Results: dupa

Query: 1bksA

MOLECULE: TRYPTOPHAN SYNTHASE;

Select neighbours (check boxes) for viewing as multiple structural alignment or 3D superimposition. The list of neighbours is sorted by Z-score. Similarities with a Z-score lower than 2 are spurious. Each neighbour has links to pairwise structural alignment with the query structure, and to the PDB format coordinate file where the neighbour is superimposed onto the query structure.

Expand gaps

Summary

    No:  Chain   Z    rmsd lali nres  %id PDB  Description
   1:  1bks-A 49.7  0.0  255   255  100 PDB  MOLECULE: TRYPTOPHAN SYNTHASE;                                       
   2:  2oof-A  8.5  3.9  179   403   11 PDB  MOLECULE: 4-IMIDAZOLONE-5-PROPANOATE AMIDOHYDROLASE;                 
   3:  3cjp-A  8.5  3.9  180   262    6 PDB  MOLECULE: PREDICTED AMIDOHYDROLASE, DIHYDROOROTASE FAMILY;           
   4:  2paj-A  8.5  3.9  178   421    8 PDB  MOLECULE: PUTATIVE CYTOSINE/GUANINE DEAMINASE;                       
   5:  3nqb-A  8.4  3.5  174   587    7 PDB  MOLECULE: ADENINE DEAMINASE 2;                                       
   6:  1a4m-A  8.2  4.1  179   349    9 PDB  MOLECULE: ADENOSINE DEAMINASE;                                       
   7:  4cqb-A  8.1  3.9  185   402   12 PDB  MOLECULE: N-ISOPROPYLAMMELIDE ISOPROPYL AMIDOHYDROLASE;              
   8:  2vun-A  8.1  3.8  168   385    7 PDB  MOLECULE: ENAMIDASE;                                                 
   9:  2imr-A  7.7  3.6  179   380   11 PDB  MOLECULE: HYPOTHETICAL PROTEIN DR_0824;                              
  10:  1k6w-A  7.7  3.7  172   423    9 PDB  MOLECULE: CYTOSINE DEAMINASE;                                        
  11:  2uz9-A  7.7  3.8  179   444    6 PDB  MOLECULE: GUANINE DEAMINASE;                                         
  12:  1gkp-A  7.7  4.8  180   458    8 PDB  MOLECULE: HYDANTOINASE;                                              
  13:  3mkv-A  7.6  3.6  166   414    7 PDB  MOLECULE: PUTATIVE AMIDOHYDROLASE;                                   
  14:  3ls9-A  7.6  3.9  185   453    8 PDB  MOLECULE: TRIAZINE HYDROLASE;                                        
  15:  3giq-A  7.6  3.9  186   475    6 PDB  MOLECULE: N-ACYL-D-GLUTAMATE DEACYLASE;                              
  16:  4dlf-A  7.5  3.6  176   287    8 PDB  MOLECULE: AMIDOHYDROLASE 2;                                          
  17:  1yrr-B  7.5  3.8  165   334   11 PDB  MOLECULE: N-ACETYLGLUCOSAMINE-6-PHOSPHATE DEACETYLASE;               
  18:  4mup-B  7.4  4.0  181   286    9 PDB  MOLECULE: AMIDOHYDROLASE;                                            
  19:  1itq-A  7.4  3.6  178   369    9 PDB  MOLECULE: RENAL DIPEPTIDASE;                                         
  20:  4b3z-D  7.2  4.1  177   477    8 PDB  MOLECULE: DIHYDROPYRIMIDINASE-RELATED PROTEIN 1;                     
  21:  2ffi-A  7.1  3.7  169   273    9 PDB  MOLECULE: 2-PYRONE-4,6-DICARBOXYLIC ACID HYDROLASE, PUTATIV          
  22:  4rdv-B  7.1  3.7  173   451   12 PDB  MOLECULE: N-FORMIMINO-L-GLUTAMATE IMINOHYDROLASE;                    
  23:  3dcp-A  7.0  3.7  156   277   10 PDB  MOLECULE: HISTIDINOL-PHOSPHATASE;                                    
  24:  4c5y-A  6.9  3.8  162   436    9 PDB  MOLECULE: OCHRATOXINASE;                                             
  25:  1j6p-A  6.9  3.7  177   407    7 PDB  MOLECULE: METAL-DEPENDENT HYDROLASE OF                               
  26:  1onx-A  6.7  3.8  174   390   11 PDB  MOLECULE: ISOASPARTYL DIPEPTIDASE;                                   
  27:  4qrn-A  6.7  3.7  169   352   12 PDB  MOLECULE: 5-CARBOXYVANILLATE DECARBOXYLASE;                          
  28:  3gri-A  6.6  3.6  166   422    7 PDB  MOLECULE: DIHYDROOROTASE;                                            
  29:  2ob3-A  6.6  3.9  176   329   11 PDB  MOLECULE: PARATHION HYDROLASE;                                       
  30:  3pnu-A  6.6  3.7  172   338   12 PDB  MOLECULE: DIHYDROOROTASE;                                            
  31:  1bf6-A  6.5  3.8  169   291    7 PDB  MOLECULE: PHOSPHOTRIESTERASE HOMOLOGY PROTEIN;                       
  32:  3k2g-B  6.5  3.8  172   358   10 PDB  MOLECULE: RESINIFERATOXIN-BINDING, PHOSPHOTRIESTERASE-               
  33:  2a3l-A  6.5  3.9  174   616    6 PDB  MOLECULE: AMP DEAMINASE;                                             
  34:  3e74-A  6.5  4.4  171   429    8 PDB  MOLECULE: ALLANTOINASE;                                              
  35:  3mtw-A  6.4  3.6  164   404    9 PDB  MOLECULE: L-ARGININE CARBOXYPEPTIDASE CC2672;                        
  36:  2y1h-B  6.4  3.6  165   265    7 PDB  MOLECULE: PUTATIVE DEOXYRIBONUCLEASE TATDN3;                         
  37:  3gg7-A  6.1  3.5  153   243   14 PDB  MOLECULE: UNCHARACTERIZED METALLOPROTEIN;                            
  38:  4hk5-D  5.8  3.9  160   380    7 PDB  MOLECULE: URACIL-5-CARBOXYLATE DECARBOXYLASE;                        
  39:  3irs-A  5.8  3.9  141   281    8 PDB  MOLECULE: UNCHARACTERIZED PROTEIN BB4693;                            
  40:  3au2-A  5.8  3.7  146   575    8 PDB  MOLECULE: DNA POLYMERASE BETA FAMILY (X FAMILY);                     
  41:  2ogj-A  5.7  3.8  156   379   10 PDB  MOLECULE: DIHYDROOROTASE;                                            
  42:  1m65-A  5.7  3.6  141   234    9 PDB  MOLECULE: HYPOTHETICAL PROTEIN YCDX;                                 
  43:  2dvt-A  5.6  3.5  152   325    6 PDB  MOLECULE: THERMOPHILIC REVERSIBLE GAMMA-RESORCYLATE DECARBO          
  44:  1a5k-C  5.4  3.8  164   566   10 PDB  MOLECULE: UREASE (GAMMA SUBUNIT);                                    
  45:  2gwg-A  5.4  3.8  159   329   10 PDB  MOLECULE: 4-OXALOMESACONATE HYDRATASE;                               
  46:  4dzi-C  5.3  4.1  166   388   11 PDB  MOLECULE: PUTATIVE TIM-BARREL METAL-DEPENDENT HYDROLASE;             
  47:  2vc5-A  5.2  3.6  148   314    8 PDB  MOLECULE: ARYLDIALKYLPHOSPHATASE;                                    
  48:  2qpx-A  4.9  4.1  153   376    7 PDB  MOLECULE: PREDICTED METAL-DEPENDENT HYDROLASE OF THE TIM-BA          
  49:  2anu-A  4.8  3.9  127   224   10 PDB  MOLECULE: HYPOTHETICAL PROTEIN TM0559;                               
  50:  1v77-A  4.8  3.5  117   202   15 PDB  MOLECULE: HYPOTHETICAL PROTEIN PH1877;                               
  51:  1j5s-A  4.7  3.1  141   451    7 PDB  MOLECULE: URONATE ISOMERASE;                                         
  52:  3qy6-A  4.6  4.5  144   247   10 PDB  MOLECULE: TYROSINE-PROTEIN PHOSPHATASE YWQE;                         
  53:  3iac-A  4.2  3.9  138   469    9 PDB  MOLECULE: GLUCURONATE ISOMERASE;                                     
  54:  3icj-A  4.1  4.2  145   468    4 PDB  MOLECULE: UNCHARACTERIZED METAL-DEPENDENT HYDROLASE;                 
  55:  3f2b-A  4.1  3.9  135   994    6 PDB  MOLECULE: DNA-DIRECTED DNA POLYMERASE III ALPHA CHAIN;               
  56:  2yb1-A  4.0  3.5  121   284    8 PDB  MOLECULE: AMIDOHYDROLASE;                                            
  57:  4ofc-A  3.8  4.0  132   335    5 PDB  MOLECULE: 2-AMINO-3-CARBOXYMUCONATE-6-SEMIALDEHYDE DECARBOX          
  58:  3e38-A  3.7  4.4  133   342   12 PDB  MOLECULE: TWO-DOMAIN PROTEIN CONTAINING PREDICTED PHP-LIKE           
  59:  3ooq-A  3.7  4.1  139   384   10 PDB  MOLECULE: AMIDOHYDROLASE;                                            


Pairwise Structural Alignments

Notation: three-state secondary structure definitions by DSSP (reduced to H=helix, E=sheet, L=coil) are shown above the amino acid sequence. Structurally equivalent residues are in uppercase, structurally non-equivalent residues (e.g. in loops) are in lowercase. Amino acid identities are marked by vertical bars.

No 1: Query=1bksA Sbjct=1bksA Z-score=49.7

back to top
DSSP  LHHHHHHHHHHHHLLLLEEEEEEELLLLLHHHHHHHHHHHHHLLLLLEEEELLLLLLLLL
Query MERYENLFAQLNDRREGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLAD   60
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct MERYENLFAQLNDRREGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLAD   60
DSSP  LHHHHHHHHHHHHLLLLEEEEEEELLLLLHHHHHHHHHHHHHLLLLLEEEELLLLLLLLL


DSSP  LHHHHHHHHHHHHHLLLHHHHHHHHHHHHHHLLLLLEEEEELHHHHHLLLHHHHHHHHHH
Query GPTIQNANLRAFAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQ  120
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct GPTIQNANLRAFAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQ  120
DSSP  LHHHHHHHHHHHHHLLLHHHHHHHHHHHHHHLLLLLEEEEELHHHHHLLLHHHHHHHHHH


DSSP  HLLLEEEELLLLHHHLHHHHHHHHHLLLEEEEEELLLLLHHHHHHHHHHLLLLEEELLLL
Query VGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPPNADDDLLRQVASYGRGYTYLLALP  180
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct VGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPPNADDDLLRQVASYGRGYTYLLALP  180
DSSP  HLLLEEEELLLLHHHLHHHHHHHHHLLLEEEEEELLLLLHHHHHHHHHHLLLLEEELLLL


DSSP  HHHHHHHHHHHLLLLEEELLLLLLHHHHHHHHHHLLLEEEELLHHHHHHHHLLLLHHHHH
Query LHHLIEKLKEYHAAPALQGFGISSPEQVSAAVRAGAAGAISGSAIVKIIEKNLASPKQML  240
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct LHHLIEKLKEYHAAPALQGFGISSPEQVSAAVRAGAAGAISGSAIVKIIEKNLASPKQML  240
DSSP  HHHHHHHHHHHLLLLEEELLLLLLHHHHHHHHHHLLLEEEELLHHHHHHHHLLLLHHHHH


DSSP  HHHHHHHHHHHHLLL
Query AELRSFVSAMKAASR  255
ident |||||||||||||||
Sbjct AELRSFVSAMKAASR  255
DSSP  HHHHHHHHHHHHLLL


No 2: Query=1bksA Sbjct=2oofA Z-score=8.5

back to top
DSSP  ------------------------------------------------lhhhhhhhhhhh
Query ------------------------------------------------meryenlfaqln   12
ident                                                             
Sbjct lncervwlnvtpatlrsdladygllephalgvhegrihalvpxqdlkypahwqdxkgklv   60
DSSP  lllleeeeeeeellllllllllllllleeeeeelleeeeeeehhhllllllleellllee


DSSP  HLLLLEEEEEEELL----------------------------------lLLHHHHHHHHH
Query DRREGAFVPFVTLG----------------------------------dPGIEQSLKIID   38
ident                                                      |      
Sbjct TPGLIDCHTHLIFAgsraeefelrqkgvpyaeiarkgggiistvratraASEDQLFELAL  120
DSSP  EELEEEEEELLLLLlllhhhhhhhhhlllhhhhhhllllhhhhhhhhhhLLHHHHHHHHH


DSSP  HHHHLL------lLLEEEELLLlllllllhhhhhhhhhhhhhllLHHHHHHHHHHHHHHL
Query TLIDAG------aDALELGVPFsdpladgptiqnanlrafaagvTPAQCFEMLALIREKH   92
ident                   |                         |       |   |   
Sbjct PRVKSLiregvttVEIKSGYGL----------------------TLEDELKXLRVARRLG  158
DSSP  HHHHHHhhhleeeEEEELLLLL----------------------LHHHHHHHHHHHHHHH


DSSP  L----LLLEEEE--ELHH-------hhHLLL-HHHHHHHHH-HHLLLEEEEL----LLLH
Query P----TIPIGLL--MYAN-------lvFNNG-IDAFYARCE-QVGVDSVLVA----DVPV  133
ident           ||                                  | | |         
Sbjct EalpiRVKTTLLaaHAVPpeyrddpdsWVETiCQEIIPAAAeAGLADAVDVFcehiGFSL  218
DSSP  HhlllEEEEEEEeeLLLLhhhlllhhhHHHHhHHLHHHHHHhLLLLLEEEEEelllLLLH


DSSP  HHLHHHHHHHHHLLLEEEEEEL-LLLLhhHHHHHHHHLLLLEEELlllHHHHHHHHHHHL
Query EESAPFRQAALRHNIAPIFICP-PNADddLLRQVASYGRGYTYLLalpLHHLIEKLKEYH  192
ident         ||     |                  |  |      |       |  |    
Sbjct AQTEQVYLAADQYGLAVKGHXDqLSNL-gGSTLAANFGALSVDHLeylDPEGIQALAHRG  277
DSSP  HHHHHHHHHHHHLLLEEEEEELlLLLL-lHHHHHHHLLLLEEEELlllLHHHHHHHHHHL


DSSP  LlLEEELLLLLL--------hhhhhhhhhhLLLEE-EELL-HHHHhhhhllllhhhhhhh
Query AaPALQGFGISS--------peqvsaavraGAAGA-ISGS-AIVKiieknlaspkqmlae  242
ident    |                            |                           
Sbjct V-VATLLPTAFYflketklppvvalrkagvPXAVSsDINPgTAPI---------------  321
DSSP  L-EEEELHHHHHhllllllllhhhhhhlllLEEELlLLLLlLLLL---------------


DSSP  hhhhhhhHHHLLL-----------------------------------------------
Query lrsfvsaMKAASR-----------------------------------------------  255
ident                                                             
Sbjct ------vSLRXAXnxactlfgltpveaxagvtrhaaralgeqeqlgqlrvgxladflvwn  375
DSSP  ------lLHHHHHhhhhhhhlllhhhhhhhllhhhhhhllllllllllllllllleeeel


DSSP  ----------------------------
Query ----------------------------  255
ident                             
Sbjct cghpaelsyligvdqlvsrvvngeetlh  403
DSSP  lllllhhhhlllllleeeeeelleelll


No 3: Query=1bksA Sbjct=3cjpA Z-score=8.5

back to top
DSSP  lhhhhhhhhhhhhllllEEEEEEelllllhhhHHHHhHHHHHLL------lLLEEEELL-
Query meryenlfaqlndrregAFVPFVtlgdpgieqSLKIiDTLIDAG------aDALELGVP-   53
ident                                  |      |            |      
Sbjct ---------------liIDGHTH--------vILPV-EKHIKIMdeagvdkTILFSTSIh   36
DSSP  ---------------llEEEEEE--------lLLLH-HHHHHHHhhhllleEEEELLLLl


DSSP  --------------lLLLLLLlhhhhhhhhhhhhhlLLHHHHHHHHHHHHHHLLL-LLEE
Query --------------fSDPLADgptiqnanlrafaagVTPAQCFEMLALIREKHPT-IPIG   98
ident                                              |       |      
Sbjct petavnlrdvkkemkKLNDVV-------ngktnsmiDVRRNSIKELTNVIQAYPSrYVGF   89
DSSP  hhhlllhhhhhhhhhHHHHHH-------lllllllhHHHHHHHHHHHHHHHHLLLlEEEE


DSSP  EEELHHhhHLLLHHHHHHH-HHHHLLLEEE-ELLL--LHHHLHHHHHHHHHLL-LEEEEE
Query LLMYANlvFNNGIDAFYAR-CEQVGVDSVL-VADV--PVEESAPFRQAALRHN-IAPIFI  153
ident           |                                |                
Sbjct GNVPVG-lSENDTNSYIEEnIVNNKLVGIGeLTPAsgQIKSLKPIFKYSMDSGsLPIWIH  148
DSSP  ELLLLL-lLHHHHHHHHHHhLLLLLLLEEEeELLLllLHHHHHHHHHHHHHLLlLLEEEL


DSSP  EL--LLLL-hHHHHHHHH---hLLLLEEEL-lLLHHHHHHHHHHHLLLLEEELLLlllhh
Query CP--PNAD-dDLLRQVAS---yGRGYTYLL-aLPLHHLIEKLKEYHAAPALQGFGisspe  206
ident                                        |  ||                
Sbjct AFnpLVLQdiKEIAELCKafpkVPVILGHMggSNWMTAVELAKEIQNLYLDTSAY----f  204
DSSP  LLllLLHHhhHHHHHHHHhlllLLEEEHHHhhHHHHHHHHHHHHLLLEEEELLLL----l


DSSP  HHHHHHHHL-----lLEEEELLHHhhhhhhllllhhhhhhhhhhHHHHHHHLLL------
Query QVSAAVRAG-----aAGAISGSAIvkiieknlaspkqmlaelrsFVSAMKAASR------  255
ident                                                    |        
Sbjct STFVLKIVInelplkCIFGTDMPF-------------------gDLQLSIEAIKkmsnds  245
DSSP  LHHHHHHHHhhllllEELLLLLLL-------------------lLHHHHHHHHHhhlllh


DSSP  -----------------
Query -----------------  255
ident                  
Sbjct yvanavlgdnisrllni  262
DSSP  hhhhhhhlhhhhhhhll


No 4: Query=1bksA Sbjct=2pajA Z-score=8.5

back to top
DSSP  ----------------------------------------------lhhhhhhhhhhhHL
Query ----------------------------------------------meryenlfaqlnDR   14
ident                                                             
Sbjct pstlirnaaaimtggrgtaddpsrvpgpdirivgdtidaigalaprpgetivdatdcvIY   60
DSSP  leeeeellleelllllllllllllllllleeeelleeeeellllllllleeeelllleEE


DSSP  LLLEE-EEEEE---------lllLLHHHHHHHHHHHHHLL------lLLEEEELLLLlll
Query REGAF-VPFVT---------lgdPGIEQSLKIIDTLIDAG------aDALELGVPFSdpl   58
ident                                                 |    |      
Sbjct PAWVNtHHHLFqsllkgepfralFDERRFRLAARIGLIELarsgcatVADHNYVYYP---  117
DSSP  ELEELlLLLHHhhhllllllhhhLLHHHHHHHHHHHHHHHhllleeeEEELLLLLLL---


DSSP  lllhhhhhhhhhhhhhllLHHHhhHHHHHHHHHLL----LLLEEEEELH-----------
Query adgptiqnanlrafaagvTPAQcfEMLALIREKHP----TIPIGLLMYA-----------  103
ident                            |   |                            
Sbjct ------------------GMPF--DSSAILFEEAEklglRFVLLRGGATqtrqleadlpt  157
DSSP  ------------------LLLL--LHHHHHHHHHHhlllEEEEEELLLLllllllllllh


DSSP  ---HHHHLlLHHHHHHHHHHHLL---------LEEEEL----LLLHHHLHHHHHHHHHLL
Query ---NLVFNnGIDAFYARCEQVGV---------DSVLVA----DVPVEESAPFRQAALRHN  147
ident             |   |                              |       | |  
Sbjct alrPETLD-AYVADIERLAARYHdaspramrrVVMAPTtvlySISPREMRETAAVARRLG  216
DSSP  hhlLLLHH-HHHHHHHHHHHHLLllllllleeEEELLLllllLLLHHHHHHHHHHHHHLL


