLHFH    8
DSSP  ----------------------------------------------------lLEELLLL


DSSP  LLLEelleeLLLLHHHHHHHHHHLLEEEEEEEELLlllllhhhhHHHHHHHHLLLL---L
Query IYLPfmatfAKDTHETGSKAALMGGTTTYIEMCCPsrnddalegYQLWKSKAEGNS---Y  117
ident             |       |                              |        
Sbjct SRTS----dGALTPTEVIDRAAARAPALLALTDHD---------CTGGLAEAAAAAarrG   55
DSSP  LLLL----lLLLLHHHHHHHHHLLLLLEEEELLLL---------LLLLHHHHHHHHhhlL


DSSP  LEEEEEEELLL------------llllhhHHHHH--------------------------
Query CDYTFHMAVSK------------fdekteGQLRE--------------------------  139
ident         ||                     |                            
Sbjct IPFLNGVEVSVswgrhtvhivglgidpaePALAAglksiregrlerarqmgasleaagia  115
DSSP  LLEEEEEEEEEeelleeeeeeeellllllHHHHHhhhhhhllhhhhhhhhhhhhhhllll


DSSP  -----------------------------------hhhlllleeeeeellLLLLlllhhH
Query -----------------------------------ivadgissfxiflsyKNFFgvddgE  164
ident                                                             
Sbjct gcfdgamrwcdnpemisrthfarhlvdsgavkdmrtvfrkyltpgkpgyvSHQW----aS  171
DSSP  lhhhhhhlllllhhhllhhhhhhhhhhllllllhhhhhhhllllllllllLLLL----lL


DSSP  HHHHHHHHHHHLLEEEEE-ELLHhhhhhhhhhhhhlllllhhhllllllhhHHHH-hHHH
Query MYQTLRLAKELGVIVTAH-CENAelvgrlqqkllsegktgpewhepsrpeaVEAE-gTAR  222
ident            |                                               |
Sbjct LEDAVGWIVGAGGMAVIAhPGRY----------------------------DMGRtlIER  203
DSSP  HHHHHHHHHHLLLEEEELlHHHL----------------------------LLLHhhHHH


DSSP  HHHHHHHHlLEEEEL----LLLLHHHHHHHHHHHHllLLEEEEeehhhhhllhhhhhllh
Query FATFLETTgATGYVV----HLSCKPALDAAMAAKArgVPIYIEsviphflldktyaergg  278
ident                      |       |  |       |                   
Sbjct LILDFQAA-GGQGIEvasgSHSLDDMHKFALHADR--HGLYAS-----------------  243
DSSP  HHHHHHHL-LLLEEEeeelLLLHHHHHHHHHHHHH--HLLEEE-----------------


DSSP  hhhhlllllllllllhhhhhhhhhhhllllleEELLLLLLLhhhhhhhlllhhhllllLL
Query veamkyimspplrdkrnqkvlwdalaqgfidtVGTDHCPFDteqkllgkeaftaipngIP  338
ident                                  | |                        
Sbjct --------------------------------SGSDFHAPG-----------------ED  254
DSSP  --------------------------------EELLLLLLL-----------------LL


DSSP  LLllhhhhhhhhhlllllllhhhhhhhhlhHHHHHLLLlllllllllllllleeeeelll
Query AIedrvnllytygvsrgrldihrfvdaastKAAKLFGLfprkgtiavgsdadlvvydpqy  398
ident                                                             
Sbjct VG------------------htedlppicrPIWRELEA----------------------  274
DSSP  LL------------------llllllllllLHHHHLHH----------------------


DSSP  leellhhhllllllllllllleelleeeeeeELLEeeeelleelllllllllllllllll
Query rgtisvktqhvnndyngfegfeidgrpsvvtVRGKvavrdgqfvgekgwgkllrrepmyf  458
ident                                                             
Sbjct ---------------------------rilrPADA-----------------------en  284
DSSP  ---------------------------hlllLLHH-----------------------hl