DSSP  LEEEEEELllllHHHHHHHHH----hlLLLEEELlLLHHHHHHHHHHhLLLLEEELlLLL
Query IAPIFICPpnadDDLLRQVAS----ygRGYTYLLaLPLHHLIEKLKEyHAAPALQGfGIS  203
ident                                  |       |  |              |
Sbjct LRMHSHLS---gKSPVAFCGEhdwlgsDVWYAHLvKVDADEIALLAQ-TGTGVAHC-PQS  271
DSSP  LEEEEELL---lLLHHHHHHHllllllLEEEELLlLLLHHHHHHHHH-HLLEEEEL-HHH


DSSP  LhhhhhhhHHHL-----lLEEEELlHHHHhhhhllllhhhhhhhhhHHHHhhHHLLL---
Query SpeqvsaaVRAG-----aAGAISGsAIVKiieknlaspkqmlaelrSFVSamKAASR---  255
ident         ||                                                  
Sbjct N---grlpVREMadagvpVSIGVD-GAAS----------------nEAAD--MISEVhmt  309
DSSP  H---hlllLLLHhhhlllEEELLL-HHHH----------------lLLLL--HHHHHhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  255
ident                                                             
Sbjct wlaqrarlasiaevihwgtaggarvmgldevgkvavgyaadiavyrlddpryfglhdpai  369
DSSP  hhhhhhllllhhhhhhhhlhhhhhhhllllllllllllllleeeeelllhhhlllllhhh


DSSP  ----------------------------------------------------
Query ----------------------------------------------------  255
ident                                                     
Sbjct gpvasggrpsvmalfsagkrvvvddliegvdikelggearrvvrellrevvv  421
DSSP  hhhhllllleeeeeeelleeeeellllllllhhhhhhhhhhhhhhhhhhhhl


No 5: Query=1bksA Sbjct=3nqbA Z-score=8.4

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct epadlnddtlraravaaargdqrfdvlitggtlvdvvtgelrpadigivgaliasvhepa   60
DSSP  llhhhllhhhhhhhhhhhhlllleeeeeelleeelllllleeeleeeeelleeeeeelll


DSSP  ----lhhhhhhhhhhhhlllleeeEEEElllllhhHHHHHHHHHHHLLL-LLEEEELLll
Query ----meryenlfaqlndrregafvPFVTlgdpgieQSLKIIDTLIDAGA-DALELGVPfs   55
ident                                                |            
Sbjct srrdaaqvidaggayvspglidthXHIE---ssxiTPAAYAAAVVARGVtTIVWDPHE--  115
DSSP  lllleeeeeelllleeeeleeeeeELHH---hhllLHHHHHHHHHLLLEeEEEELLHH--


DSSP  llllllhhhhhhhhhhhhhlLLHHHHHHHHHHHHHHL-lLLLEEEEELH-----------
Query dpladgptiqnanlrafaagVTPAQCFEMLALIREKH-pTIPIGLLMYA-----------  103
ident                     |         |   |                         
Sbjct -----------------fgnVHGVDGVRWAAKAIENLplRAILLAPSCVpsapglergga  158
DSSP  -----------------hhhHHLHHHHHHHHHHHLLLllEEEEEELLLLlllllllllll


DSSP  HHHHlLLHHHHHHHhhhHLLLEEEeLLLLHHH------LHHHHHHHHHLLLEEEEEELlL
Query NLVFnNGIDAFYARceqVGVDSVLvADVPVEE------SAPFRQAALRHNIAPIFICPpN  157
ident                                            || |             
Sbjct DFDA-AILADLLSW---PEIGGIAeIXNXRGVierdprXSGIVQAGLAAEKLVCGHAR-G  213
DSSP  LLLH-HHHHHHHLL---LLEEEEEeELLHHHHhlllhhHHHHHHHHHHHLLEEEELLL-L


DSSP  LLHHHHHHHH-HHLLllEEEL---lLLHHHHHHHHhhhllLLEEELllLLLHHHHHHHHH
Query ADDDLLRQVA-SYGRgyTYLL---aLPLHHLIEKLkeyhaAPALQGfgISSPEQVSAAVR  213
ident      |                     |                     |        | 
Sbjct LKNADLNAFXaAGVS--SDHElvsgEDLXAKLRAG-----LTIELR--GSHDHLLPEFVA  264
DSSP  LLHHHHHHHHhLLLL--EELLlllhHHHHHHHHLL-----LEEEEE--LLLHHHHHHHHH


DSSP  HL--------lLEEEELLhHHHHhhhllllhhhhhhHHHHHH--HHHHHLLL--------
Query AG--------aAGAISGSaIVKIieknlaspkqmlaELRSFV--SAMKAASR--------  255
ident |                                    |                      
Sbjct ALntlghlpqtVTLCTDD-VFPD-------------DLLQGGglDDVVRRLVryglkpew  310
DSSP  HHhhhllllllEEEELLL-LLHH-------------HHHHLLlhHHHHHHHHhllllhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  255
ident                                                             
Sbjct alraatlnaaqrlgrsdlgliaagrradivvfedlngfsarhvlasgravaeggrxlvdi  370
DSSP  hhhhhlhhhhhhhllllllllllllllleeeellllllleeeeeelleeeeelleellll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  255
ident                                                             
Sbjct ptcdttvlkgsxklplrxandflvksqgakvrlatidrprftqwgeteadvkdgfvvppe  430
DSSP  lllllhhhllllllllllhhhhllllllleeeeeeeellllleeeeeeeeeelleellll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  255
ident                                                             
Sbjct gatxisvthrhgxaepttktgfltgwgrwngafattvshdshnltvfggnagdxalaana  490
DSSP  leeeeeeellllllllleeeeeeellllllleeeelllllllleeeeellhhhhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  255
ident                                                             
Sbjct vigtgggxavasegkvtailplplsglvsdapleevarafedlreavgkvvewqppylvf  550
DSSP  hhhllleeeeeelleeeeeeelllllllllllhhhhhhhhhhhhhhhhhhlllllllllh


DSSP  -------------------------------------
Query -------------------------------------  255
ident                                      
Sbjct kacfgatlacnigphqtdxgiadvltgkvxespviev  587
DSSP  hhhhlllllllllleelllleeelllleeellleeel


No 6: Query=1bksA Sbjct=1a4mA Z-score=8.2

back to top
DSSP  lhhhhhhhhhhhhlllLEEE-EEEE-----------------------------------
Query meryenlfaqlndrreGAFV-PFVT-----------------------------------   24
ident                                                             
Sbjct ---------tpafnkpKVELhVHLDgaikpetilyfgkkrgialpadtveelrniigmdk   51
DSSP  ---------lllllllEEEEeEEHHhlllhhhhhhhhhhhllllllllhhhhhhhhllll


DSSP  ----------------llllLHHHHHHHHHHHHHLL------lLLEEEELLL-------L
Query ----------------lgdpGIEQSLKIIDTLIDAG------aDALELGVPF-------S   55
ident                       |    |                                
Sbjct plslpgflakfdyympviagCREAIKRIAYEFVEMKakegvvyVEVRYSPHLlanskvdP  111
DSSP  lllhhhhhllhhhhhhhhllLHHHHHHHHHHHHHHHhhlleeeEEEEELLHHhllllllL


DSSP  LLLlllhhhhhhhhhhhHHLLLHHHHHHHHHHHHHHLL-----LLLEEEEEL---HHHHH
Query DPLadgptiqnanlrafAAGVTPAQCFEMLALIREKHP-----TIPIGLLMY---ANLVF  107
ident  |                  |||                         |           
Sbjct MPW-----------nqtEGDVTPDDVVDLVNQGLQEGEqafgiKVRSILCCMrhqPSWSL  160
DSSP  LHH-----------hllLLLLLHHHHHHHHHHHHHHHHhhhllEEEEEEEEElllHHHHH


DSSP  lllhhhHHHHHHHHL---LLEEEELL-----lLHHH--LHHHHHHHHHLLLEEEEEELLL
Query nngidaFYARCEQVG---VDSVLVAD-----vPVEE--SAPFRQAALRHNIAPIFICPPN  157
ident           |       |     |                    |    |         
Sbjct -----eVLELCKKYNqktVVAMDLAGdetiegSSLFpgHVEAYEGAVKNGIHRTVHAGEV  215
DSSP  -----hHHHHHHHLLlllEEEEEEELllllllHHHLhhHHHHHHHHHHHLLEEEEEELLL


DSSP  LLHHHHHHHHH--HLLLlEEEL--lLLHHHHHHHHHHHLLlLEEELLLL-----llhhhh
Query ADDDLLRQVAS--YGRGyTYLL--aLPLHHLIEKLKEYHAaPALQGFGI-----sspeqv  208
ident       |                       |   |                         
Sbjct GSPEVVREAVDilKTER-VGHGyhtIEDEALYNRLLKENM-HFEVCPWSsyltgawdpkt  273
DSSP  LLHHHHHHHHHllLLLE-EEELhhhHHLHHHHHHHHHLLL-EEEELHHHhhhllllllll


DSSP  hHHHHHL-----lLEEEELLHHHHHhhhllllhhhhhhhhhhhhhhHHHL----------
Query sAAVRAG-----aAGAISGSAIVKIieknlaspkqmlaelrsfvsaMKAA----------  253
ident   ||                                                        
Sbjct tHAVVRFkndkanYSLNTDDPLIFK--------------------sTLDTdyqmtkkdmg  313
DSSP  lLHHHHHhhllllEEELLLLLLLLL--------------------lLHHHhhhhhhhlll


DSSP  ----------------------------------ll
Query ----------------------------------sr  255
ident                                     
Sbjct fteeefkrlninaakssflpeeekkellerlyreyq  349
DSSP  llhhhhhhhhhhhhhlllllhhhhhhhhhhhhhhll


No 7: Query=1bksA Sbjct=4cqbA Z-score=8.1

back to top
DSSP  --------------------------------------lhhhhhhhhhhhhllllEEEEE
Query --------------------------------------meryenlfaqlndrregAFVPF   22
ident                                                             
Sbjct skdfdliirnaylsekdsvydigivgdriikieakiegtvkdeidakgnlvspgfVDAHT   60
DSSP  llleeeeeeeeeelllleeeeeeeelleeeeeelllllleeeeeellllleeeleEEEEE


DSSP  EELLLLL-----------------------------------HHHHHHHHHHHHHLLL-L
Query VTLGDPG-----------------------------------IEQSLKIIDTLIDAGA-D   46
ident                                                         |   
Sbjct HMDKSFTstgerlpkfwsrpytrdaaiedglkyyknatheeiKRHVIEHAHMQVLHGTlY  120
DSSP  LHHHLLLlllllllllllllllhhhhhhhhhhhhhhllhhhhHHHHHHHHHHHHHLLEeE


DSSP  LEEEELlllllllllhhhhhhhhhhhhhllLHHHHHHHHHHHHHHLL---LLLEEEE-EL
Query ALELGVpfsdpladgptiqnanlrafaagvTPAQCFEMLALIREKHP---TIPIGLL-MY  102
ident                                     |      |       |        
Sbjct TRTHVD--------------------vdsvAKTKAVEAVLEAKEELKdliDIQVVAFaQS  160
DSSP  EEEEEE--------------------llllLLLHHHHHHHHHHHHLLlllEEEEEEElLL


DSSP  HHhhHLLLHhHHHHHHHHHLLLEEEELLL-----LHHH-LHHHHHHHHHLLLEEEE-EEL
Query ANlvFNNGIdAFYARCEQVGVDSVLVADV-----PVEE-SAPFRQAALRHNIAPIF-ICP  155
ident                    | | |   |       ||         |          |  
Sbjct GFfvDLESE-SLIRKSLDMGCDLVGGVDPatrenNVEGsLDLCFKLAKEYDVDIDYhIHD  219
DSSP  LLllLLLHH-HHHHHHHHHLLLEEELLLLlllllLHHHhHHHHHHHHHHLLLEEEEeELL


DSSP  LLLL-hHHHHHHHHH-------lLLLEEEL-------LLLHHHHhHHHHHHLLLLEEELl
Query PNAD-dDLLRQVASY-------gRGYTYLL-------ALPLHHLiEKLKEYHAAPALQGf  200
ident             |          |  |             |      |            
Sbjct IGTVgvYSINRLAQKtiengykgRVTTSHAwcfadapSEWLDEA-IPLYKDSGMKFVTC-  277
DSSP  LHHHhhHHHHHHHHHhhhlllllLEEEEELlhhhhllHHHHHHH-HHHHHHHLLEEEEE-


DSSP  lLLLHhhhhHHHHHL-----LLEEEELLH---hHHHHhhllllhhhhhhhhhhHHHHHHH
Query gISSPeqvsAAVRAG-----AAGAISGSA---iVKIIeknlaspkqmlaelrsFVSAMKA  252
ident   ||       |          |  |       |                          
Sbjct -FSST-pptMPVIKLleagiNLGCASDNIrdfwVPFG--------------ngDMVQGAL  321
DSSP  -LLLL-lllLLHHHHhhlllEEEEELLLLllllLLLL--------------llLHHHHHH


DSSP  LLL---------------------------------------------------------
Query ASR---------------------------------------------------------  255
ident                                                             
Sbjct IETqrlelktnrdlgliwkmitsegarvlgieknygievgkkadlvvlnslspqwaiidq  381
DSSP  HHHhhhllllhhhhhhhhhhhlhhhhhhhllhhhlllllllllleeeellllhhhhhhhl


DSSP  ---------------------
Query ---------------------  255
ident                      
Sbjct akrlcvikngriivkdeviva  402
DSSP  lleeeeeelleeeeelleell


No 8: Query=1bksA Sbjct=2vunA Z-score=8.1

back to top
DSSP  -lhhhhhhhhhhHHLL--------------------------------------------
Query -meryenlfaqlNDRR--------------------------------------------   15
ident                                                             
Sbjct sktiiknigkivSGDIkspvlqadtivvedgliaaiggeelmkdagdatiidaagstvtp   60
DSSP  leeeeellleeeLLLLllleellleeeeelleeeeeelhhhhlllllleeeelllleeee


DSSP  llEEEEEEELllllhhhHHHH-----hhHHHHLL-----lLLEE-EELLllllllllhhh
Query egAFVPFVTLgdpgieqSLKI-----idTLIDAG-----aDALE-LGVPfsdpladgpti   64
ident                               |                             
Sbjct glLDTHVHVS-------GGDYaprqktmDFISSAlhggvtTMISaGSPH-----------  102
DSSP  leEEEEELLL-------LLLEehhhleeLHHHHHhllleeEEEElLLLL-----------


DSSP  hhhhhhhhhHLLL------hhhhHHHHHHHHHHL---lLLLEeEEELHHHHhlllHHHHH
Query qnanlrafaAGVT------paqcFEMLALIREKH---pTIPIgLLMYANLVfnngIDAFY  115
ident           |                                                 
Sbjct --------fPGRPkdaagtkalaITLSKSYYNARpagvKVHGgAVILEKGL----TEEDF  150
DSSP  --------lLLLLllhhhhhhhhHHHHHHHHHLLhhhlEEELlEELLLLLL----LHHHH


DSSP  HHHHHHLLLEEE---eLLLL-HHHLHHHHHHHHHLLLEEEEEELL------LLLHhhHHH
Query ARCEQVGVDSVL---vADVP-VEESAPFRQAALRHNIAPIFICPP------NADDdlLRQ  165
ident       ||  |           |  ||    |  |                         
Sbjct IEMKKEGVWIVGevglGTIKnPEDAAPMVEWAHKHGFKVQMHTGGtsipgsSTVT--ADD  208
DSSP  HHHHHLLLLEEEeellLLLLlHHHHHHHHHHHHHLLLEEEEELLLllllllLLLL--HHH


DSSP  HHHHLLLLEEEL----lllHHHHHHHHHHHLLLLEEELLLLllhhhhhhHHHHL------
Query VASYGRGYTYLL----alpLHHLIEKLKEYHAAPALQGFGIsspeqvsaAVRAG------  215
ident |                                                           
Sbjct VIKTKPDVVSHInggptaiSVQEVDRIMDETDFAMEIVQCG-----npkIADYVarraae  263
DSSP  HHHHLLLEEELLlllllllLHHHHHHHHHHLLLEEEEELLL-----lhhHHHHHhhhhhh


DSSP  -----lLEEEELLhHHHHhhhllllhhhhhhhhhhhHHHHHHLLL---------------
Query -----aAGAISGSaIVKIieknlaspkqmlaelrsfVSAMKAASR---------------  255
ident                                                             
Sbjct kgqlgrVIFGNDA-PSGT----------------glIPLGILRNMcqiasmsdidpevav  306
DSSP  hllhhhEEEELLL-LLLL----------------llLLLHHHHHHhhhhhhllllhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  255
ident                                                             
Sbjct cmatgnstavyglntgviapgkeadliimdtplgsvaedamgaiaagdipgisvvlidge  366
DSSP  hhhlhhhhhhhlllllllllllllleeeeelllllllllhhhhhhhlllleeeeeeelle


DSSP  -------------------
Query -------------------  255
ident                    
Sbjct avvtksrntppakraakil  385
DSSP  eeellllllllllllleel


No 9: Query=1bksA Sbjct=2imrA Z-score=7.7

back to top
DSSP  lhhhhhhhhhhHHLL----------------------------------------lleEE
Query meryenlfaqlNDRR----------------------------------------egaFV   20
ident                                                             
Sbjct htprlltcdvlYTGAqspggvvvvgetvaaaghpdelrrqyphaaeeragaviapppvNA   60
DSSP  lleeeeeeleeELLEelleeeeeelleeeeeelhhhhhhhlllleeeellleelllllEE


DSSP  EEEEL-----------------------lLLLHHHHHHHHHHHHHLL-LLLEEEELllll
Query PFVTL-----------------------gDPGIEQSLKIIDTLIDAG-ADALELGVpfsd   56
ident                                |        |||   |             
Sbjct HTHLDmsayefqalpyfqwipevvirgrhLRGVAAAQAGADTLTRLGaGGVGDIVW----  116
DSSP  EEELLllhhhhhhlhhhhllhhhhhhhllLLHHHHHHHHHHHHHHLLlLLEEEEEL----


DSSP  lllllhhhhhhhhhhhhhlllHHHHHHHHHHhHHHLllLLEEEEELHH------hhHLLL
Query pladgptiqnanlrafaagvtPAQCFEMLALiREKHptIPIGLLMYAN------lvFNNG  110
ident                             |   ||             |            
Sbjct ---------------------APEVMDALLA-REDL--SGTLYFEVLNpfpdkadeVFAA  152
DSSP  ---------------------LHHHHHHHHL-LLLL--LEEEEEEELLllhhhhhhHHHH


DSSP  HHHHHHHHHHHL----LLEEEEL---LLLHHHLHHHHHHHHHLLLEEEEEEL--------
Query IDAFYARCEQVG----VDSVLVA---DVPVEESAPFRQAALRHNIAPIFICP--------  155
ident       |                    |           |                    
Sbjct ARTHLERWRRLErpglRLGLSPHtpfTVSHRLMRLLSDYAAGEGLPLQIHVAehptelem  212
DSSP  HHHHHHHHHLLLllleEEEEEELlllLLLHHHHHHHHHHHHHHLLLLEEEELllhhhhhh


DSSP  --------------------------------llLLHHHHH-HHHHHLLlLEEELllLHH
Query --------------------------------pnADDDLLR-QVASYGRgYTYLLalPLH  182
ident                                       |    |                
Sbjct frtgggplwdnrmpalyphtlaevigrepgpdltPVRYLDElGVLAARP-TLVHMvnVTP  271
DSSP  hhhlllllhhhllhhhllllhhhhhlllllllllHHHHHHHhLLHHHLL-EEEELllLLH


DSSP  HHHHHHHHHLlLLEEELlLLLL-hhhhhHHHHHL-----lLEEEELLhHHHHhhhllllh
Query HLIEKLKEYHaAPALQGfGISS-peqvsAAVRAG-----aAGAISGSaIVKIieknlasp  236
ident   |                             |             |             
Sbjct DDIARVARAG-CAVVTCpRSNHhlecgtFDWPAFaaagveVALGTDS-VASG--------  321
DSSP  HHHHHHHHHL-LLEEELhHHHHhlllllLLHHHHhhllllEEELLLL-HHHH--------


DSSP  hhhhhhhhhHHHHHHHLLL-----------------------------------------
Query kqmlaelrsFVSAMKAASR-----------------------------------------  255
ident           |       |                                         
Sbjct ------etlNVREEVTFARqlypgldprvlvraavkggqrvvgtpflrrgetwqegfrwe  375
DSSP  ------lllLLHHHHHHHHhhlllllhhhhhhhhhhhhhhhhllllllllllllhhhlhh


DSSP  -----
Query -----  255
ident      
Sbjct lsrdl  380
DSSP  hllll


No 10: Query=1bksA Sbjct=1k6wA Z-score=7.7

back to top
DSSP  -------------------------------------lhhhhhhhhhhhHLLLLEEE-EE
Query -------------------------------------meryenlfaqlnDRREGAFV-PF   22
ident                                                             
Sbjct alqtiinarlpgeeglwqihlqdgkisaidaqsgvmpitensldaeqglVIPPFVEPhIH   60
DSSP  llleeeeellllllleeeeeeelleeeeeeeellllllllleeelllleEELLEEEEeEL


DSSP  EE--------------------------lllLLHHHHHHHHHHHHHLL------lLLEEE
Query VT--------------------------lgdPGIEQSLKIIDTLIDAG------aDALEL   50
ident                                                             
Sbjct LDttqtagqpnwnqsgtlfegierwaerkalLTHDDVKQRAWQTLKWQiangiqhVRTHV  120
DSSP  LLlllllllllllllllhhhhhhhhhllhhhLLHHHHHHHHHHHHHHHhhlleeeEEEEE


DSSP  ELlllllllllhhhhhhhhhhhhhllLHHHHHHHHHHHHHHLL---LLLEEEE-ELHHhh
Query GVpfsdpladgptiqnanlrafaagvTPAQCFEMLALIREKHP---TIPIGLL-MYANlv  106
ident  |                                               |          
Sbjct DV----------------------sdATLTALKAMLEVKQEVApwiDLQIVAFpQEGIls  158
DSSP  EL----------------------llLLLHHHHHHHHHHHHHLlllEEEEEEElLLLLll


DSSP  HLLLHhhHHHHHHHHLLLEEEELL-------lLHHHLHHHHHHHHHLLLEEEE-EELLLL
Query FNNGIdaFYARCEQVGVDSVLVAD-------vPVEESAPFRQAALRHNIAPIF-ICPPNA  158
ident   ||           | | |             ||        |                
Sbjct YPNGE-aLLEEALRLGADVVGAIPhfeftreyGVESLHKTFALAQKYDRLIDVhCDEIDD  217
DSSP  LLLHH-hHHHHHHHLLLLEEEELHhhlllhhhHHHHHHHHHHHHHHHLLEEEEeELLLLL


DSSP  L-hHHHHHHHHHL-------LLLEEEL------lllhhhhhHHHHHHLLLLEEELLLL--
Query D-dDLLRQVASYG-------RGYTYLL------alplhhliEKLKEYHAAPALQGFGI--  202
ident         ||          |                      |                
Sbjct EqsRFVETVAALAhhegmgaRVTASHTtamhsyngaytsrlFRLLKMSGINFVANPLVni  277
DSSP  LllLHHHHHHHHHhhhllhhHEEEEELhhhhhllhhhhhhhHHHHHHHLLEEEELHHHhh


DSSP  --------llhhhhhhhHHHL-----lLEEEELLHHHHHhhhllllhhhhhhhhhHHHHh
Query --------sspeqvsaaVRAG-----aAGAISGSAIVKIieknlaspkqmlaelrSFVSa  249
ident                  |                                          
Sbjct hlqgrfdtypkrrgitrVKEMlesginVCFGHDDVFDPW-------------yplGTAN-  323
DSSP  hhlllllllllllllllHHHHhhllllEEELLLLLLLLL-------------lllLLLL-


DSSP  hHHLL-------------------------------------------------------
Query mKAAS-------------------------------------------------------  254
ident                                                             
Sbjct -MLQVlhmglhvcqlmgygqindglnlithhsartlnlqdygiaagnsanliilpaengf  382
DSSP  -HHHHhhhhhhhlllllhhhhhhhhhhhlhhhhhhllllllllllllllleeeellllhh


DSSP  ----------------------------------------l
Query ----------------------------------------r  255
ident                                          
Sbjct dalrrqvpvrysvrggkviastqpaqttvyleqpeaidykr  423
DSSP  hhhhhllllleeeelleeeeellllleeeellleeeellll


No 11: Query=1bksA Sbjct=2uz9A Z-score=7.7

back to top
DSSP  lhhhhhhhhhhHHLL---------------------------------------------
Query meryenlfaqlNDRR---------------------------------------------   15
ident                                                             
Sbjct plahifrgtfvHSTWtcpmevlrdhllgvsdsgkivfleeasqqeklakewcfkpceire   60
DSSP  llleeeeeeeeELLLlllleeeeeeeeeellllleeeeeehhhhhhhhhhhlllhhheee


DSSP  ---------llEEEEEEELLLL------------------------------lHHHHHHH
Query ---------egAFVPFVTLGDP------------------------------gIEQSLKI   36
ident                                                       |     
Sbjct lshheffmpglVDTHIHASQYSfagssidlpllewltkytfpaehrfqnidfaEEVYTRV  120
DSSP  llllleeeeleEEEEEEHHHHHhllllllllhhhhhhhlhhhhhhhhhlhhhhHHHHHHH


DSSP  HHHHHHLLL-LLEEEELlllllllllhhhhhhhhhhhhhlllHHHHHHHHHHHHHHLllL
Query IDTLIDAGA-DALELGVpfsdpladgptiqnanlrafaagvtPAQCFEMLALIREKHptI   95
ident        |   |                                                
Sbjct VRRTLKNGTtTACYFAT-----------------------ihTDSSLLLADITDKFG-qR  156
DSSP  HHHHHHLLEeEEEEELL-----------------------llHHHHHHHHHHHHHHL-lE


DSSP  LEEEEELHH---------hhHLLLHHHHHHHHHHHL-------LLEEEEL---LLLHHHL
Query PIGLLMYAN---------lvFNNGIDAFYARCEQVG-------VDSVLVA---DVPVEES  136
ident                         |                     |             
Sbjct AFVGKVCMDlndtfpeyketTEESIKETERFVSEMLqknysrvKPIVTPRfslSCSETLM  216
DSSP  EEEELEELLlllllllllllHHHHHHHHHHHHHHHHhhlllleEEEEEELlhhHLLHHHH


DSSP  HHHHHHHHHLLLEEEEEEL------------lllLHHHHHHHH--HHLL--LLEEELlll
Query APFRQAALRHNIAPIFICP------------pnaDDDLLRQVA--SYGR--GYTYLLalp  180
ident       |                                                     
Sbjct GELGNIAKTRDLHIQSHISenrdeveavknlypsYKNYTSVYDknNLLTnkTVMAHGcyl  276
DSSP  HHHHHHHHHHLLEEEEEELllhhhhhhhhhhlllLLLHHHHHHhlLLLLllEEEEELlll


DSSP  HHHHHHHHHHhLLLLEEELlLLLL-hhhhhHHHHHL-----lLEEEEL--LHHHhhhhhl
Query LHHLIEKLKEyHAAPALQGfGISS-peqvsAAVRAG-----aAGAISG--SAIVkiiekn  232
ident          |   |                  |          |                
Sbjct SAEELNVFHE-RGASIAHCpNSNLslssgfLNVLEVlkhevkIGLGTDvaGGYS------  329
DSSP  LHHHHHHHHH-HLLEEEELhHHHHhlllllLLHHHHhhllleEEELLLllLLLL------


DSSP  lllhhhhhhhhhhHHHHHHHLLL-------------------------------------
Query laspkqmlaelrsFVSAMKAASR-------------------------------------  255
ident                                                             
Sbjct ------------ySMLDAIRRAVmvsnillinkvneksltlkevfrlatlggsqalgldg  377
DSSP  ------------lLHHHHHHHHHhhhhhhhhlllllllllhhhhhhhhlhhhhhhlllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  255
ident                                                             
Sbjct eignfevgkefdailinpkasdspidlfygdffgdiseaviqkflylgddrnieevyvgg  437
DSSP  lllllllllllleeeelllllllllllllhhhhlllllhhhhhhhhhllhhheeeeeell


DSSP  -------
Query -------  255
ident        
Sbjct kqvvpfs  444
DSSP  eeeelll


No 12: Query=1bksA Sbjct=1gkpA Z-score=7.7

back to top
DSSP  -------------------------------------lhhhhhhhhhhhHLLLLEEE-EE
Query -------------------------------------meryenlfaqlnDRREGAFV-PF   22
ident                                                             
Sbjct pllikngeiitadsrykadiyaegetitrigqnleappgtevidatgkyVFPGFIDPhVH   60
DSSP  leeeelleeeelleeeeleeeelllllleeellllllllleeeelllleEEELEEEEeEL


DSSP  EELLLLlhhhhhhHHHHHHHLL------lLLEEEELLLLllllllhhhhhhhhhhhhhll
Query VTLGDPgieqslkIIDTLIDAG------aDALELGVPFSdpladgptiqnanlrafaagv   76
ident   |             |   |                                       
Sbjct IYLPFM-atfakdTHETGSKAAlmggtttYIEMCCPSRN--------------------d   99
DSSP  LLLEEL-leelllLHHHHHHHHhhlleeeEEEEELLLLL--------------------l


DSSP  LHHHHHHHHHHHHHHL--lLLLEEEEELHhhhHLLLHHHHHHHHHHHLLLEEEEL-----
Query TPAQCFEMLALIREKH--pTIPIGLLMYAnlvFNNGIDAFYARCEQVGVDSVLVA-----  129
ident              |                  |              |  |         
Sbjct DALEGYQLWKSKAEGNsycDYTFHMAVSK---FDEKTEGQLREIVADGISSFXIFlsykn  156
DSSP  LHHHHHHHHHHHHLLLlllEEEEEEELLL---LLLLHHHHHHHHHHLLLLEEEEEellll


DSSP  --LLLHHHLHHHHHHHHHLLLEEEEEEL-----------------------------lLL
Query --DVPVEESAPFRQAALRHNIAPIFICP-----------------------------pNA  158
ident    |   |       |          |                                 
Sbjct ffGVDDGEMYQTLRLAKELGVIVTAHCEnaelvgrlqqkllsegktgpewhepsrpeaVE  216
DSSP  llLLLHHHHHHHHHHHHHHLLEEEEEELlhhhhhhhhhhhhhlllllhhhllllllhhHH


DSSP  LHhHHHHHHHHL-----LLLEEELlllHHHHHHHHHHHL----lLLEEELLLL-------
Query DDdLLRQVASYG-----RGYTYLLalpLHHLIEKLKEYH----aAPALQGFGI-------  202
ident         |         ||   |                                    
Sbjct AE-GTARFATFLettgaTGYVVHL--sCKPALDAAMAAKargvpIYIESVIPHflldkty  273
DSSP  HH-HHHHHHHHHhhhllEEEELLL--lLHHHHHHHHHHHhllllEEEEEEHHHhhllhhh


DSSP  ---------------------llhhhhhhhhHHLLLEEEELlHHHHhhHHLLLLH----h
Query ---------------------sspeqvsaavRAGAAGAISGsAIVKiiEKNLASP----k  237
ident                                                             
Sbjct aerggveamkyimspplrdkrnqkvlwdalaQGFIDTVGTD-HCPF--DTEQKLLgkeaf  330
DSSP  hhllhhhhhlllllllllllhhhhhhhhhhhLLLLLEEELL-LLLL--LHHHHHHhlllh


DSSP  hhhhhhhhHHHHHHHL--------------------------------------------
Query qmlaelrsFVSAMKAA--------------------------------------------  253
ident                                                             
Sbjct taipngipAIEDRVNLlytygvsrgrldihrfvdaastkaaklfglfprkgtiavgsdad  390
DSSP  hhllllllLLLLHHHHhhhhhlllllllhhhhhhhhlhhhhhhlllllllllllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  253
ident                                                             
Sbjct lvvydpqyrgtisvktqhvnndyngfegfeidgrpsvvtvrgkvavrdgqfvgekgwgkl  450
DSSP  eeeeelllleellhhhllllllllllllleelleeeeeeelleeeeelleelllllllll


DSSP  ------ll
Query ------sr  255
ident         
Sbjct lrrepmyf  458
DSSP  llllllll


No 13: Query=1bksA Sbjct=3mkvA Z-score=7.6

back to top
DSSP  -------------------------------------------lhhhhhhhhhhhHLLLL
Query -------------------------------------------meryenlfaqlnDRREG   17
ident                                                             
Sbjct lttflfrngalldpdhpdllqgfeiliedgfirevsdkpikssnahvidvkgktiMPGLI   60
DSSP  lleeeeeeeeelllllllleeeeeeeeelleeeeeellllllllleeeelllleeEELEE


DSSP  EeEEEEE--------lLLLLHHHHHHHHHHHHHLL------lLLEEEEllllllllllhh
Query AfVPFVT--------lGDPGIEQSLKIIDTLIDAG------aDALELGvpfsdpladgpt   63
ident      |                           |             |            
Sbjct DlHVHVVaiefnlprvATLPNVLVTLRAVPIMRAMlrrgfttVRDAGG------------  108
DSSP  EeEELLLlllllhhhhLLLLHHHHHHHHHHHHHHHhhlleeeEEELLL------------


DSSP  hhhhhhhhhhhlllhhhhhhhHHHHHHHLL-------LLLEE-EEELHH-----------
Query iqnanlrafaagvtpaqcfemLALIREKHP-------TIPIG-LLMYAN-----------  104
ident                                                             
Sbjct --------------------aGYPFKQAVEsglvegpRLFVSgRALSQTgghadprarsd  148
DSSP  --------------------lLHHHHHHHHlllllllEEEELlLEEELLlllllllllll


DSSP  -------------------HHHL-LLHHHHHHHHHHHLLLEEEEL---------------
Query -------------------LVFN-NGIDAFYARCEQVGVDSVLVA---------------  129
ident                                    | | |                    
Sbjct ymppdspcgccvrvgalgrVADGvDEVRRAVREELQMGADQIXIMasggvasptdpvgvf  208
DSSP  llllllllllllllllleeELLLhHHHHHHHHHHHHHLLLLEEEElllllllllllllll


DSSP  LLLHHHLHHHHHHHHHLLLEEEEEELLLLlhhHHHHHH-HHLLlLEEELlllHHHHHHHH
Query DVPVEESAPFRQAALRHNIAPIFICPPNAdddLLRQVA-SYGRgYTYLLalpLHHLIEKL  188
ident      |       |              |             |                 
Sbjct GYSEDEIRAIVAEAQGRGTYVLAHAYTPA---AIARAVrCGVR-TIEHGnliDDETARLV  264
DSSP  LLLHHHHHHHHHHHHLLLLLEEEEELLHH---HHHHHHhLLLL-EEEELlllLHHHHHHH


DSSP  HHHLLlLEEELLLLLL----------------------------hhhhhhhhhhlLLEEe
Query KEYHAaPALQGFGISS----------------------------peqvsaavragAAGAi  220
ident  |  |                                                       
Sbjct AEHGA-YVVPTLVTYDalasegekyglppesiakiadvhgaglhsieimkragvkMGFG-  322
DSSP  HHHLL-EEELLHHHHHhhhhhlllllllhhhhllhhhhhllhhhhhhhhhhhlllLLLL-


DSSP  ELLHHhhhhhhllllhhhhhhhhhhHHHHHhHLLL-------------------------
Query SGSAIvkiieknlaspkqmlaelrsFVSAMkAASR-------------------------  255
ident                                                             
Sbjct TDLLG-------------------eAQRLQ-SDEFrilaevlspaeviasativsaevlg  362
DSSP  LLLLH-------------------hHHHHL-LHHHhhhhllllhhhhhhhllhhhhhhll


DSSP  ----------------------------------------------------
Query ----------------------------------------------------  255
ident                                                     
Sbjct mqdklgrivpgahadvlvvdgnplksvdcllgqgehiplvmkdgrlfvnele  414
DSSP  llllllllllllllleeeellllllllllllllllllleeeelleeeeelll


No 14: Query=1bksA Sbjct=3ls9A Z-score=7.6

back to top
DSSP  ------------------------------------------lhhhhhhhhhhhhlllle
Query ------------------------------------------meryenlfaqlndrrega   18
ident                                                             
Sbjct milirgltrvitfddqereledadilidgpkivavgkdlsdrsvsrtidgrgmialpgli   60
DSSP  leeeeeeeeeellllllleeeeeeeeeelleeeeeellllllllleeeellleeeeelee


DSSP  EEEEEELLLL------------------------------------lHHHHHHHHHHHHH
Query FVPFVTLGDP------------------------------------gIEQSLKIIDTLID   42
ident                                                 |           
Sbjct NSHQHLYEGAmraipqlervtmaswlegvltrsagwwrdgkfgpdviREVARAVLLESLL  120
DSSP  EEEELHHHHHhlllhhhllllhhhhhhhhhhhhhhhhhlllllhhhhHHHHHHHHHHHHH


DSSP  LLL-LLEEEELLLLLlllllhhhhhhhhhhhhhlllHHHHHHHHHHHHHHLL-LLLEEEE
Query AGA-DALELGVPFSDpladgptiqnanlrafaagvtPAQCFEMLALIREKHP-TIPIGLL  100
ident  |          |                                               
Sbjct GGItTVADQHLFFPG-------------------atADSYIDATIEAATDLGiRFHAARS  161
DSSP  LLEeEEEEEELLLLL-------------------llLLLHHHHHHHHHHHHLlEEEEEEL


DSSP  ELH-------------HHHHLlLHHHHHHHHHHHL---------LLEEEEL---LLLHHH
Query MYA-------------NLVFNnGIDAFYARCEQVG---------VDSVLVA---DVPVEE  135
ident                                                           | 
Sbjct SMTlgkseggfcddlfVEPVD-RVVQHCLGLIDQYhepepfgmvRIALGPCgvpYDKPEL  220
DSSP  LLLllhhhlllllhhhLLLHH-HHHHHHHHHHHHHlllllllleEEEELLLlllLLLHHH


DSSP  LHHHHHHHHHLLLEEEEEEL-LLLL--------HHHHHHHHHH----lLLLEEELlllHH
Query SAPFRQAALRHNIAPIFICP-PNAD--------DDLLRQVASY----gRGYTYLLalpLH  182
ident    | | |             |               |          |           
Sbjct FEAFAQMAADYDVRLHTHFYePLDAgmsdhlygMTPWRFLEKHgwasdRVWLAHAvvpPR  280
DSSP  HHHHHHHHHHHLLEEEEEELlLLHHhhhhhhhlLLHHHHHHHLlllllLEEEEELlllLH


DSSP  HHHHHHHHhLLLLEEEL-lLLLLhhhhhHHHHHL-----lLEEEELLhHHHHHhhllllh
Query HLIEKLKEyHAAPALQG-fGISSpeqvsAAVRAG-----aAGAISGSaIVKIIeknlasp  236
ident   |                         |  |         |                  
Sbjct EEIPEFAD-AGVAIAHLiaPDLRmgwglAPIREYldagitVGFGTTG-SASND-------  331
DSSP  HHHHHHHH-HLLEEEELhhHHHHlllllLLHHHHhhllleEEELLLL-LLLLL-------


DSSP  hhhhhhhhhHHHHHHHLLL-----------------------------------------
Query kqmlaelrsFVSAMKAASR-----------------------------------------  255
ident                                                             
Sbjct -------ggNLLGDLRLAAlahrpadpnepekwlsarellrmatrgsaeclgrpdlgvle  384
DSSP  -------llLHHHHHHHHHhhlhhhllllhhhlllhhhhhhhllhhhhhhllllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  255
ident                                                             
Sbjct egraadiacwrldgvdrvgvhdpaiglimtglsdraslvvvngqvlvenerpvladleri  444
DSSP  lllllleeeeelllhhhlllllhhhhhhhlllllllleeeelleeeeelleellllhhhh


DSSP  ---------
Query ---------  255
ident          
Sbjct vanttalip  453
DSSP  hhhhhhhll


No 15: Query=1bksA Sbjct=3giqA Z-score=7.6

back to top
DSSP  -lhhhhhhhhhhHHLL-----------------------------------------lle
Query -meryenlfaqlNDRR-----------------------------------------ega   18
ident              |                                              
Sbjct ekldfkitggwiIDGTgaprrradlgvrdgriaaigelgahparhawdasgkivapgfid   60
DSSP  lleeeeeelleeLLLLlllleeleeeeelleeeeeelllllleeeeeelllleeeeleee


DSSP  eEEEEELllllhhHHHHHhHHHHHL--LLLLEEE---------elllLLLLLLLhHHHHh
Query fVPFVTLgdpgieQSLKIiDTLIDA--GADALEL---------gvpfSDPLADGpTIQNa   67
ident       |                                            |        
Sbjct vHGHDDL----mfVEKPD-LRWKTSqgITTVVVGncgvsaapaplpgNTAAALA-LLGE-  113
DSSP  lLLLLLL----hhHHLLL-LHHHHLllEEEEEELlllllllllllllLLLHHHH-HHLL-


DSSP  hhhhhhhlLLHHHHHHHHHHHHHH--llLLLEEEEEL-HHHHHL------------LLHH
Query nlrafaagVTPAQCFEMLALIREK--hpTIPIGLLMY-ANLVFN------------NGID  112
ident            |      |                     |                   
Sbjct -------tPLFADVPAYFAALDAQrpmiNVAALVGHAnLRLAAMrdpqaaptaaeqQAMQ  166
DSSP  -------lLLLLLHHHHHHHHHHLllllEEEEEEEHHhHHHHHLllllllllhhhhHHHH