No 58: Query=1gkpA Sbjct=2anuA Z-score=5.6

back to top
DSSP  leeeelleeeelleeeeleeeelllllleeellllllllleeeelllleeEELEEEEEEL
Query pllikngeiitadsrykadiyaegetitrigqnleappgtevidatgkyvFPGFIDPHVH   60
ident                                                        | |||
Sbjct -------------------------------------------------tEWLLCDFHVH   11
DSSP  -------------------------------------------------lEEEEEEEEEL


DSSP  LLLEelleELLLLHHHHHHHHHHLLEEEEEEEELLLLL--------------llHHHHHH
Query IYLPfmatFAKDTHETGSKAALMGGTTTYIEMCCPSRN--------------ddALEGYQ  106
ident                         |                                  |
Sbjct TNXS----DGHLPLGEVVDLFGKHGVDVVSITDHIVDRrtleqrkrngeplgaiTEDKFQ   67
DSSP  LLLL----LLLLLHHHHHHHHHHLLLLEEEEEEEEELHhhhhhhhhllllllllLLLLHH


DSSP  HHHHHHLLLL-------lLEEE-EEEE------------------LLLLlllhhhhhhhh
Query LWKSKAEGNS-------yCDYT-FHMA------------------VSKFdektegqlrei  140
ident                                                             
Sbjct DYLKRLWREQkraweeygXILIpGVEItnntdlyhivavdvkeyvDPSL-----------  116
DSSP  HHHHHHHHHHhhhhhhhlLEEEeEEEEeelllleeeeeellllllLLLL-----------


DSSP  hhlllleeeeeelllllllllhhHHHHHHHHHHHHLLEEEEEEllhhhhhhhhhhhhhll
Query vadgissfxiflsyknffgvddgEMYQTLRLAKELGVIVTAHCenaelvgrlqqkllseg  200
ident                                 ||    | |                   
Sbjct -----------------------PVEEIVEKLKEQNALVIAAH-----------------  136
DSSP  -----------------------LHHHHHHHHHHLLLEEEELL-----------------


DSSP  lllhhhllllllHHHHhHHHHHhHHHHHhhLLEEEELllllhhhhhhhhhhhhlllleee
Query ktgpewhepsrpEAVEaEGTARfATFLEttGATGYVVhlsckpaldaamaakargvpiyi  260
ident                     |                                       
Sbjct --------pdrkKLSW-YLWAN-XERFK--DTFDAWE-----------------------  161
DSSP  --------llllLLLL-HHHHL-LLLLL--LLLLEEE-----------------------


DSSP  EEEHHHHhllhhhhhllhhhhhlllllllllllhhhhhhhhhhhllllLEEELLLLLllh
Query ESVIPHFlldktyaerggveamkyimspplrdkrnqkvlwdalaqgfiDTVGTDHCPfdt  320
ident                                                      |      
Sbjct IANRDDL-------------------------------fnsvgvkkyrYVANSDFHE---  187
DSSP  EEELLEE-------------------------------lhhhhhllllEEEELLLLL---


DSSP  hhhhhhlllhhhllllLLLLllhhhhhhhhhlllllllhhhhhhhHLHH----hhHHLLL
Query eqkllgkeaftaipngIPAIedrvnllytygvsrgrldihrfvdaASTK----aaKLFGL  376
ident                                                 |           
Sbjct ---------------lWHVY----------------------swkTLVKseknieAIKEA  210
DSSP  ---------------hHHHL----------------------leeEEEEelllhhHHHHH


DSSP  lllllllllllllleeeeelllleellhhhllllllllllllleelleeeeeeelleeee
Query fprkgtiavgsdadlvvydpqyrgtisvktqhvnndyngfegfeidgrpsvvtvrgkvav  436
ident                                                             
Sbjct ------------------------------------------------------------  210
DSSP  ------------------------------------------------------------


DSSP  elleelllllllllllllllll
Query rdgqfvgekgwgkllrrepmyf  458
ident                       
Sbjct --------irkntdvaiylxrk  224
DSSP  --------hhhllleeeeelll


No 59: Query=1gkpA Sbjct=3e38A Z-score=5.6

back to top
DSSP  leeeelleeEELLEeeeleeeelllllleeellllllllleeeelllleeeELEEEEEEL
Query pllikngeiITADSrykadiyaegetitrigqnleappgtevidatgkyvfPGFIDPHVH   60
ident             |                                          | | |
Sbjct aqrrneiqvPDLDG-----------------------------------ytTLKCDFHXH   25
DSSP  lllllllllLLLLL-----------------------------------leEEEEELLLL