DSSP  HHHHHHHHHLLLEEEEL-----LLLHHH--LHHHHHHHHHLLLEEEEEE--LLLLLHHHH
Query AFYARCEQVGVDSVLVA-----DVPVEE--SAPFRQAALRHNIAPIFIC--PPNADDDLL  163
ident          |                           |                      
Sbjct DMLQAALEAGAVGFSTGlayqpGAVAQAaeLEGLARVAAERRRLHTSHIrnEADGVEAAV  226
DSSP  HHHHHHHHHLLLEEEEElllllHHHLLHhhHHHHHHHHHHLLLEEEEELllLLLLHHHHH


DSSP  HHHHHHL-----LLLEEEL-----LLLHhhHHHHHHHHL--------lLLEEEllllllh
Query RQVASYG-----RGYTYLL-----ALPLhhLIEKLKEYH--------aAPALQgfgissp  205
ident   |   |                                                     
Sbjct EEVLAIGrgtgcATVVSHHkcmmpQNWG--RSRATLANIdrareqgveVALDI-------  277
DSSP  HHHHHHHhhhllEEEELLLllllhHHLL--LHHHHHHHHhhhhhllllEEEEE-------


DSSP  hHHHH-------------------------------------------------------
Query eQVSA-------------------------------------------------------  210
ident                                                             
Sbjct -YPYPgsstiliperaetiddiritwstphpecsgeyladiaarwgcdkttaarrlapag  336
DSSP  -LLLLeeeeellhhhllllllleeeeelllhhhllllhhhhhhhhlllhhhhhhhhllee


DSSP  ---------hHHHL-----LLEEEELLhHHHHhhhllllhhhhhhhhhhhHHHHHHLLL-
Query ---------aVRAG-----AAGAISGSaIVKIieknlaspkqmlaelrsfVSAMKAASR-  255
ident           |              |                                  
Sbjct aiyfamdedeVKRIfqhpcCMVGSDGL-PNDA-------------rphprLWGSFTRVLg  382
DSSP  eeeelllhhhHHHHhhlllEEELLLLL-LLLL-------------llllhHHHHHHHHHh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  255
ident                                                             
Sbjct ryvrearlmtleqavarmtalparvfgfaergvlqpgawadvvvfdpdtvadratwdept  442
DSSP  hhhhhlllllhhhhhhhhlhhhhhhhllllllllllllllleeeelllllllllllllll


DSSP  ---------------------------------
Query ---------------------------------  255
ident                                  
Sbjct lasvgiagvlvngaevfpqppadgrpgqvlrax  475
DSSP  llllleeeeeelleeeellllllllllllllll


No 16: Query=1bksA Sbjct=4dlfA Z-score=7.5

back to top
DSSP  lhhhhhhhhhhhhlllleEEEEEElLLLL---------------hhhHHHHHHHHHHLL-
Query meryenlfaqlndrregaFVPFVTlGDPG---------------ieqSLKIIDTLIDAG-   44
ident                                                       |  |  
Sbjct --------------alriDSHQHF-WRYRaadypwigagmgvlardyLPDALHPLMHAQa   45
DSSP  --------------llleEEEELL-LLLLhhhllllllllhhhllllLHHHHHHHHHHLl


DSSP  --llLEEEELLLlllllllhhhhhhhhhhhhhlllhHHHHHHHHHhhHHLLlLLEEEeEL
Query --adALELGVPFsdpladgptiqnanlrafaagvtpAQCFEMLALirEKHPtIPIGLlMY  102
ident                                     |   |      |            
Sbjct lgasIAVQARAG--------------------rdetAFLLELACD--EARI-AAVVG-WE   81
DSSP  lleeEEELLLLL--------------------hhhhHHHHHHHLL--LLLE-EEEEE-LL


DSSP  HHhhhLLLHHHHHHHHHHHLLLEEEELL-------lLHHH--LHHHHHHHHHLLLEEEEE
Query ANlvfNNGIDAFYARCEQVGVDSVLVAD-------vPVEE--SAPFRQAALRHNIAPIFI  153
ident              |                       |     |                
Sbjct DL--rAPQLAERVAEWRGTKLRGFRHQLqdeadvraFVDDadFARGVAWLQANDYVYDVL  139
DSSP  LL--lLLLHHHHHHLLLLLLEEEEEELHhhlllhhhHHHLhhHHHHHHHHHHLLLEEEEL


DSSP  ELLLLLHHHHHHHHHH--lLLLEEEL--------------llLHHHHHHHHHHHLLLLEE
Query CPPNADDDLLRQVASY--gRGYTYLL--------------alPLHHLIEKLKEYHAAPAL  197
ident        |     |                                    |         
Sbjct VFERQLPDVQAFCARHdahWLVLDHAgkpalaefdrddtalaRWRAALRELAALPHVVCK  199
DSSP  LLHHHHHHHHHHHHHLlllLEEEHHHhlllhhhllllllhhhHHHHHHHHHHLLLLEEEE


DSSP  ELLLLL-----------lHHHHHHHHHHL-------lLEEEELLhHHHHhhhllllhhhh
Query QGFGIS-----------sPEQVSAAVRAG-------aAGAISGSaIVKIieknlaspkqm  239
ident                            |             |    |             
Sbjct LSGLVTeadwrrglrasdLRHIEQCLDAAldafgpqrLMFGSDW-PVCL-----------  247
DSSP  ELLLLLlllllllllhhhHHHHHHHHHHHhhhhlhhhEEELLLL-LHHH-----------


DSSP  hhhhhhHHHHHHHLLL---------------------------
Query laelrsFVSAMKAASR---------------------------  255
ident                                            
Sbjct ---laaSYDEVASLVErwaesrlsaaersalwggtaarcyalp  287
DSSP  ---hllLHHHHHHHHHhhhhhhllhhhhhhhllhhhhhhllll


No 17: Query=1bksA Sbjct=1yrrB Z-score=7.5

back to top
DSSP  -------------------------------------lhhhhhhhhhhhhllllEEEEEE
Query -------------------------------------meryenlfaqlndrregAFVPFV   23
ident                                                         |   
Sbjct yaltqgriftgheflddhavviadgliksvcpvaelppeieqrslngailspgfIDVQLN   60
DSSP  leeelleeelllleelleeeeeelleeeeeeehhhlllllleeelllleeeeleEEEEEL


DSSP  -----ELLLLLhHHHH-HHHHHHHHLL-----lLLEEEELLLlllllllhhhhhhhhhhh
Query -----TLGDPGiEQSL-KIIDTLIDAG-----aDALELGVPFsdpladgptiqnanlraf   72
ident         |   |            |         |                        
Sbjct gcggvQFNDTA-EAVSvETLEIMQKANeksgctNYLPTLITT------------------  101
DSSP  eelleELLLLL-LLLLhHHHHHHHHHHhllleeEEEEEELLL------------------


DSSP  hhllLHHHHHHHHHHHHHHLL----LLLE-EEEELHhhhhlLLHHHHHHHHHHhLLLEEE
Query aagvTPAQCFEMLALIREKHP----TIPI-GLLMYAnlvfnNGIDAFYARCEQvGVDSVL  127
ident                 ||             |              |           | 
Sbjct ----SDELMKQGVRVMREYLAkhpnQALGlHLEGPW---lnAALVDFLCENAD-VITKVT  153
DSSP  ----LHHHHHHHHHHHHHHHHhlllLLLLeEEELLL---llLHHHHHHHHLHH-HEEEEE


DSSP  EllLLHHHLHHHHHHHHHLLLEEEEEellLLLHHHHHHHHHHLLlLEEE----LLLL---
Query VadVPVEESAPFRQAALRHNIAPIFIcppNADDDLLRQVASYGRgYTYL----LALP---  180
ident     |    |          |        ||           |                 
Sbjct L--APEMVPAEVISKLANAGIVVSAG-hsNATLKEAKAGFRAGItFATHlynaMPYItgr  210
DSSP  E--LHHHLLHHHHHHHHHHLLEEEEL-llLLLHHHHHHHHHHLEeEELLllllLLLLlll


DSSP  hhhhHHHHHHHLLLLEEElllLLLHHH-hhhhHHHL------lLEEEELLHhhhhhhhll
Query lhhlIEKLKEYHAAPALQgfgISSPEQ-vsaaVRAG------aAGAISGSAivkiieknl  233
ident                      |           |                          
Sbjct epglAGAILDEADIYCGI---IADGLHvdyanIRNAkrlkgdkLCLVTDAT---------  258
DSSP  llhhHHHHHHLLLLEEEE---ELLLLLllhhhHHHHhhhhhhhEEEELLLL---------


DSSP  llhhhhhhhhhhhhhhHHHLLL--------------------------------------
Query aspkqmlaelrsfvsaMKAASR--------------------------------------  255
ident                                                             
Sbjct -----------sgsslTMIEGVrnlvehcgialdevlrmatlyparaigvekrlgtlaag  307
DSSP  -----------lllllLHHHHHhhhhhhhlllhhhhhhhhlhhhhhhlllllllllllll


DSSP  ---------------------------
Query ---------------------------  255
ident                            
Sbjct kvanltaftpdfkitktivngnevvtq  334
DSSP  lllleeeellllleeeeeelleeeeel


No 18: Query=1bksA Sbjct=4mupB Z-score=7.4

back to top
DSSP  -lhhhhhhhhhhhhlllleeEEEEELL------------lllhHHHHHHHHHHHHLL--l
Query -meryenlfaqlndrregafVPFVTLG------------dpgiEQSLKIIDTLIDAG--a   45
ident                                                     |       
Sbjct lvrklsgtapnpafprgavdTQMHMYLpgypalpggpglppgaLPGPEDYRRLMQWLgid   60
DSSP  lllllllllllllllllleeLLLLLLLllllllllllllllllLLLHHHHHHHHHHHlll


DSSP  LLEEEELLLlllllllhhhhhhhhhhhhhllLHHHHHHHHHHHHHHlllllEEEEElhhh
Query DALELGVPFsdpladgptiqnanlrafaagvTPAQCFEMLALIREKhptipIGLLMyanl  105
ident                                         |   |               
Sbjct RVIITQGNA-------------------hqrDNGNTLACVAEMGEA----aHAVVI---i   94
DSSP  EEEEELLHH-------------------hllLLHHHHHHHHHHHHH----eEEEEL---l


DSSP  HHLLLhHHHHHHHHHHLLLEEEEL-----LLLHHHLHHHHHHHHHLLLEEEEEELLLLLH
Query VFNNGiDAFYARCEQVGVDSVLVA-----DVPVEESAPFRQAALRHNIAPIFICPPNADD  160
ident                 |             |   |       |             |   
Sbjct DATTT-EKDMEKLTAAGTVGARIMdlpggAVNLSELDAVDERAHAADWMVAVQFDGNGLL  153
DSSP  LLLLL-HHHHHHHHHLLEEEEEEElllllLLLHHHHHHHHHHHHHLLLEEEEELLHHHHH


DSSP  HHHHHHHHH-lLLLEEEL----LLLHH--HHHHHHHHHL---lLLEEELLLL-----lLH
Query DLLRQVASY-gRGYTYLL----ALPLH--HLIEKLKEYH---aAPALQGFGI-----sSP  205
ident | |        |                      |                        |
Sbjct DHLPRLQKIrsRWVFDHHgkffKGIRTdgPEMAALLKLIdrgnLWFKFAGVYessrksWP  213
DSSP  HHHHHHHLLllEEEELHHhhllLLLLLllHHHHHHHHHHhhllEEEEELLHHhlllllLL


DSSP  HH-hHHHHHHL------lLEEEELLHHHHHhhHLLLlhhhhhhhhhhHHHHHHHLLL---
Query EQ-vSAAVRAG------aAGAISGSAIVKIieKNLAspkqmlaelrsFVSAMKAASR---  255
ident      |  |                          |                        
Sbjct YAdvAAFSRVIaahaperIVWGTNWPHNSV--RETA--------aypDDARLAELTLgwl  263
DSSP  LHhhHHHHHHHhhhlhhhEEELLLLLLLLL--LLHH--------hllLHHHHHHHHHlll


DSSP  -----------------------
Query -----------------------  255
ident                        
Sbjct pdeaarhralvenpealfklspv  286
DSSP  llhhhhhhhhlhhhhhhhlllll


No 19: Query=1bksA Sbjct=1itqA Z-score=7.4

back to top
DSSP  lhhhhhhhhhhHHLLllEEEEEEEL---LLLLHHH---------hhhhhhHHHHLL----
Query meryenlfaqlNDRRegAFVPFVTL---GDPGIEQ---------slkiidTLIDAG----   44
ident                              |                    | |       
Sbjct -dffrdeaeriMRDSpvIDGHNDLPwqlLDMFNNRlqderanlttlagthTNIPKLragf   59
DSSP  -lhhhhhhhhhHLLLleEEEEELHHhhhHHHHLLLlllhhhlllllllllLLHHHHhhll


DSSP  -lLLEEE-ELLLLLLllllhhhhhhhhhhhhhllLHHHHHHHHHHHHH-----HLLL---
Query -aDALEL-GVPFSDPladgptiqnanlrafaagvTPAQCFEMLALIRE-----KHPT---   94
ident           |                                                 
Sbjct vgGQFWSvYTPCDTQ-------------nkdavrRTLEQMDVVHRMCRmypetFLYVtss  106
DSSP  eeEEEEEeLLLHHHL-------------lllhhhHHHHHHHHHHHHHHhllllEEELllh


DSSP  -------------LLEEEEElHHHHHllLHHHHHHHHHHHLLLEEEEL------------
Query -------------IPIGLLMyANLVFnnGIDAFYARCEQVGVDSVLVA------------  129
ident                ||                     | |                   
Sbjct agirqafregkvaSLIGVEG-GHSID--SSLGVLRALYQLGMRYLTLThscntpwadnwl  163
DSSP  hhhhhhhhllleeEEEEEEL-HHHLL--LLHHHHHHHHHLLEEEEELLllllllllllhh


DSSP  ---------llLHHH-LHHHHHHHHHLLLEEEEEelllllhhHHHHHHHHL--LLLEEEL
Query ---------dvPVEE-SAPFRQAALRHNIAPIFIcppnadddLLRQVASYG--RGYTYLL  177
ident                          |                                  
Sbjct vdtgdsepqsqGLSPfGQRVVKELNRLGVLIDLA---hvsvaTMKATLQLSraPVIFSHS  220
DSSP  hllllllllllLLLHhHHHHHHHHHHHLLEEELL---lllhhHHHHHHHHLllLLEELLL


DSSP  ---------lllHHHHHHHHHHhLLLLEEELLL--------llLHHHHHHHHHHL-----
Query ---------alpLHHLIEKLKEyHAAPALQGFG--------isSPEQVSAAVRAG-----  215
ident                     |          |              ||            
Sbjct saysvcasrrnvPDDVLRLVKQ-TDSLVMVNFYnnyisctnkaNLSQVADHLDHIkevag  279
DSSP  llllllllllllLHHHHHHHHH-HLLEEEELLLhhhhllllllLHHHHHHHHHHHhhhll


DSSP  --lLEEEELLhHHHHhhhllllhhhhhhhhhHHHHHhHHLLL------------------
Query --aAGAISGSaIVKIieknlaspkqmlaelrSFVSAmKAASR------------------  255
ident     |                            ||                         
Sbjct araVGFGGDF-DGVP----------rvpeglEDVSK-YPDLIaellrrnwteaevkgala  327
DSSP  hhhEEELLLL-LLLL----------llllllLLLLL-HHHHHhhhhhllllhhhhhhhhl


DSSP  ------------------------------------------
Query ------------------------------------------  255
ident                                           
Sbjct dnllrvfeaveqasnltqapeeepipldqlggscrthygyss  369
DSSP  hhhhhhhhhhhhllllllllllllllhhhlllllllllllll


No 20: Query=1bksA Sbjct=4b3zD Z-score=7.2

back to top
DSSP  --------------------------------------lhhhhhhhhhhhhllllEEEEE
Query --------------------------------------meryenlfaqlndrregAFVPF   22
ident                                                          |  
Sbjct drllikggriinddqslyadvyledglikqigenlivpggvktieangrmvipggIDVNT   60
DSSP  leeeeeeeeeelllleeeeeeeeelleeeeeellllllllleeeelllleeeeleEEEEE


DSSP  EeLLLLlhhhhhHHHHHHHHLL-----lLLEEEELLLlllllllhhhhhhhhhhhhhlll
Query VtLGDPgieqslKIIDTLIDAG-----aDALELGVPFsdpladgptiqnanlrafaagvt   77
ident                     |             ||                        
Sbjct YlQKTA-----aDDFFQGTRAAlvggttMIIDHVVPE------------------pgssl   97
DSSP  LlLLLL-----lLLHHHHHHHHhhlleeEEEEEELLL------------------llllh


DSSP  HHHHHHHHHHHHHH-llLLLEEEEELHHhhHLLLHhHHHHHHHH-HLLLEEEEL------
Query PAQCFEMLALIREK-hpTIPIGLLMYANlvFNNGIdAFYARCEQ-VGVDSVLVA------  129
ident              |                             |  || |  |       
Sbjct LTSFEKWHEAADTKsccDYSLHVDITSW--YDGVR-EELEVLVQdKGVNSFQVYmaykdv  154
DSSP  HHHHHHHHHHHHLLlllEEEEEEELLLL--LLLHH-HHHHHHHHlLLLLEEEEEllllll


DSSP  -LLLHHHLHHHHHHHHHLLLEEEEEE--------------------------------LL
Query -DVPVEESAPFRQAALRHNIAPIFIC--------------------------------PP  156
ident                                                             
Sbjct yQMSDSQLYEAFTFLKGLGAVILVHAengdliaqeqkrilemgitgpeghalsrpeelEA  214
DSSP  lLLLHHHHHHHHHHHHHHLLEEEEELllhhhhhhhhhhhhhllllllhhhhhhllhhhHH


DSSP  LLlhhhhHHHHHHL-----LLLEEEL-lLLHHHHHHHHHH-HLLLLEEELlLLLL-----
Query NAdddllRQVASYG-----RGYTYLL-aLPLHHLIEKLKE-YHAAPALQGfGISS-----  204
ident  |                   |            |                         
Sbjct EA----vFRAITIAgrincPVYITKVmsKSAADIIALARKkGPLVFGEPIaASLGtdgth  270
DSSP  HH----hHHHHHHHhhhllLEEEEEEllHHHHHHHHHHHHhLLLEEEEELhHHHHlllhh


DSSP  ---------------------hhhhhHHHHHL----LLEEEELlhHHHHhHHLLLL----
Query ---------------------peqvsAAVRAG----AAGAISGsaIVKIiEKNLAS----  235
ident                                          ||                 
Sbjct ywsknwakaaafvtspplspdpttpdYLTSLLacgdLQVTGSG--HCPY-STAQKAvgkd  327
DSSP  hhlllhhhhhhllllllllllllhhhHHHHHHhhllLLLLLLL--LLLL-LHHHHHhhll


DSSP  hhhhhhhhhhHHHHHHHLLL----------------------------------------
Query pkqmlaelrsFVSAMKAASR----------------------------------------  255
ident                                                             
Sbjct nftlipegvnGIEERMTVVWdkavatgkmdenqfvavtstnaakifnlyprkgriavgsd  387
DSSP  lhhhllllllLLLLHHHHHHhhhlllllllhhhhhhhhlhhhhhhhllllllllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  255
ident                                                             
Sbjct advviwdpdklktitakshksaveynifegmechgsplvvisqgkivfedgninvnkgmg  447
DSSP  lleeeeeeeeeeelllllllllllllllllleeeeeeeeeeelleeeeelleelllllll


DSSP  ------------------------------
Query ------------------------------  255
ident                               
Sbjct rfiprkafpehlyqrvkirnkvfglqgvsr  477
DSSP  lllllllllhhhhhhhhhhhhhllllllll


No 21: Query=1bksA Sbjct=2ffiA Z-score=7.1

back to top
DSSP  lhhhhhhhhhhhhlllleeEEEEElLLLLHH------------hHHHHHHHHHHLL--ll
Query meryenlfaqlndrregafVPFVTlGDPGIE------------qSLKIIDTLIDAG--ad   46
ident                             |                |        |     
Sbjct ------------lhltaidSHAHV-FSRGLNlasqrryapnydaPLGDYLGQLRAHgfsh   47
DSSP  ------------llllleeLLLLL-LLHHHHhhlllllllllllLHHHHHHHHHHLllle


DSSP  LEEEELLLlllllllhhhhhhhhhhhhhllLHHHHHHHHHHHHhhlLLLLEEEeELHHhh
Query ALELGVPFsdpladgptiqnanlrafaagvTPAQCFEMLALIRekhPTIPIGLlMYANlv  106
ident        |                              |                     
Sbjct GVLVQPSF-------------------lgtDNRYLLSALQTVP---GQLRGVV-XLER--   82
DSSP  ELLLLLHH-------------------hllLLHHHHHHHHHLL---LLLLLLL-LLLL--


DSSP  hllLHHHHHHHHHHHLLLEEEELL-----lLHHH--LHHHHHHHHHLLLEEEEEELLLLl
Query fnnGIDAFYARCEQVGVDSVLVAD-----vPVEE--SAPFRQAALRHNIAPIFICPPNAd  159
ident       |  |     ||  |                  |                     
Sbjct --dVEQATLAEXARLGVRGVRLNLxgqdxpDLTGaqWRPLLERIGEQGWHVELHRQVAD-  139
DSSP  --lLLHHHHHHHHLLLLLEEELLLllllllLLLLllLHHHHHHHHHHLLEEEELLLLLL-


DSSP  hhhHHHHHHH----lLLLEEEL----------LLLHHHHHHhhHHHL-LLLEEELLLL--
Query ddlLRQVASY----gRGYTYLL----------ALPLHHLIEklKEYH-AAPALQGFGI--  202
ident       |                               |                     
Sbjct --iPVLVRALqpyglDIVIDHFgrpdarrglgQPGFAELLT--LSGRgKVWVKVSGIYrl  195
DSSP  --hHHHHHHHlllllLEEELHHhlllllllllLLLHHHHLL--LLLLlLEEEEEELHHhl


DSSP  -----llhhhhHHHHHHL-------lLEEEELLHHHHHhhhllllhhhhhhhhhhHHHHH
Query -----sspeqvSAAVRAG-------aAGAISGSAIVKIieknlaspkqmlaelrsFVSAM  250
ident              |  |             |                             
Sbjct qgspeenlafaRQALCALeahygaerLXWGSDWPHTQH-------------esevSFGSA  242
DSSP  lllhhhhhhhhHHHHHHHhhhllhhhEEEELLLLLLLL-------------llllLHHHH


DSSP  HHLLL--------------------------
Query KAASR--------------------------  255
ident                                
Sbjct VEQFEalgcsaqlrqallldtaralfgfele  273
DSSP  HHHHHhhlllhhhhhhhhlhhhhhhllllll


No 22: Query=1bksA Sbjct=4rdvB Z-score=7.1

back to top
DSSP  ----------------------------------lhhhhhhhhhhhHLLLLEE-EEEEE-
Query ----------------------------------meryenlfaqlnDRREGAF-VPFVT-   24
ident                                                             
Sbjct saifaerallpegwarnvrfeisadgvlaeirpdanadgaerlggaVLPGMPNlHSHAFq   60
DSSP  leeeeeeeeelleeeeeeeeeellllleeeeelllllllleellllEEELEEEeEELHHh


DSSP  ---------------------------lllLLHHHHHHHHHHHHHLL------lLLEEEE
Query ---------------------------lgdPGIEQSLKIIDTLIDAG------aDALELG   51
ident                                  ||   |   |            |    
Sbjct ramaglaevagnpndsfwtwrelmyrmvarLSPEQIEVIACQLYIEMlkagytaVAEFHY  120
DSSP  hhhlllllllllllllhhhhhhhhhhhhllLLHHHHHHHHHHHHHHHhhhleeeEEEEEL


DSSP  LLllllllllhhhhhhhhhhhhHLLLHH-HHHHHHHHHHHHLL----LLLEEEEELH---
Query VPfsdpladgptiqnanlrafaAGVTPA-QCFEMLALIREKHP----TIPIGLLMYA---  103
ident |                               |    |                 |    
Sbjct VH------------------hdLDGRSYaDPAELSLRISRAASaagiGLTLLPVLYShag  162
DSSP  LL------------------llLLLLLLlLLLHHHHHHHHHHHhhllEEEEEELLLLeee


DSSP  -------------HHHHlllhHHHHHHHHHHL--------lLEEEEL---LLLHHHLHHH
Query -------------NLVFnngiDAFYARCEQVG--------vDSVLVA---DVPVEESAPF  139
ident                       |                            |     |  
Sbjct fggqpasegqrrfINGS----EAYLELLQRLRapleaaghsLGLCFHslrAVTPQQIATV  218
DSSP  llleellhhhlllLLLH----HHHHHHHHHHHhhhhhhlleELEEELlllLLLHHHHHHH


DSSP  HHHhHHLLLEEEEEEL--------------lLLLHHHHH-HHHHhlLLLEEELlLLHHHH
Query RQAaLRHNIAPIFICP--------------pNADDDLLR-QVASygRGYTYLLaLPLHHL  184
ident   |                                 |         |             
Sbjct LAA-GHDDLPVHIHIAeqqkevddcqawsgrRPLQWLYEnVAVD-qRWCLVHAtHADPAE  276
DSSP  HLL-LLLLLLEEEEELllhhhhhhhhhhhllLHHHHHHHhLLLL-lLEEEEELlLLLHHH


DSSP  HHHHHHhLLLLEEEL-lLLLL-----hhhhhhhhhhllLEEEELLHhhhhhhhllllhhh
Query IEKLKEyHAAPALQG-fGISS-----peqvsaavragaAGAISGSAivkiieknlaspkq  238
ident          | |                           |  | |               
Sbjct VAAMAR-SGAVAGLClsTEANlgdgifpatdflaqggrLGIGSDSH--------------  321
DSSP  HHHHHH-HLLEEEELhhHHHHlllllllhhhhhhllleEEELLLLL--------------


DSSP  hhhhhhhHHHHhHHLLL-------------------------------------------
Query mlaelrsFVSAmKAASR-------------------------------------------  255
ident                                                             
Sbjct -------VSLS-VVEELrwleygqrlrdrkrnrlyrddqpmigrtlydaalaggaqalgq  373
DSSP  -------LLLL-HHHHHhhhhhhhhhhhlllllllllllllhhhhhhhhhhhhhhhhhll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  255
ident                                                             
Sbjct pigslavgrradllvldgndpylasaegdallnrwlfaggdrqvrdvmvagrwvvrdgrh  433
DSSP  lllllllllllleeeellllhhhhllllhhhhhhhhhhllhhheeeeeelleeeelllll


DSSP  ------------------
Query ------------------  255
ident                   
Sbjct ageersarafvqvlgell  451
DSSP  llhhhhhhhhhhhhhhhl


No 23: Query=1bksA Sbjct=3dcpA Z-score=7.0

back to top
DSSP  lhhhhhhhhhhhhllLLEE-EEEEeLLLLlhhhhHHHHHHHHHLL------lLLEEEELL
Query meryenlfaqlndrrEGAF-VPFVtLGDPgieqsLKIIDTLIDAG------aDALELGVP   53
ident                                                            |
Sbjct ---------------XKRDgHTHTeFCPH---gtHDDVEEXVLKAieldfdeYSIVEHAP   42
DSSP  ---------------LLEEeEELLlLLLL---llLLLHHHHHHHHhhlllleEEEEEELL


DSSP  LLL----lllllHHHHHHhhhhhhhlLLHHHhHHHHHHHHHHLL-------LLLEEEEEL
Query FSD----pladgPTIQNAnlrafaagVTPAQcFEMLALIREKHP-------TIPIGLLMY  102
ident  |                                                  | ||    
Sbjct LSSefxkntagdKEAVTT------asXAXSD-LPYYFKKXNHIKkkyasdlLIHIGFEVD   95
DSSP  LLHhhhhlllllLHHHHL------llLLHHH-HHHHHHHHHHHHhhlllllEEEEEEEEE


DSSP  HHhhHLLLHHHHHHHHHHhLLLEEEELL--------------------------------
Query ANlvFNNGIDAFYARCEQvGVDSVLVAD--------------------------------  130
ident            |         |                                      
Sbjct YLigYEDFTRDFLNEYGP-QTDDGVLSLhflegqggfrsidfsaedynegivqfyggfeq  154
DSSP  LLllLHHHHHHHHHHHHH-HLLEEEEELleeeelleeeellllhhhhhhhlhhhhllhhh


DSSP  ------lLHHH--LHHHhhhhhHLLLEEEE-EELL--------------------llLHH
Query ------vPVEE--SAPFrqaalRHNIAPIF-ICPP--------------------naDDD  161
ident         |     |                                             
Sbjct aqlayleGVKQsiEADL-----GLFKPRRXgHISLcqkfqqffgedtsdfseevxekFRV  209
DSSP  hhhhhhhHHHHhhHLLL-----LLLLLLEElLLLHhhllhhhhlllhhhllhhhhhhHHH


DSSP  HHHHHHHHLLlLEEEL-----------lllHHHHHHHHHHHLLlLEEEL----lllllhh
Query LLRQVASYGRgYTYLL-----------alpLHHLIEKLKEYHAaPALQG----fgisspe  206
ident  |  |                                  |    |   |           
Sbjct ILALVKKRDY-ELDFNtaglfkplcgetypPKKIVTLASELQI-PFVYGsdshgvqdigr  267
DSSP  HHHHHHHHLL-EEEEElhhhhlllllllllLHHHHHHHHHLLL-LEEEElllllhhhlll


DSSP  HHHHHHHHLlleeeellhhhhhhhhllllhhhhhhhhhhhhhhhhhlll
Query QVSAAVRAGaagaisgsaivkiieknlaspkqmlaelrsfvsamkaasr  255
ident   |                                              
Sbjct GYSTYCQKL---------------------------------------e  277
DSSP  LHHHHHHHL---------------------------------------l


No 24: Query=1bksA Sbjct=4c5yA Z-score=6.9

back to top
DSSP  ----------------------------------------------lhhhhhhhhhhhhL
Query ----------------------------------------------meryenlfaqlndR   14
ident                                                             
Sbjct deakvtiiyagllipgdgeplrnaalvisdkiiafvgseadipkkylrstqsthrvpvlM   60
DSSP  lllleeeeeeeeellllllleeeeeeeeelleeeeeeehhhllhhhhhhllleeeeeeeE


DSSP  LLLEE-EEEEeLLLL------------LHHHHHHHHHHHHHLL------lLLEEEEllll
Query REGAF-VPFVtLGDP------------GIEQSLKIIDTLIDAG------aDALELGvpfs   55
ident             ||                 |                       |    
Sbjct PGLWDcHMHF-GGDDdyyndytsglatHPASSGARLARGCWEAlqngytsYRDLAG----  115
DSSP  ELEEEeEELL-LLLLllllllhhhhhlLHHHHHHHHHHHHHHHhhlleeeEEELLL----


DSSP  llllllhhhhhhhhhhhhhlllhhhhhhHHHHHHHHLL-------LLLEE-EEELHH---
Query dpladgptiqnanlrafaagvtpaqcfeMLALIREKHP-------TIPIG-LLMYAN---  104
ident                                                             
Sbjct ----------------------------YGCEVAKAINdgtivgpNVYSSgAALSQTagh  147
DSSP  ----------------------------LHHHHHHHHHlllllllEEEELlLEEELLlll


DSSP  --------------HHHL------------------LLHHHHHHHHHHHLLLEEEEL---
Query --------------LVFN------------------NGIDAFYARCEQVGVDSVLVA---  129
ident                                                  |     |    
Sbjct gdifalpagevlgsYGVMnprpgywgagplciadgvEEVRRAVRLQIRRGAKVIXVMasg  207
DSSP  lllllllhhhhhhhHLLLllllllllllleeelllhHHHHHHHHHHHHHLLLLEEEElll


DSSP  ----------llLHHH--LHHHHHHHHHLLLEEEEEELLLLlhhHHHHHH-HHLLlLEEE
Query ----------dvPVEE--SAPFRQAALRHNIAPIFICPPNAdddLLRQVA-SYGRgYTYL  176
ident                          | | |          |                   
Sbjct gvmsrddnpnfaQFSPeeLKVIVEEAARQNRIVSAHVHGKA---GIMAAIkAGCK-SLEH  263
DSSP  llllllllllllLLLHhhHHHHHHHHHHLLLLEEEEELLHH---HHHHHHhHLLL-EEEE


DSSP  LlllHHHHHHHHHHhLLLLEEELLLLLL---------------------hhhhhhhHHHL
Query LalpLHHLIEKLKEyHAAPALQGFGISS---------------------peqvsaaVRAG  215
ident          |  ||                                              
Sbjct VsyaDEEVWELMKE-KGILYVATRSVIEiflasngeglvkeswaklqaladshlkaYQGA  322
DSSP  LlllLHHHHHHHHH-HLLEEELLHHHHHhhhhhllllllllhhhlllhhhhhhhhhHHHH


DSSP  -----lLEEEELLhhhhhhhhllllhhhhhhhhhhhhhhHHHL-----------------
Query -----aAGAISGSaivkiieknlaspkqmlaelrsfvsaMKAA-----------------  253
ident                                          |                  
Sbjct ikagvtIALGTDT----------------------apggPTALelqfaverggmtpleai  360
DSSP  hhllllEELLLLL----------------------llllLLHHhhhhhhhlllllhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  253
ident                                                             
Sbjct kaatanaplsvgpqapltgqlregyeadvialeenpledikvfqepkavthvwkggklfk  420
DSSP  hhhlllhhhhhhhhlllllllllllllleeeelllllllhhhhhlhhheeeeeelleeee


DSSP  --------------ll
Query --------------sr  255
ident                 
Sbjct gpgigpwgedarnpfl  436
DSSP  llllllllllllllll


No 25: Query=1bksA Sbjct=1j6pA Z-score=6.9

back to top
DSSP  ------------------------------------lhhhhhhhhhhhhllllEEEEEEE
Query ------------------------------------meryenlfaqlndrregAFVPFVT   24
ident                                                             
Sbjct hhxiignclilkdfssepfwgaveiengtikrvlqgevkvdldlsgklvxpalFNTHTHA   60
DSSP  leeeeeeeeelllllllleeeeeeeelleeeeeeelllllleellleeeeeleEEEEELH


DSSP  LLLL-----------------------------lHHHHHHHHHHHHHLLL-LLEEEELll
Query LGDP-----------------------------gIEQSLKIIDTLIDAGA-DALELGVpf   54
ident                                                 |           
Sbjct PXTLlrgvaedlsfeewlfskvlpiedrltekxaYYGTILAQXEXARHGIaGFVDXYF--  118
DSSP  HHHHhllllllllhhhhhhllhhhhhllllhhhhHHHHHHHHHHHHLLLEeEEEEEEL--


DSSP  lllllllhhhhhhhhhhhhhlllhhHHHHHHHHHHHHLlLLLEEEEELHH--hhHLLLHh
Query sdpladgptiqnanlrafaagvtpaQCFEMLALIREKHpTIPIGLLMYAN--lvFNNGId  112
ident                                   |                         
Sbjct -------------------------HEEWIAKAVRDFG-XRALLTRGLVDsngdDGGRL-  151
DSSP  -------------------------LHHHHHHHHHHHL-LEEEEEEEELLllllLLLHH-


DSSP  HHHHH-HHHHL------LLEEEEL---LLLHHHLHHHHHHHHHLLLEEEEEEL----LLL
Query AFYAR-CEQVG------VDSVLVA---DVPVEESAPFRQAALRHNIAPIFICP----PNA  158
ident                                |        |   |               
Sbjct EENLKlYNEWNgfegriFVGFGPHspyLCSEEYLKRVFDTAKSLNAPVTIHLYetskEEY  211
DSSP  HHHHHhHHHHLlhhhleEEEEEELlllLLLHHHHHHHHHHHHHHLLLEEEEELllllLLL


DSSP  L-HHHHHHhHHHLLLLEEELlllHHHHHHHHHhHLLLLEEELlLLLL-hhhhhHHHHHL-
Query D-DDLLRQvASYGRGYTYLLalpLHHLIEKLKeYHAAPALQGfGISS-peqvsAAVRAG-  215
ident |  | |                        ||                     | |    
Sbjct DlEDILNIgLKEVKTIAAHCvhlPERYFGVLK-DIPFFVSHNpASNLklgngiAPVQRXi  270
DSSP  LlHHHHLLlLLLLLEEEEELlllLHHHHHHHL-LLLEEEEELhHHHHhlllllLLHHHHh


DSSP  ----lLEEEELLhHHHHHhhllllhhhhhhhhhhHHHHHHHLLL----------------
Query ----aAGAISGSaIVKIIeknlaspkqmlaelrsFVSAMKAASR----------------  255
ident                                                             
Sbjct ehgxkVTLGTDG-AASNN--------------slNLFFEXRLASllqkaqnprnldvntc  315
DSSP  hllleEEELLLL-LLLLL--------------llLHHHHHHHHHhhhhllllllllhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  255
ident                                                             
Sbjct lkxvtydgaqaxgfksgkieegwnadlvvidldlpexfpvqniknhlvhafsgevfatxv  375
DSSP  hhhhlhhhhhhhlllllllllllllleeeeelllhhhllhhhhhhhhhhllllllleeee


DSSP  --------------------------------
Query --------------------------------  255
ident                                 
Sbjct agkwiyfdgeyptidseevkrelariekelys  407
DSSP  lleeeeellllllllhhhhhhhhhhhhhhhhl


No 26: Query=1bksA Sbjct=1onxA Z-score=6.7

back to top
DSSP  ----------------------------------------------lhhhhhhhhhhhhl
Query ----------------------------------------------meryenlfaqlndr   14
ident                                                             
Sbjct midytaagftllqgahlyapedrgicdvlvangkiiavasnipsdivpnctvvdlsgqil   60
DSSP  llllhhhlleeeeeeeeellleeeeeeeeeelleeeeeellllllllllleeeellllee


DSSP  llleeEEEEELLL-------llhhHHHHhHHHHHHLLLLLEEEEL--LLLLlllllhhhh
Query regafVPFVTLGD-------pgieQSLKiIDTLIDAGADALELGV--PFSDpladgptiq   65
ident         | |                     |  ||                       
Sbjct cpgfiDQHVHLIGgggeagpttrtPEVA-LSRLTEAGVTSVVGLLgtDSIS---------  110
DSSP  eeleeEEEELLLLllllllhhhllLLLL-HHHHHHLLEEEEEELLllLLLL---------


DSSP  hhhhhhhhhlLLHHHHHHHHHHHHHHLllLLEEEEE---lHHHHhLLLHHHHHHHHhhHL
Query nanlrafaagVTPAQCFEMLALIREKHptIPIGLLM---yANLVfNNGIDAFYARCeqVG  122
ident             |           |        |                   |      
Sbjct ----------RHPESLLAKTRALNEEG-iSAWMLTGayhvPSRTiTGSVEKDVAII--DR  157
DSSP  ----------LLHHHHHHHHHHHHHHL-lEEEEEEEllllLLLLlLLLHHHHHHHL--LL


DSSP  LLEEEEL------llLHHH-LHHHHHHHHHLL------LEEEEEELLLLLhhhHHHH---
Query VDSVLVA------dvPVEE-SAPFRQAALRHN------IAPIFICPPNADddlLRQV---  166
ident |  |  |        |     |                    |          |      
Sbjct VIGVXCAisdhrsaaPDVYhLANMAAESRVGGllggkpGVTVFHMGDSKK--aLQPIydl  215
DSSP  EEEEEEEelllllllLLHHhHHHHHHHHHHHHhhhlllLEEEEEELLLLL--lLHHHhhh


DSSP  ------hHHLLlLEEEL--lLLHHHHHHHHHHHLLlLEEELlLLLL-hhHHHHHHHHL--
Query ------aSYGRgYTYLL--aLPLHHLIEKLKEYHAaPALQGfGISS-peQVSAAVRAG--  215
ident                      ||                                     
Sbjct lencdvpISKL-LPTHVnrnVPLFEQALEFARKGG-TIDIT-SSIDepvAPAEGIARAvq  272
DSSP  hhlllllHHHE-EEELHhhlHHHHHHHHHHHHLLL-LEEEE-LLLLlllLHHHHHHHHhh


DSSP  ------lLEEEELLhHHHHhhhllllhhhhhhhhhhhHHHHHHLLL--------------
Query ------aAGAISGSaIVKIieknlaspkqmlaelrsfVSAMKAASR--------------  255
ident            |                                                
Sbjct agiplarVTLSSDG-NGSQ--pffddegnlthigvagFETLLETVQvlvkdydfsisdal  329
DSSP  llllhhhEEEELLL-LLEE--eeellllleeeeeellLHHHHHHHHhhhhhhlllhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  255
ident                                                             
Sbjct rpltssvagflnltgkgeilpgndadllvmtpelrieqvyargklmvkdgkacvkgtfet  389
DSSP  hhhlhhhhhhlllllllllllllllleeeellllleeeeeelleeeeelleellllllll


DSSP  -
Query -  255
ident  
Sbjct d  390
DSSP  l


No 27: Query=1bksA Sbjct=4qrnA Z-score=6.7

back to top
DSSP  lhhhhhhhhhhhhllllEEEEEEELLL---------------------------------
Query meryenlfaqlndrregAFVPFVTLGD---------------------------------   27
ident                                                             
Sbjct -smtqdlktggeqgylrIATEEAFATReiidvylrmirdgtadkgmvslwgfyaqspser   59
DSSP  -llllllllllllllllEEEEEEELLHhhhhhhhhhhhhllllhhhhhhhhhhhhlllhh