DSSP  LLLeelleELLLLHHHHHHHHHHLLEEEEEEEELLL---llllhhHHHHHHHHHHLLLL-
Query IYLpfmatFAKDTHETGSKAALMGGTTTYIEMCCPS---rnddalEGYQLWKSKAEGNS-  116
ident                     |   |                                   
Sbjct SVF----sDGLVWPTVRVDEAYRDGLDAISLTEHIEyrphkqdvvSDHNRSFDLCREQAe   81
DSSP  LLL----lLLLLLHHHHHHHHHHLLLLEELLEEELLlllllllllLLLLHHHHHHHHHHh


DSSP  --LLEEEEEEELLlllllhhhhhhhhhhlllleeeeeelllllLLLL-------------
Query --YCDYTFHMAVSkfdektegqlreivadgissfxiflsyknfFGVD-------------  161
ident                                                             
Sbjct klGILLIKGSEIT------------------------------RAXApghfnaiflsdsn  111
DSSP  hhLLEELLEEEEE------------------------------LLLLlleeeeelllllh


DSSP  ---hhHHHHHHHHHHHHLLEEE-EEEL--lHHHHhhhhhhhhhlllllhhhllllllhhH
Query ---dgEMYQTLRLAKELGVIVT-AHCE--nAELVgrlqqkllsegktgpewhepsrpeaV  215
ident            | ||  |      |                                   
Sbjct pleqkDYKDAFREAKKQGAFXFwNHPGwdsQQPD-------------------------T  146
DSSP  hhlllLHHHHHHHHHHLLLEEEeLLLLlllLLLL-------------------------L


DSSP  HHHhhHHHHHHHHHHLLEEEELLL----LLHHHHHHHHHHHhllllEEEEeehhhhhllh
Query EAEgtARFATFLETTGATGYVVHL----SCKPALDAAMAAKargvpIYIEsviphflldk  271
ident          | |   |                |                           
Sbjct TKW--WPEHTALYQEGCXHGIEVAnghlYXPEAIQWCLDKN-----LTXI----------  189
DSSP  LLL--LHHHHHHHHLLLLLEEEEEelleELLHHHHHHHHHL-----LEEE----------


DSSP  hhhhllhhhhhlllllllllllhhhhhhhhhhhllllleEELLLLLLlhhhhhhhlllhh
Query tyaerggveamkyimspplrdkrnqkvlwdalaqgfidtVGTDHCPFdteqkllgkeaft  331
ident                                           |                 
Sbjct ---------------------------------------GTSDIHQP-------------  197
DSSP  ---------------------------------------EELLLLLL-------------


DSSP  hllllllllllhhhHHHHHHlllllllhhhhhhhHLHHhhhhlllLLLL-----------
Query aipngipaiedrvnLLYTYGvsrgrldihrfvdaASTKaaklfglFPRK-----------  380
ident                                                             
Sbjct ---------iqtdyDFEKGE----------hrtxTFVF-------AKERslqgirealdn  231
DSSP  ---------hhhhlLHHHLL----------llleEEEE-------ELLLlhhhhhhhhhl


DSSP  ---------------------------------lllllllllleeeEELLlleellhhhl
Query ---------------------------------gtiavgsdadlvvYDPQyrgtisvktq  407
ident                                                             
Sbjct rrtaayfhelligredllrpffekcvkieevsrneqgvtlsitnvtDLVLklkktahdtl  291
DSSP  lleeeeelleeellhhhhhhhhhhheeeeeeeeelleeeeeeeellLLLEeeeellllll


DSSP  lllllllllllleelleeeeeeelleeeeelleelllllllllllllllll
Query hvnndyngfegfeidgrpsvvtvrgkvavrdgqfvgekgwgkllrrepmyf  458
ident                                                    
Sbjct lvyfrdxtlkphtrytvrigfkqgikggdvnfevtnfivapdkglkytisl  342
DSSP  eellleeeellleeeeeeeeellllllleeeeeeeeeeeelleeeeeeeel