DSSP  ----llhhHHHH-HHHHHHH--LLLLLEEEE---LLLLLlllllhhhhhhhhhhhhhllL
Query ----pgieQSLK-IIDTLID--AGADALELG---VPFSDpladgptiqnanlrafaagvT   77
ident           |        |      |                                 
Sbjct atqilerlLDLGeRRIADMDatGIDKAILALtspGVQPL------------hdldeartL  107
DSSP  hhhhhhhhHLLLhHHHHHHHhlLLLEEEEEElllLLLLL------------llhhhhhhH


DSSP  HHHHHHHHHHHHHHLLL-LLEEEEELHHHHHllLHHHHHHHHH-HHLLLEEEELLL----
Query PAQCFEMLALIREKHPT-IPIGLLMYANLVFnnGIDAFYARCE-QVGVDSVLVADV----  131
ident        ||    | |                        |     |             
Sbjct ATRANDTLADACQKYPDrFIGMGTVAPQDPE--WSAREIHRGArELGFKGIQINSHtqgr  165
DSSP  HHHHHHHHHHHHHHLLLlEEELLLLLLLLHH--HHHHHHHHHHhLLLLLLEEELLLllll


DSSP  LHHH--LHHHHHHHHHLLLEEEEE----------------------eLLLL-lhhHHHHH
Query PVEE--SAPFRQAALRHNIAPIFI----------------------cPPNA-dddLLRQV  166
ident    |    |   |                                          |||  
Sbjct YLDEefFDPIFRALVEVDQPLYIHpatspdsmidpmleagldgaifgFGVEtgmhLLRLI  225
DSSP  LLLLhhHHHHHHHHHHHLLLEEELlllllllllhhhhhhlllllllhHHHHhhhhHHHHH


DSSP  -------hhhlLLLEEEllllhhHHHHH-------------------------hhHHLL-
Query -------asygRGYTYLlalplhHLIEK-------------------------lkEYHA-  193
ident                         |                              |    
Sbjct tigifdkypslQIMVGH---mgeALPYWlyrldymhqagvrsqryermkplkktiEGYLk  282
DSSP  hhlhhhhllllLEEELH---hhhLHHHHhhhhhhhhhhhhhlllllllllllllhHHHHh


DSSP  --LLEEELLllllhhHHHH-HHHHL-------lLEEEELLHHhhhhhhllllhhhhhhhh
Query --APALQGFgisspeQVSA-AVRAG-------aAGAISGSAIvkiieknlaspkqmlael  243
ident                     |                                       
Sbjct snVLVTNSG------VAWEpAIKFCqqvmgedrVMYAMDYPY------------------  318
DSSP  hlEEEELLL------LLLHhHHHHHhhhhlhhhEELLLLLLL------------------


DSSP  hhHHHHHHHLLL-----------------------
Query rsFVSAMKAASR-----------------------  255
ident    |     |                         
Sbjct -qYVADEVRAMDamdmsaqtkkkffqtnaekwfkl  352
DSSP  -lLLHHHHHHHHlllllhhhhhhhhlhhhhhhlll


No 28: Query=1bksA Sbjct=3griA Z-score=6.6

back to top
DSSP  -------------------------------------lhhhhhhhhhhhhlllleEEEEE
Query -------------------------------------meryenlfaqlndrregaFVPFV   23
ident                                                         |   
Sbjct xklikngkvlqngelqqadilidgkvikqiapaiepsngvdiidakghfvspgfvDVHVH   60
DSSP  leeeelleeeelleeeeleeeeelleeeeeellllllllleeeelllleeeeleeEEEEL


DSSP  -ELLLLLhhhHHHHHHHHHHLL--lLLEEE-ELLLlllllllhhhhhhhhhhhhhllLHH
Query -TLGDPGieqSLKIIDTLIDAG--aDALEL-GVPFsdpladgptiqnanlrafaagvTPA   79
ident                      |                                      
Sbjct lREPGGEykeTIETGTKAAARGgftTVCPXpNTRP----------------vpdsveHFE  104
DSSP  lLLLLLLlllLHHHHHHHHHHLleeEEEELlLLLL----------------llllhhHHH


DSSP  HHHHHHHHHhhhllLLLEEEEelHHHHhllLHHHhHHHHHHHLLLEEEE--LLLL-HHHL
Query QCFEMLALIrekhpTIPIGLLmyANLVfnnGIDAfYARCEQVGVDSVLV--ADVP-VEES  136
ident                                           |          |      
Sbjct ALQKLIDDN--aqvRVLPYAS-iTTRQlgkELVD-FPALVKEGAFAFTDdgVGVQtASXX  160
DSSP  HHHHHHHHH--lllEELLLEE-lLHHHlllLLLL-HHHHHLLLLLLEEEllLLLLlHHHH


DSSP  HHHHHHHHHLLLEEEEEEL--------------------------LLLLHhHHHHHHHHL
Query APFRQAALRHNIAPIFICP--------------------------PNADDdLLRQVASYG  170
ident       |   | |    |                                          
Sbjct YEGXIEAAKVNKAIVAHCEdnsliyggaxhegkrskelgipgipnICESV-QIARDVLLA  219
DSSP  HHHHHHHHHHLLLEEELLLlhhhllllleellhhhhhhllleellHHHHH-HHHHHHHHH


DSSP  -----LLLEEELlllHHHHHHHHHHHL----lLLEEELlllllhhHHHH-----------
Query -----RGYTYLLalpLHHLIEKLKEYH----aAPALQGfgisspeQVSA-----------  210
ident                                   |                         
Sbjct eaagcHYHVCHV--sTKESVRVIRDAKragihVTAEVT------pHHLLlteddipgnna  271
DSSP  hhhllLEEELLL--lLHHHHHHHHHHHhllllEEEEEL------hHHHHllhhhlllllh


DSSP  ---------------hhHHLL-----LEEEELLHHhhhhhhllllhhhhhhhhhhHHHHH
Query ---------------avRAGA-----AGAISGSAIvkiieknlaspkqmlaelrsFVSAM  250
ident                    |             |                          
Sbjct iykxnpplrstedrealLEGLldgtiDCIATDHAP--hardekaqpxekapfgivGSETA  329
DSSP  hhllllllllhhhhhhhHHHHhllllLEELLLLLL--llhhhhllllllllllllLLLLH


DSSP  HHLLL-------------------------------------------------------
Query KAASR-------------------------------------------------------  255
ident                                                             
Sbjct FPLLYthfvkngdwtlqqlvdyltikpcetfnleygtlkengyadltiidldseqeikge  389
DSSP  HHHHHhhhlllllllhhhhhhhhlhhhhhhllllllllllllllleeeeelllleellhh


DSSP  ---------------------------------
Query ---------------------------------  255
ident                                  
Sbjct dflskadntpfigykvygnpiltxvegevkfeg  422
DSSP  hllllllllllllleelleeeeeeelleeeeel


No 29: Query=1bksA Sbjct=2ob3A Z-score=6.6

back to top
DSSP  ------lhhhhhhHHHHhhlllleeEEEEE-----------llLLLHHHHHHHHHHHHHL
Query ------meryenlFAQLndrregafVPFVT-----------lgDPGIEQSLKIIDTLIDA   43
ident               |                                             
Sbjct drintvrgpitisEAGF-----tltHEHICgssagflrawpefFGSRKALAEKAVRGLRR   55
DSSP  lleeelleeelhhHHLL-----eeeEELLEellllhhhhlhhhHLLHHHHHHHHHHHHHH


DSSP  LL------LLEEEELLllllllllhhhhhhhhhhhhhlllhhhhhhHHHHHHHHL----l
Query GA------DALELGVPfsdpladgptiqnanlrafaagvtpaqcfeMLALIREKH----p   93
ident                                                  |  |       
Sbjct ARaagvrtIVDVSTFD---------------------------igrDVSLLAEVSraadv   88
DSSP  HHhlllleEEELLLHH---------------------------hllLHHHHHHHHhhhll


DSSP  LLLEEEEELHHH------hhllLHHHHHHHHHH-------HLLLEEEELL-----lLHHH
Query TIPIGLLMYANL------vfnnGIDAFYARCEQ-------VGVDSVLVAD-----vPVEE  135
ident  |                        |  |  |              ||         | 
Sbjct HIVAATGLWFDPplsmrlrsveELTQFFLREIQygiedtgIRAGIIXVATtgkatpFQEL  148
DSSP  EEELEEELLLLLlhhhhlllhhHHHHHHHHHHHlllllllLLLLEEEEELlllllhHHHH


DSSP  -LHHHHHHHHHLLLEEEEEE-LLLLlhhHHHHHHHH--------lLLLEEEL-llLHHHH
Query -SAPFRQAALRHNIAPIFIC-PPNAdddLLRQVASY--------gRGYTYLL-alPLHHL  184
ident        | |                     | |           |              
Sbjct vLKAAARASLATGVPVTTHTaASQR---DGEQQAAIfeseglspsRVCIGHSddtDDLSY  205
DSSP  hHHHHHHHHHHHLLLEEEELlHHHL---HHHHHHHHhhhllllhhHEEELLHhhlLLHHH


DSSP  HHHHHHHLLlLEEELlLLLL-------------------hHHHHHHHHHL-------lLE
Query IEKLKEYHAaPALQGfGISS-------------------pEQVSAAVRAG-------aAG  218
ident    |             |                              |           
Sbjct LTALAARGY-LIGLD-HIPYsaiglednasasallgirswQTRALLIKALidqgymkqIL  263
DSSP  HHHHHHLLL-EEEEL-LLLLllllllllhhhhhhhllllhHHHHHHHHHHhhlllhhhEE


DSSP  EEELL------hhhhHHHHllllhhhhhhhhHHHHHHHHHLLL-----------------
Query AISGS------aivkIIEKnlaspkqmlaelRSFVSAMKAASR-----------------  255
ident                |                                            
Sbjct VSNDWtfgfssyvtnIMDV-------mdrvnPDGMAFIPLRVIpflrekgvpqetlagit  316
DSSP  ELLLLlleellllllHHHH-------hhhhlLLHHHHHHHLHHhhhhhllllhhhhhhhh


DSSP  -------------
Query -------------  255
ident              
Sbjct vtnparflsptlr  329
DSSP  lhhhhhhhlllll


No 30: Query=1bksA Sbjct=3pnuA Z-score=6.6

back to top
DSSP  lhhhhhhhhhhhhllllEEEEEEELLlllHHHHHHHHHHHHHLLLLLEEEELLLLLllll
Query meryenlfaqlndrregAFVPFVTLGdpgIEQSLKIIDTLIDAGADALELGVPFSDplad   60
ident                                    |          |             
Sbjct --enlyfqsnamklknpLDMHLHLRD---NQMLELIAPLSARDFCAAVIMPNLIPP----   51
DSSP  --llllllllleeeellEEEEELLLL---HHHHHHHHHHHHLLLLEEEELLLLLLL----


DSSP  lhhhhhhhhhhhhhlllHHHHHHHHHHHH----hhllLLLEEEEELHhhhhlllHHHHHH
Query gptiqnanlrafaagvtPAQCFEMLALIR----ekhpTIPIGLLMYAnlvfnngIDAFYA  116
ident                            |         |    |              |  
Sbjct --------------lcnLEDLKAYKMRILkackdenfTPLMTLFFKN------yDEKFLY   91
DSSP  --------------lllHHHHHHHHHHHHhhhlllllEEEEEEELLL------lLHHHHH


DSSP  HHHHhLLLEEEEL-----------LLLHH--HLHHHHHHHHHLLLEEEEEEL--------
Query RCEQvGVDSVLVA-----------DVPVE--ESAPFRQAALRHNIAPIFICP--------  155
ident                                   |   |    ||               
Sbjct SAKD-EIFGIXLYpagittnsnggVSSFDieYLKPTLEAMSDLNIPLLVHGEtndfvmdr  150
DSSP  HHLL-LLLEEEELlllllllllllLLLLLhhHHHHHHHHHHHLLLLEEELLLllllhhhl


DSSP  LLLLHHHHHHHHHH---lLLLEEELlllHHHHHHHHHHHLLLLEEELlllllhhHHHH--
Query PNADDDLLRQVASY---gRGYTYLLalpLHHLIEKLKEYHAAPALQGfgisspeQVSA--  210
ident            |                   | | || |    |                
Sbjct ESNFAKIYEKLAKHfprlKIVMEHI--tTKTLCELLKDYENLYATIT------lHHLIit  202
DSSP  LHHHHHHHHHHHHHllllLEEELLL--lLHHHHHHHHHLLLEEEEEL------lHHHLll


DSSP  --------------------------hHHHL------lLEEEELLHhhhHHHHllllhhh
Query --------------------------aVRAG------aAGAISGSAivkIIEKnlaspkq  238
ident                                           | ||      |       
Sbjct lddviggkmnphlfckpiakryedkeaLCELafsgyekVMFGSDSA---PHPK-------  252
DSSP  hhhhhlllllhhhllllllllhhhhhhHHHHhhlllllEEELLLLL---LLLL-------


DSSP  hhhhhhhHHHHHHHLLL-------------------------------------------
Query mlaelrsFVSAMKAASR-------------------------------------------  255
ident                                                             
Sbjct gcaagvfSAPVILPVLAelfkqnsseenlqkflsdntckiydlkfkedkiltleekewqv  312
DSSP  lllllllLHHHHHHHHHhhhhhhllhhhhhhhhlhhhhhhhlllllllleeeeellleel


DSSP  --------------------------
Query --------------------------  255
ident                           
Sbjct pnvyedkynqvvpymageilkfqlkh  338
DSSP  llleelllleellllllleelleell


No 31: Query=1bksA Sbjct=1bf6A Z-score=6.5

back to top
DSSP  lhhhhhhhhhhhhlllleeeeEEEL------------lLLLHHHHHHHHHHHHHLLLLLE
Query meryenlfaqlndrregafvpFVTL------------gDPGIEQSLKIIDTLIDAGADAL   48
ident                                                    |   |    
Sbjct ----------sfdptgytlahEHLHidlsgfknnvdcrLDQYAFICQEMNDLMTRGVRNV   50
DSSP  ----------lllllleeeeeELLLeelhhhhllhhheELLHHHHHHHHHHHHHLLEEEE


DSSP  EEellLLLLllllhhhhhhhhhhhhhlllhhhHHHHHHHHHHHlllllEEEEELH-----
Query ELgvpFSDPladgptiqnanlrafaagvtpaqCFEMLALIREKhptipIGLLMYA-----  103
ident                                                             
Sbjct IEmtnRYMG----------------------rNAQFMLDVMRE-tginVVACTGYyqdaf   87
DSSP  EElllHHHL----------------------lLHHHHHHHHHH-hlleEEEEELLllhhh


DSSP  ---------hhhhllLHHHHHHH---hhHHLLLEEEEL-------lllHHHL-HHHHHHH
Query ---------nlvfnnGIDAFYAR---ceQVGVDSVLVA-------dvpVEES-APFRQAA  143
ident                                                  |        | 
Sbjct fpehvatrsvqelaqEMVDEIEQgidgtELKAGIIAEIgtsegkitplEEKVfIAAALAH  147
DSSP  lllhhhhllhhhhhhHHHHHHHLlllllLLLEEEEEEEelllllllhhHHHHhHHHHHHH


DSSP  HHLLLEEEEEELLLLlhhHHHHHHHH--------lLLLEEEL-lLLHHHHHHHHHHHLLl
Query LRHNIAPIFICPPNAdddLLRQVASY--------gRGYTYLL-aLPLHHLIEKLKEYHAa  194
ident                                    |              | |     | 
Sbjct NQTGRPISTHTSFST---MGLEQLALlqahgvdlsRVTVGHCdlKDNLDNILKMIDLGA-  203
DSSP  HHHLLLEEEELHHHL---LHHHHHHHhhhllllhhHEEELLLllLLLHHHHHHHHHLLL-


DSSP  LEEELLLLL----lHHHHHHHHHHL-------lLEEEELL--hhHHHHHHLlllhhhhhh
Query PALQGFGIS----sPEQVSAAVRAG-------aAGAISGS--aiVKIIEKNlaspkqmla  241
ident                |   |   |                                    
Sbjct YVQFDTIGKnsyypDEKRIAMLHALrdrgllnrVMLSMDItrrsHLKANGG---------  254
DSSP  EEEELLLLLlllllHHHHHHHHHHHhhlllhhhEEELLLLllhhHLHHHLL---------


DSSP  hhhHHHH-HHHHLLL----------------------
Query elrSFVS-AMKAASR----------------------  255
ident               |                      
Sbjct ygyDYLLtTFIPQLRqsgfsqadvdvmlrenpsqffq  291
DSSP  lllLHHHhLHHHHHHhllllhhhhhhhhlhhhhhhll


No 32: Query=1bksA Sbjct=3k2gB Z-score=6.5

back to top
DSSP  ------------lhhhhhhhhhhhhlllleeeeEEEL-----------------------
Query ------------meryenlfaqlndrregafvpFVTL-----------------------   25
ident                                                             
Sbjct slselspchvrsgrixtvdgpipssalghtlxhEHLQndcrcwwnppqeperqylaeapi   60
DSSP  llllllllllllleeeelleeeehhhllleellLLLLeelhhhllllllhhhhhhhhlll


DSSP  -------------------lLLLHHHHHHHHHHHHHLLLLLEEEELlLLLLllllhhhhh
Query -------------------gDPGIEQSLKIIDTLIDAGADALELGVpFSDPladgptiqn   66
ident                                      |                      
Sbjct sieilselrqdpfvnkhniaLDDLDLAIAEVKQFAAVGGRSIVDPTcRGIG---------  111
DSSP  lhhhhhhhhllhhhllllleELLHHHHHHHHHHHHHLLLLEEEELLlLLLL---------


DSSP  hhhhhhhhlllhhhHHHHHHHHHHHlllllEEEEELH--------------hhhhllLHH
Query anlrafaagvtpaqCFEMLALIREKhptipIGLLMYA--------------nlvfnnGID  112
ident                   |  |                                    | 
Sbjct -------------rDPVKLRRISAE-tgvqVVXGAGYylassxpetaarlsaddiadEIV  157
DSSP  -------------lLHHHHHHHHHH-hlleEEELLLLllhhhllhhhhlllhhhhhhHHH


DSSP  HHHHH---hhHHLLLEEEeLLLL-------HHHL-HHHHHHHHHLLLEEEEEE-LLLLlh
Query AFYAR---ceQVGVDSVLvADVP-------VEES-APFRQAALRHNIAPIFIC-PPNAdd  160
ident |                              | |      |  |                
Sbjct AEALEgtdgtDARIGLIG-EIGVssdftaeEEKSlRGAARAQVRTGLPLXVHLpGWFR--  214
DSSP  HHHHLlllllLLLLLLEE-EELLlllllhhHHHHhHHHHHHHHHHLLLEEELLlLLLL--


DSSP  hHHHHHHHH--------lLLLEEEL--llLHHHHHHHHHHhLLLLEEELlLLLL------
Query dLLRQVASY--------gRGYTYLL--alPLHHLIEKLKEyHAAPALQGfGISS------  204
ident  |   |                               |     |       |        
Sbjct -LAHRVLDLveeegadlrHTVLCHXnpshXDPVYQATLAQ-RGAFLEFD-XIGXdffyad  271
DSSP  -LHHHHHHHhhhllllhhHEEELLLhhhlLLHHHHHHHHH-HLLEEEEL-LLLLlleell


DSSP  -------HHHHHHHHHHL-------lLEEEELL--hhHHHHHHllllhhhhhhhhHHHHH
Query -------PEQVSAAVRAG-------aAGAISGS--aiVKIIEKnlaspkqmlaelRSFVS  248
ident           |  |                                              
Sbjct qgvqcpsDDEVARAILGLadhgyldrILLSHDVfvkxXLTRYG--------gngyAFVTK  323
DSSP  lleelllHHHHHHHHHHHhhlllhhhEEELLLLllhhHLHHHL--------llllLHHHH


DSSP  HHHHLLL----------------------------
Query AMKAASR----------------------------  255
ident       |                            
Sbjct HFLPRLRrhglddaaletlxvtnprrvfdasiegh  358
DSSP  LHHHHHHhllllhhhhhhhhlhhhhhhhlllllll


No 33: Query=1bksA Sbjct=2a3lA Z-score=6.5

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct qpdpiaadilrkepeqetfvrlnvplevptsdeveaykclqeclelrkryvfqetvapwe   60
DSSP  llllllllllllllllllllllllllllllllllllhhhhhhhhhhhhllllllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct keepfahypqgksdhcfemqdgvvhvfankdakedlfpvadatafftdlhhvlkviaagn  120
DSSP  lllllllllllllllllllllllllllllllllllllllllhhhhhhhhhhhhhhlllhh


DSSP  ---------------------------lhhhhhhhhhhhHLLLLEEE-EEEE--------
Query ---------------------------meryenlfaqlnDRREGAFV-PFVT--------   24
ident                                                             
Sbjct irtlchrrlvlleqkfnlhlmlnadkeflaqksaphrdfYNVRKVDThVHHSacmnqkhl  180
DSSP  hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhllllllLLLLEEEEeEELLllllhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------   24
ident                                                             
Sbjct lrfiksklrkepdevvifrdgtyltlrevfesldltgydlnvdlldvhadkstfhrfdkf  240
DSSP  hhhhhhhhhllllllleeelleeelhhhhhhhhlllllllllllllllllllllllllll


DSSP  --------------lLLLL-----HHHHHHHHHHHHHLL------lLLEEEELlllllll
Query --------------lGDPG-----IEQSLKIIDTLIDAG------aDALELGVpfsdpla   59
ident                               |                             
Sbjct nlkynpcgqsrlreiFLKQdnliqGRFLGEITKQVFSDLeaskyqmAEYRISI-------  293
DSSP  hhhhllllllhhhhhHLLLlllllLLLHHHHHHHHHHHHllllleeEEEEEEL-------


DSSP  llhhhhhhhhhhhhhllLHHHHHHHHHHhhHHLLLLLEEEEELHH-------------hh
Query dgptiqnanlrafaagvTPAQCFEMLALirEKHPTIPIGLLMYAN-------------lv  106
ident                     |                                       
Sbjct -----------ygrkmsEWDQLASWIVNndLYSENVVWLIQLPRLyniykdmgivtsfqn  342
DSSP  -----------llllllHHHHHHHHHHLllLLLLLEEEEEEEELLhhhhlllllllllhh


DSSP  HLLLHHHHHH------------hhhHHLLLEEEELL------------------------
Query FNNGIDAFYA------------rceQVGVDSVLVAD------------------------  130
ident     |                       |      |                        
Sbjct ILDNIFIPLFeatvdpdshpqlhvfLKQVVGFDLVDdeskperrptkhmptpaqwtnafn  402
DSSP  HHHHHLLHHHhhhhlhhhllllhhhHLLEEEEEEELllllllllllllllllllllllll


DSSP  -lLHHHLHHHHHHHHHLL----------LEEEE-EELLLLLhHHHHHHHHHLLlLEEEL-
Query -vPVEESAPFRQAALRHN----------IAPIF-ICPPNADdDLLRQVASYGRgYTYLL-  177
ident                  |          |             | |               
Sbjct paFSYYVYYCYANLYVLNklreskgmttITLRPhSGEAGDI-DHLAATFLTCH-SIAHGi  460
DSSP  llHHHHHHHHHHHHHHHHhhhlllllllLEELLlLLLLLLL-HHHHHHHHHLL-LLLLLh


DSSP  -lLLHHHHHHHHHHHLLlLEEELLLL---llhhhhhhhHHHL-----lLEEEELLHHHhh
Query -aLPLHHLIEKLKEYHAaPALQGFGI---sspeqvsaaVRAG-----aAGAISGSAIVki  228
ident        |                                                    
Sbjct nlRKSPVLQYLYYLAQI-GLAMSPLSnnslfldyhrnpFPVFflrglnVSLSTDDPLQ--  517
DSSP  hhHHLHHHHHHHHHHLL-LEEELHHHhlllllllllllHHHHhhllllEEELLLLHHH--


DSSP  hhhllllhhhhhhhhhhhhHHHHHLLL---------------------------------
Query ieknlaspkqmlaelrsfvSAMKAASR---------------------------------  255
ident                                                             
Sbjct ---------------ihltKEPLVEEYsiaasvwklsacdlceiarnsvyqsgfshalks  562
DSSP  ---------------hlllLLHHHHHHhhhhhhhlllhhhhhhhhhhhhhhllllhhhhh


DSSP  ------------------------------------------------------
Query ------------------------------------------------------  255
ident                                                       
Sbjct hwigkdyykrgpdgndihktnvphirvefrdtiwkeemqqvylgkavisdevvp  616
DSSP  hhlllllllllhhhllhhhhlllhhhhhhhhhhhhhhhhhhlllllllllllll


No 34: Query=1bksA Sbjct=3e74A Z-score=6.5

back to top
DSSP  -------------------------------------lhhhhhhhhhhhhllllEEEEEE
Query -------------------------------------meryenlfaqlndrregAFVPFV   23
ident                                                             
Sbjct sfdliikngtvilenearvvdiavkggkiaaigqdlgdakevxdasglvvspgxVDAHTH   60
DSSP  leeeeeelleeelllleeeleeeeelleeeeeellllleeeeeelllleeeeleEEEEEL


DSSP  elllllhhhHHHHHHHHHHL--LLLLEEEELLllllllllhhhhhhhhhhhhhlLLHH--
Query tlgdpgieqSLKIIDTLIDA--GADALELGVPfsdpladgptiqnanlrafaagVTPA--   79
ident                            |                                
Sbjct --------iGYETGTRAAAKggITTXIEXPLN---------------------qLPATvd   91
DSSP  --------lLHHHHHHHHHHllEEEEEELLLL---------------------lLLLLll


DSSP  -HHHHHHHHHHHH--llLLLEEEEELHHHHHlllhhhHHHHHHHHLLLEEEEL--LLLHH
Query -QCFEMLALIREK--hpTIPIGLLMYANLVFnngidaFYARCEQVGVDSVLVA--DVPVE  134
ident     |                                       |||        ||   
Sbjct rASIELKFDAAKGkltiDAAQLGGLVSYNID------RLHELDEVGVVGFXCFvrDVNDW  145
DSSP  hHHHHHHHHHHLLllllEEEELEELLLLLLL------LHHHHHHHLLLLEEEEllLLLHH


DSSP  HLHHHHHHHHHLLLEEEEEEL-----------------------------lLLLHhHHHH
Query ESAPFRQAALRHNIAPIFICP-----------------------------pNADDdLLRQ  165
ident       |            |                                      | 
Sbjct QFFKGAQKLGELGQPVLVHCEnalicdelgeeakregrvtahdyvasrpvfTEVE-AIRR  204
DSSP  HHHHHHHHHHHHLLLEEEELLlhhhhhhhhhhhhhhllllhhhhhhlllhhHHHH-HHHH


DSSP  HHHHL-----LLLEEELlllHHHHHHHHHHHL----lLLEEELlllllhhHHHH------
Query VASYG-----RGYTYLLalpLHHLIEKLKEYH----aAPALQGfgisspeQVSA------  210
ident |         |              |                                  
Sbjct VLYLAkvagcRLHVCHV--sSPEGVEEVTRARqegqdITCESC-------PHYFvldtdq  255
DSSP  HHHHHhhhllLEEELLL--lLHHHHHHHHHHHhllllEEEEEL-------LHHHhllhhh


DSSP  --------------------------hhHHLLLEEEELlHHHHhhHHLLLL-hhhhhhhh
Query --------------------------avRAGAAGAISGsAIVKiiEKNLAS-pkqmlael  243
ident                                     |                       
Sbjct feeigtlakcsppirdlenqkgxweklfNGEIDCLVSD-HSPC--PPEXKAgnixkawgg  312
DSSP  hhhhlhhhllllllllhhhhhhhhhhhhLLLLLEELLL-LLLL--LLLLLLlllllllll


DSSP  hhHHHHHHHLLL------------------------------------------------
Query rsFVSAMKAASR------------------------------------------------  255
ident                                                             
Sbjct iaGLQSCXDVXFdeavqkrgxslpxfgklxatnaadifglqqkgriapgkdadfvfiqpn  372
DSSP  llLHHHHHHHHHhhhlllllllhhhhhhhhlhhhhhhlllllllllllllllleeeeell


DSSP  ---------------------------------------------------------
Query ---------------------------------------------------------  255
ident                                                          
Sbjct ssyvltnddleyrhkvspyvgrtigaritktilrgdviydieqgfpvapkgqfilkh  429
DSSP  lleellhhhllllllllllllleelleeeeeeelleeeeelllllllllllleelll


No 35: Query=1bksA Sbjct=3mtwA Z-score=6.4

back to top
DSSP  lhhhhhhhhhhHHLL-------------------------------------------ll
Query meryenlfaqlNDRR-------------------------------------------eg   17
ident             |                                               
Sbjct aeikavsaarlLDVAsgkyvdnplvivtdgritsigkkgdavpagatavdlpgvtllpgl   60
DSSP  lleeeeeeeeeEELLlleeeeleeeeeelleeeeeeellllllllleeeeeeeeeeeele


DSSP  EEEEEEEL--------------llLLHHHHHHHHHHHHHLLL-LLEE-EELLllllllll
Query AFVPFVTL--------------gdPGIEQSLKIIDTLIDAGA-DALE-LGVPfsdpladg   61
ident                                        ||                   
Sbjct IDMHVHLDslaevggynsleysdrFWSVVQTANAKKTLEAGFtTVRNvGAAD--------  112
DSSP  EEEEELLLllllllhhhhhhllhhHHHHHHHHHHHHHHHLLEeEEEElLLLL--------


DSSP  hhhhhhhhhhhhhlllhhhHHHHHHHHHHH--lllLLEEE-EELH---------------
Query ptiqnanlrafaagvtpaqCFEMLALIREK--hptIPIGL-LMYA---------------  103
ident                           |                                 
Sbjct -----------------ydDVGLREAIDAGyvpgpRIVTAaISFGatgghcdstffppsm  155
DSSP  -----------------lhHHHHHHHHHLLlllllEEEELlLLEEllllllllllllhhh


DSSP  ---HHHH-------llLHHHHHHHHhhhlLLEEEEL---------------lllHHHLHH
Query ---NLVF-------nnGIDAFYARCeqvgVDSVLVA---------------dvpVEESAP  138
ident    |                                                   ||   
Sbjct dqkNPFNsdspdearkAVRTLKKYG----AQVIXICatggvfsrgnepgqqqltYEEMKA  211
DSSP  lllLLLLlllhhhhhhHHHHHHHLL----LLEEEEEllllllllllllllllllHHHHHH


DSSP  HHHHHHHLLLEEEEEELLLLlhhHHHHHH-HHLLlLEEELlllHHHHHHHHHHhLLLLEE
Query FRQAALRHNIAPIFICPPNAdddLLRQVA-SYGRgYTYLLalpLHHLIEKLKEyHAAPAL  197
ident     |    |               |                     |        |   
Sbjct VVDEAHMAGIKVAAHAHGAS---GIREAVrAGVD-TIEHAslvDDEGIKLAVQ-KGAYFS  266
DSSP  HHHHHHHLLLEEEEEELLHH---HHHHHHhLLLL-EEEELlllLHHHHHHHHH-HLLEEE


DSSP  ELlLLLL-----------------------hhhhhhhHHHL-----lLEEEELLhHHHHh
Query QGfGISS-----------------------peqvsaaVRAG-----aAGAISGSaIVKIi  229
ident                                       |                     
Sbjct MD-IYNTdytqaegkkngvlednlrkdrdigelqrenFRKAlkagvkMVYGTDA-GIYP-  323
DSSP  LL-LLLHhhhhhhhhhhlllhhhhhhhhhhhhhhhhhHHHHhhhlleEELLLLL-LLLL-


DSSP  hhllllhhhhhhhhhHHHHhHHHL------------------------------------
Query eknlaspkqmlaelrSFVSaMKAA------------------------------------  253
ident                        |                                    
Sbjct --------------hGDNA-KQFAvmvrygatplqaiqsatltaaealgrskdvgqvavg  368
DSSP  --------------lLLHH-HHHHhhhhllllhhhhhhhllhhhhhhhllllllllllll


DSSP  ----------------------------------ll
Query ----------------------------------sr  255
ident                                     
Sbjct rygdmiavagdpladvttlekpvfvmkggavvkapx  404
DSSP  lllleeeelllllllhhhhhllleeeelleeeelll


No 36: Query=1bksA Sbjct=2y1hB Z-score=6.4

back to top
DSSP  lhhhhhhhhhhhhlllleeeeEEELLLLLHHHHHHHHHHHHHLLLLLEEEElllllllll
Query meryenlfaqlndrregafvpFVTLGDPGIEQSLKIIDTLIDAGADALELGvpfsdplad   60
ident                                           |   ||            
Sbjct -------------gvglvdchCHLSAPDFDRDLDDVLEKAKKANVVALVAV---------   38
DSSP  -------------llleeeeeELLLLHHHLLLHHHHHHHHHHLLEEEEEEL---------


DSSP  lhhhhhhhhhhhhhlllHHHHHHHHHHHHHhlllLLEEEEELH-----------hhhHLL
Query gptiqnanlrafaagvtPAQCFEMLALIREkhptIPIGLLMYA-----------nlvFNN  109
ident                                        |                    
Sbjct -----------aehsgeFEKIMQLSERYNG----FVLPCLGVHpvqgldqrsvtlkdLDV   83
DSSP  -----------lllhhhHHHHHHHHHHLLL----LEEEEELLLleelllleellhhhHHH


DSSP  LHhHHHHHHHHhLLLEEEEL---------------llLHHHLHHHHHHHHHLLLEEEEEE
Query GIdAFYARCEQvGVDSVLVA---------------dvPVEESAPFRQAALRHNIAPIFIC  154
ident                                               | | | |       
Sbjct AL-PIIENYKD-RLLAIGEVgldfsprfagtgeqkeeQRQVLIRQIQLAKRLNLPVNVHS  141
DSSP  HH-HHHHHHLL-LLLEEEEEeeellllllllhhhhhhHHHHHHHHHHHHHHHLLLEEEEE


DSSP  LLLLlHHHHHHHH--HHLLLLEEELlllHHHHHHHHHHhLLLLEEElllLLLHHH--hhh
Query PPNAdDDLLRQVA--SYGRGYTYLLalpLHHLIEKLKEyHAAPALQgfgISSPEQ--vsa  210
ident                                                   |         
Sbjct RSAG-RPTINLLQeqGAEKVLLHAF-dgRPSVAMEGVR-AGYFFSI--pPSIIRSgqkqk  196
DSSP  ELLH-HHHHHHHHhlLLLLEEEELL-llLHHHHHHHHH-LLLEEEE--lHHHHLLhhhhh


DSSP  HHHHL---lLEEEELLHHhhhhhhllllhhhhhhhhhhHHHHHHHLLL------------
Query AVRAG---aAGAISGSAIvkiieknlaspkqmlaelrsFVSAMKAASR------------  255
ident  |             |                        |                   
Sbjct LVKQLpltsICLETDSPA--------lgpekqvrnepwNISISAEYIAqvkgisveevie  248
DSSP  HHHHLlhhhEEELLLLLL--------llllllllllhhHHHHHHHHHHhhhlllhhhhhh


DSSP  -----------------
Query -----------------  255
ident                  
Sbjct vttqnalklfpklrhll  265
DSSP  hhhhhhhhhlllhhhhl


No 37: Query=1bksA Sbjct=3gg7A Z-score=6.1

back to top
DSSP  lhhhhhhhhhhhhlLLLE------------------------EEEEE-ELLLllhhhHHH
Query meryenlfaqlndrREGA------------------------FVPFV-TLGDpgieqSLK   35
ident                                                 |           
Sbjct --------------SLIDfhvhldlypdpvavaraceerqltVLSVTtTPAA-----WRG   41
DSSP  --------------LLEEeeelhhhlllhhhhhhhhhhllleEEELLlLHHH-----HHH


DSSP  HHhHHHH-LLLLLEEEEL---LLLLlllllhhhhhhhhhhhhhlLLHHHHHHHHHHHhhh
Query IIdTLID-AGADALELGV---PFSDpladgptiqnanlrafaagVTPAQCFEMLALIrek   91
ident     |          ||      |                             |      
Sbjct TL-ALAAgRPHVWTALGFhpeVVSE-----------------raADLPWFDRYLPET---   80
DSSP  HH-HHHLlLLLEEELLLLlhhHLLL-----------------lhHHLHHHHHHHHHL---


DSSP  llllLEEEEE--------------LHHHHHlllhhhHHHHHHHHLLLEEEELL-lLHHHL
Query hptiPIGLLM--------------YANLVFnngidaFYARCEQVGVDSVLVAD-vPVEES  136
ident                                        |||  |             | 
Sbjct ----RFVGEVgldgspslrgtwtqQFAVFQ-----hILRRCEDHGGRILSIHSrrAESEV  131
DSSP  ----LEEEEEellllhhhhhhhhhHHHHHH-----hHHHHHHHLLLEEEEEELllLHHHH


DSSP  HHHHHHHHhLLLEEEEEELLllLHHHHHHHHHHLLlLEEEL--llLHHHHHHHHHHHLll
Query APFRQAALrHNIAPIFICPPnaDDDLLRQVASYGRgYTYLL--alPLHHLIEKLKEYHaa  194
ident      |       ||           ||   | |                          
Sbjct LNCLEANP-RSGTPILHWYS-gSVTELRRAISLGC-WFSVGptmvRTQKGAALIRSMPrd  188
DSSP  HHHHHHLH-HHEEEEEELLL-lLHHHHHHHHHLLL-EEEELhhhhLLHHHHHHHHHLLhh


DSSP  LEEELLL----------LLLHhHHHHHHHHLlleeeellhhhhhhhhllllhhhhhhhhh
Query PALQGFG----------ISSPeQVSAAVRAGaagaisgsaivkiieknlaspkqmlaelr  244
ident   |                    |   |                                
Sbjct RVLTETDgpfleldgqaALPW-DVKSVVEGL---------------skiwqipaseveri  232
DSSP  HEEELLLlllleelleeLLHH-HHHHHHHHH---------------hhhhlllhhhhhhh


DSSP  hhhhhhhhlll
Query sfvsamkaasr  255
ident            
Sbjct vkenvsrllgt  243
DSSP  hhhhhhhhhhl


No 38: Query=1bksA Sbjct=4hk5D Z-score=5.8

back to top
DSSP  lhhhhhhhhhhhhLLLLE------------------------------------------
Query meryenlfaqlndRREGA------------------------------------------   18
ident                                                             
Sbjct -------------TPVVVdihthmyppsyiamlekrqtiplvrtfpqadeprlillssel   47
DSSP  -------------LLLLEeeeeeellhhhhhhhhlllllleeeeelleeeeeeellhhhh


DSSP  ----------------------------------------EEEEE----------elLLL
Query ----------------------------------------FVPFV----------tlGDP   28
ident                                          |                  
Sbjct aaldaaladpaaklpgrplsthfaslaqkmhfmdtngirvSVISLanpwfdflapdeAPG  107
DSSP  hhhhhhhhlllllllleellhhhllhhhhhhhhhhlllleEEEEEllllllllllllHHH


DSSP  LHHHHHHHHHHHHHLL--lLLEEEELLLlllllllhhhhhhhhhhhhhlLLHHHHHHHHH
Query GIEQSLKIIDTLIDAG--aDALELGVPFsdpladgptiqnanlrafaagVTPAQCFEMLA   86
ident                           |                                 
Sbjct IADAVNAEFSDMCAQHvgrLFFFAALPL--------------------sAPVDAVKASIE  147
DSSP  HHHHHHHHHHHHHHLLlllEEEEEELLL--------------------lLLHHHHHHHHH


DSSP  HHHHHLllllEEEEELHHH----HHLLLHHHHHHHHHHhLLLEEEELL------------
Query LIREKHptipIGLLMYANL----VFNNGIDAFYARCEQvGVDSVLVAD------------  130
ident            |                               |                
Sbjct RVKNLK--ycRGIILGTSGlgkgLDDPHLLPVFEAVAD-AKLLVFLHPhyglpnevygpr  204
DSSP  HHHLLL--leEEEEELLLLllllLLLHHHHHHHHHHHH-LLLEEEELLlllllhhhhlll


DSSP  -------------------lLHHHLH--HHHHHHHhlLLEEEEEElllllhHHHH-----
Query -------------------vPVEESA--PFRQAALrhNIAPIFICppnaddDLLR-----  164
ident                      |               |              |       
Sbjct seeyghvlplalgfpmettiAVARMYmaGVFDHVR--NLQMLLAH---sggTLPFlagri  259
DSSP  hhhlllhhhhhlhhhhhhhhHHHHHHhlLHHHHLL--LLLEEEHH---hhlLHHHhhhhh


DSSP  ------------------------hhHHHLLlLEEELlllHHHHHHHHHHHLL--LLEEe
Query ------------------------qvASYGRgYTYLLalpLHHLIEKLKEYHA--APALq  198
ident                                 |                           
Sbjct escivhdghlvktgkvpkdrrtiwtvLKEQI-YLDAV-iySEVGLQAAIASSGadRLMF-  316
DSSP  hhhhhllhhhhhllllllllllhhhhHHHLE-EEELL-llLHHHHHHHHHHHLhhHEEL-


DSSP  LLLLL-----------LHHHHHHHHHH-------------LLLEeeellhhhhhhhhlll
Query GFGIS-----------SPEQVSAAVRA-------------GAAGaisgsaivkiieknla  234
ident |                         |                |                
Sbjct GTDHPffppieedvqgPWDSSRLNAQAvikavgegssdaaAVMG----------------  360
DSSP  LLLLLlllllllllllLLHHHHHHHHHhhhhhllllhhhhHHHL----------------


DSSP  lhhhhhhhhhhhhhhhhhlll
Query spkqmlaelrsfvsamkaasr  255
ident                      
Sbjct -lnavrvlslkaelehhhhhh  380
DSSP  -hhhhhhlllhhhhhhhhhhl


No 39: Query=1bksA Sbjct=3irsA Z-score=5.8

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct lkiidfrlrppamgflnariytrpdirnrftrqlgfepapsaeekslelmfeemaaagie   60
DSSP  llleelllllllhhhhhlhhhhlhhhhhhhhhhhlllllhhhhhllhhhhhhhhhhllll


DSSP  --------------lhhhhhhhhhhhHLLLLEEEEEEEllLLLHHHHHHHHHHHHHLLLL
Query --------------meryenlfaqlnDRREGAFVPFVTlgDPGIEQSLKIIDTLIDAGAD   46
ident                                  |                     | |  
Sbjct qgvcvgrnssvlgsvsnadvaavakaYPDKFHPVGSIE--AATRKEAMAQMQEILDLGIR  118
DSSP  eeeeelleellleellhhhhhhhhhhLLLLEEEEEELL--LLLHHHHHHHHHHHHHLLLL


DSSP  LEEEELLLlllllllhhhhhhHHHHhhhlllHHHHHHHHHHHHHhlLLLLEEEEEL----
Query ALELGVPFsdpladgptiqnaNLRAfaagvtPAQCFEMLALIREkhPTIPIGLLMY----  102
ident    |                                   |        ||          
Sbjct IVNLEPGV-------------WATP--mhvdDRRLYPLYAFCED--NGIPVIMMTGgnag  161
DSSP  LEEELHHH-------------LLLL--llllLHHHHHHHHHHHH--LLLLEEEELLllll


DSSP  --hHHHHlllhhhHHHHHHHH--LLLEEE-ELLLlhhHLHHHHHHHHHLL-LEEEEEE-L
Query --aNLVFnngidaFYARCEQV--GVDSVL-VADVpveESAPFRQAALRHN-IAPIFIC-P  155
ident                                              | |            
Sbjct pdiTYTN---pehIDRVLGDFpdLTVVSShGNWP---WVQEIIHVAFRRPnLYLSPDMyL  215
DSSP  llhHHHL---hhhHHHHHHHLllLLEEEEhHHLL---LHHHHHHHHHHLLlEEEELHHhH


DSSP  LLL--lhhhHHHH---hHHLLlLEEEL-----lLLHHHHHHHH----hhHLLLLeeelll
Query PNA--dddlLRQV---aSYGRgYTYLL-----aLPLHHLIEKL----keYHAAPalqgfg  201
ident  |                                        |                 
Sbjct YNLpghadfIQAAnsflADRM-LFGTAypmcplKEYTEWFLTLpikpdaMEKIL------  268
DSSP  LLLllhhhhHHHHllhhHHLL-LLLLLlllllhHHHHHHHHLLlllhhhHHHHH------


DSSP  lllhhhhhhhhhhllleeeellhhhhhhhhllllhhhhhhhhhhhhhhhhhlll
Query isspeqvsaavragaagaisgsaivkiieknlaspkqmlaelrsfvsamkaasr  255
ident                                                       
Sbjct -----------------------------------------hgnaerllaqagr  281
DSSP  -----------------------------------------lhhhhhhhhhlll


No 40: Query=1bksA Sbjct=3au2A Z-score=5.8

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct mrnqelarifeeiglmseflgdnpfrvrayhqaartlydldtpieeiaekgkealmelpg   60
DSSP  llhhhhhhhhhhhhhhhhhllllhhhhhhhhhhhhhhhhllllhhhhhlllhhhhlllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct vgpdlaekileflrtgkvrkheelsrkvprgvlevmevpgvgpktarllyeglgidslek  120
DSSP  llhhhhhhhhhhhhhlllhhhhhhhhhllhhhhhhhllllllhhhhhhhhhhhllllhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct lkaaldrgdltrlkgfgpkraerireglalaqaagkrrplgavlslarslleairalpgv  180
DSSP  hhhhhhhlhhhhlllllhhhhhhhhhhhhhhhhlllleehhhhhhhhhhhhhhhhlllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct eraelcgsarrykdtvgdldflvasregeravegfvrlpqvkevyakgkeratvflkngl  240
DSSP  leeeelhhhhlllleelleeeeeelllhhhhhhhhhlllleeeeeeellleeeeeellll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct qvdlrvvppesygaglqyltgskahsirlralaqekglklseygvfrgekriageteeev  300
DSSP  eeeeeeelhhhhhhhhhhhhllhhhhhhhhhhhhhllleeelleeeelleeeelllhhhh


DSSP  --------------------lhhhhhhhhhhHHLLLLEEE-eEEELLLllhhhHHHHHHH
Query --------------------meryenlfaqlNDRREGAFV-pFVTLGDpgieqSLKIIDT   39
ident                                                       |     
Sbjct yaalglpwippplredqgeveaalegrlpklLELPQVKGDlqVHSTYS-dgqnTLEELWE  359
DSSP  hhhlllllllhhhlllllhhhhhhlllllllLLHHHLLEEeeELLLLL-llllLHHHHHH


DSSP  HHHL--LLLLE-EEELL-LLLLllllhhhhhhhhhhhhhlLLHHHHHHHHHHHHHHLL--
Query LIDA--GADAL-ELGVP-FSDPladgptiqnanlrafaagVTPAQCFEMLALIREKHP--   93
ident                 |                         |         ||      
Sbjct AAKTmgYRYLAvTDHSPaVRVA----------------ggPSPEEALKRVGEIRRFNEth  403
DSSP  HHHHhlLLEEEeEEELHhHHLL----------------llLLHHHHHHHHHHHHHHHHhh


DSSP  ---LLLEEEEELHHhhhlllhhhHHHHHHhhLLLEEEELL------------lLHHHLhh
Query ---TIPIGLLMYANlvfnngidaFYARCEqvGVDSVLVAD------------vPVEESap  138
ident        |                         | |||                      
Sbjct gppYLLAGAEVDIH--pdgtldyPDWVLR--ELDLVLVSVhsrfnlpkadqtkRLLKA--  457
DSSP  lllEEEEEEEEELL--lllllllLHHHHL--LLLEEEEELlllllllhhhhhhHHHHH--


DSSP  hHHHHhhlllEEEE-EELL----------LLLHHHHHHHHHHLLlLEEEL-----lllHH
Query fRQAAlrhniAPIF-ICPP----------NADDDLLRQVASYGRgYTYLL-----alpLH  182
ident                                           |                 
Sbjct lENPF-----VHVLaHPTArllgrrapieADWEAVFQKAKEKGV-AVEIDgyydrmdlPD  511
DSSP  hLLLL-----LLEElLLLLllllllllllLLHHHHHHHHHHHLL-EEEEEllllllllLH


DSSP  HHHHHHHHHLLlLEEEllllllhhhhhhhhhhllleeEELLhHHHH--------------
Query HLIEKLKEYHAaPALQgfgisspeqvsaavragaagaISGSaIVKI--------------  228
ident  |                                                          
Sbjct DLARMAYGMGL-WISL---------------------STDA-HQTDhlrfmelavgtaqr  548
DSSP  HHHHHHHHLLL-LEEE---------------------ELLL-LLHHhhhhhhhhhhhhhh


DSSP  hhhllllhhhhhhhhhhhhhhhhhlll
Query ieknlaspkqmlaelrsfvsamkaasr  255
ident                            
Sbjct awigpervlntldyedllswlkarrgv  575
DSSP  llllllllhhhllhhhhhhhhhlllll


No 41: Query=1bksA Sbjct=2ogjA Z-score=5.7

back to top
DSSP  -----------------------------------------lhhhhhhhhhhhhllllEE
Query -----------------------------------------meryenlfaqlndrregAF   19
ident                                                             
Sbjct qapilltnvkpvgfgkgasqsstdiliggdgkiaavgsalqapadtqridaafispgwVD   60
DSSP  llleeeeeeeellllllllllleeeeellllleeeeelllllllleeelllleeeeleEE


DSSP  EEEEEL--LLLLhhhhhhHHHHHHH--LLLLLE-EEELlllllllllhhhhhhhhhhhhh
Query VPFVTL--GDPGieqslkIIDTLID--AGADAL-ELGVpfsdpladgptiqnanlrafaa   74
ident         |                                                   
Sbjct LHVHIWhgGTDI----siRPSECGAerGVTTLVdAGSA----------------------   94
DSSP  EEELLLllLLLL----llLHHHLLHhhLEEEEEeELLL----------------------


DSSP  lllhhhHHHHHHH-HHHHL-lLLLEEEEEL----------------hHHHHlllhHHHHH
Query gvtpaqCFEMLAL-IREKH-pTIPIGLLMY----------------aNLVFnngiDAFYA  116
ident        |      | |     |   |                            |    
Sbjct ---geaNFHGFREyIIEPSreRIKAFLNLGsiglvacnrvpelrdikDIDL----DRILE  147
DSSP  ---lllLHHHHHHhLLLLLllEEEEEEELLlllllllllllllllhhHLLH----HHHHH


DSSP  HHHHHL--LLEEEEL-------llLHHHLHHHHHHHHHLLLEEEEEELLLllhhHHHHHH
Query RCEQVG--VDSVLVA-------dvPVEESAPFRQAALRHNIAPIFICPPNadddLLRQVA  167
ident              |           |         |                  |   | 
Sbjct CYAENSehIVGLXVRashvitgswGVTPVKLGKKIAKILKVPXXVHVGEP--paLYDEVL  205
DSSP  HHHLLLllEEEEEEEelhhhhlllLLHHHHHHHHHHHHHLLLEEEEELLL--llLHHHHH


DSSP  HHL--LLLEEE-----lLLLHH---hHHHHHHHHLlLLEEELLLL----llhhhhhhhhh
Query SYG--RGYTYL-----lALPLH---hLIEKLKEYHaAPALQGFGI----sspeqvsaavr  213
ident                           |              | |                
Sbjct EILgpGDVVTHcfngksGSSIXededLFNLAERCEgIRLDIGHGGasfsfkvaeaaiarg  265
DSSP  HHLllLLEEELllllllLLLLLllhhHHHHHHHLLlLEEELLLLLllllhhhhhhhhhll


DSSP  HLLLEEEELlhHHHHhhhllllhhhhhhhhhhhhhHHHHLLL------------------
Query AGAAGAISGsaIVKIieknlaspkqmlaelrsfvsAMKAASR------------------  255
ident                                       |                     
Sbjct LLPFSISTD-lHGHS---------------xnfpvWDLATTXskllsvdxpfenvveavt  309
DSSP  LLLLLLLLL-lLLLL---------------lllllLLHHHHHhhhhhllllhhhhhhlll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  255
ident                                                             
Sbjct rnpasvirldxenrldvgqradftvfdlvdadleatdsngdvsrlkrlfepryavigaea  369
DSSP  hhhhhhllllllllllllllleeeeeeeeeeeeeeellllleeeeeeeeeeeeeeellee


DSSP  ----------
Query ----------  255
ident           
Sbjct iaasryipra  379
DSSP  eellllllll


No 42: Query=1bksA Sbjct=1m65A Z-score=5.7

back to top
DSSP  lhhhhhhhhhhhhlllLEEE-eEEELLLLlhhhhhHHHHHHHHLL-----lLLEEEEL-L
Query meryenlfaqlndrreGAFV-pFVTLGDPgieqslKIIDTLIDAG-----aDALELGV-P   53
ident                         |                |                 |
Sbjct ----------------YPVDlhMHTVAST---haySTLSDYIAQAkqkgikLFAITDHgP   41
DSSP  ----------------LLEEllLLLLLLL---lllLLHHHHHHHHhhhlllEEEEEEElL


DSSP  LLLlllllhhhhhhhhhhhhhlllHHHHHhHHHHhhHHLL----LLLEEEEELHHhhhll
Query FSDpladgptiqnanlrafaagvtPAQCFeMLALirEKHP----TIPIGLLMYANlvfnn  109
ident                             |                |  |           
Sbjct DME------------------dapHHWHFiNMRI--WPRVvdgvGILRGIEANIK--nvd   79
DSSP  LLL------------------lllLLHHHhHHHH--LLLEelleEEEEEEEEELL--lll


DSSP  lhhhHHHHHHHHlLLEEEELL--------------lLHHHL-HHHHhhhhhlllEEEE-E
Query gidaFYARCEQVgVDSVLVAD--------------vPVEES-APFRqaalrhniAPIF-I  153
ident               |                           |             |   
Sbjct geidCSGKMFDS-LDLIIAGFhepvfaphdkatntqAMIATiASGN--------VHIIsH  130
DSSP  llllLLHHHHHH-LLEEEEELlllllllllhhhhhhHHHHHhHLLL--------LLEElL


DSSP  ELL---LLLH-HHHHHHHHHLLlLEEEL-llLHHHHHHHHHHHLLLlEEEL---lllllh
Query CPP---NADD-DLLRQVASYGRgYTYLL-alPLHHLIEKLKEYHAApALQG---fgissp  205
ident         |        |                                |         
Sbjct PGNpkyEIDVkAVAEAAAKHQV-ALEINnssNCREVAAAVRDAGGW-VALGsdshtaftm  188
DSSP  LLLlllLLLHhHHHHHHHHHLL-EEEEElllLHHHHHHHHHHHLLL-EEEElllllhhhl


DSSP  hHHHHHHHHL---------LLEEeellhhhhhhhhllllhhhhhhhhhhhhhhhhhlll
Query eQVSAAVRAG---------AAGAisgsaivkiieknlaspkqmlaelrsfvsamkaasr  255
ident                                                            
Sbjct gEFEECLKILdavdfpperILNV-------------sprrllnflesrgmapiaefadl  234
DSSP  lLLHHHHHHHhhllllhhhLHHH-------------lhhhhhhhhhhllllllhhhlll


No 43: Query=1bksA Sbjct=2dvtA Z-score=5.6

back to top
DSSP  lhhhhhhhhhhhhlLLLE------------------------------------------
Query meryenlfaqlndrREGA------------------------------------------   18
ident                                                             
Sbjct -------------mQGKValeehfaipetlqdsagfvpgdywkelqhrlldiqdtrlklm   47
DSSP  -------------lLLEEeeeeeellhhhhhhhlllllllhhhhhhhhhhllllhhhhhh


DSSP  -------EEEEE----------------eLLLLlhHHHHHHHHHhHHLLLlLEEEELLLL
Query -------FVPFV----------------tLGDPgiEQSLKIIDTlIDAGAdALELGVPFS   55
ident                                                          |  
Sbjct dahgietMILSLnapavqaipdrrkaieiARRA-nDVLAEECAK-RPDRF-LAFAALPLQ  104
DSSP  hhlleeeEEEEElllhhhhlllhhhhhhhHHHH-hHHHHHHHHH-LLLLE-EEEELLLLL


DSSP  llllllhhhhhhhhhhhhhllLHHHHHHH-HHHHHhhlllllEEEEELHHH---------
Query dpladgptiqnanlrafaagvTPAQCFEM-LALIRekhptipIGLLMYANL---------  105
ident                                            | |              
Sbjct ------------------dpdAATEELQRcVNDLG------fVGALVNGFSqegdgqtpl  140
DSSP  ------------------lhhHHHHHHHHhHHLLL------lLEEEEELLLlllllllll


DSSP  --hHLLLhHHHHHHHHHHLLlEEEELL--------------------------LLHHHLH
Query --vFNNGiDAFYARCEQVGVdSVLVAD--------------------------VPVEESA  137
ident           |    |   |                                        
Sbjct yydLPQY-RPFWGEVEKLDV-PFYLHPrnplpqdsriydghpwllgptwafaqETAVHAL  198
DSSP  lllLHHH-HHHHHHHHHHLL-LEEEELllllhhhlhhhlllhhhlhhhlhhhhHHHHHHH


DSSP  HHH--HHHHHL-LLEEEEEELllllhhHHHH-------------------------hhHH
Query PFR--QAALRH-NIAPIFICPpnadddLLRQ-------------------------vaSY  169
ident           |     |          |                                
Sbjct RLMasGLFDEHpRLNIILGHM---gegLPYMmwridhrnawvklpprypakrrfmdyfNE  255
DSSP  HHHhlLHHHHLlLLLEEELHH---hllHHHHhhhhhhllllllllllllllllhhhhhHH


DSSP  LLlLEEELlllHHHHHHHHHHHLL--LLEEELLL--LLLHHHHHHHHHHllleeeellhh
Query GRgYTYLLalpLHHLIEKLKEYHA--APALQGFG--ISSPEQVSAAVRAgaagaisgsai  225
ident                                                             
Sbjct NF-HITTSgnfRTQTLIDAILEIGadRILFSTDWpfENIDHASDWFNAT-----------  303
DSSP  HE-EEELLlllLHHHHHHHHLLLLhhHEELLLLLllLLHHHHHHHHHHL-----------


DSSP  hhhhhhllllhhhhhhhhhhhhhhhhhlll
Query vkiieknlaspkqmlaelrsfvsamkaasr  255
ident                               
Sbjct --------siaeadrvkigrtnarrlfkld  325
DSSP  --------lllhhhhhhhhlhhhhhhllll


No 44: Query=1bksA Sbjct=1a5kC Z-score=5.4

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct snisrqayadmfgptvgdkvrladtelwieveddlttygeevkfgggkvirdgmgqgqml   60
DSSP  leeehhhhhhhhlllllleeelllllleeelleellllllllllllllllllllllllll


DSSP  -----lhhhhhhhhHHHH------------------------------------------
Query -----meryenlfaQLND------------------------------------------   13
ident                                                             
Sbjct aadcvdlvltnaliVDHWgivkadigvkdgrifaigkagnpdiqpnvtipigaateviaa  120
DSSP  hhhllleeeeeeeeEELLeeeeeeeeeelleeeeeeleellllllllleellllleeeel


DSSP  ---lllleEEEE-EELLlllhhhHHHHHHHHHHLLLLLEEEELL-LLLLllllhhhhhhh
Query ---rregaFVPF-VTLGdpgieqSLKIIDTLIDAGADALELGVP-FSDPladgptiqnan   68
ident                                   |      |                  
Sbjct egkivtagGIDThIHWI------CPQQAEEALVSGVTTMVGGGTgPAAG--------tha  166
DSSP  llleeeelEEEEeEELL------LLLHHHHHHHHLEEEEEEELLlLLHH--------hhh


DSSP  hhhhhhllLHHHHHHHHHHHhhhlllllEEEEELhhhhhllLHHHHHHHHhhhlLLEEEE
Query lrafaagvTPAQCFEMLALIrekhptipIGLLMYanlvfnnGIDAFYARCeqvgVDSVLV  128
ident                             ||||               |      |     
Sbjct ttctpgpwYISRMLQAADSL-----pvnIGLLGKgnvsqpdALREQVAAG----VIGLEI  217
DSSP  lllllhhhHHHHHHHHHLLL-----lleEEEEEElllllhhHHHHHHHHL----LLEEEE


DSSP  L--LLLHHHL-hhhHHHHHHLLLEEEEEELLL----LLHHHHHHHhHHLLlLEEEL----
Query A--DVPVEES-apfRQAALRHNIAPIFICPPN----ADDDLLRQVaSYGRgYTYLL----  177
ident                  |    |                | |          |       
Sbjct HedWGATPAAidcaLTVADEMDIQVALHSDTLnesgFVEDTLAAIgGRTI-HTFHTegag  276
DSSP  EhhHLLLHHHhhhhHHHHHHHLLEEEEELLLLllllLHHHHHHHHlLLLE-EELLLllll


DSSP  ----LLLHhHHHHhhhhHLLLLEEELllLLLHH---------------------------
Query ----ALPLhHLIEklkeYHAAPALQGfgISSPE---------------------------  206
ident                                                             
Sbjct gghaPDII-TACA----HPNILPSST--NPTLPytlntidehldmlmvchhldpdiaedv  329
DSSP  llllLLHH-HHHH----LLLEEEEEE--HHHLLllllhhhhhhhhhhhhhllllllhhhh


DSSP  -------------hhHHHHH-HLLLEEEEL---LHHHhhhhhllllhhhhhhhhhhHHHH
Query -------------qvSAAVR-AGAAGAISG---SAIVkiieknlaspkqmlaelrsFVSA  249
ident                             |       |                    |  
Sbjct afaesrirretiaaeDVLHDlGAFSLTSSDsqaMGRV------------------gEVIL  371
DSSP  hlllllllhhhhhhhHHHHHlLLLLEEELLlllLLLL------------------lLHHH


DSSP  HHHLLL------------------------------------------------------
Query MKAASR------------------------------------------------------  255
ident                                                             
Sbjct RTWQVAhrmkvqrgalaeetgdndnfrvkryiakytinpalthgiahevgsievgkladl  431
DSSP  HHHHHHhhhhhhhlllllllllllhhhhhhhhhlllhhhhhhllllllllllllllllle


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  255
ident                                                             
Sbjct vvwspaffgvkpatvikggmiaiapmgdinasiptpqpvhyrpmfgalgsarhhcrltfl  491
DSSP  eeelhhhlllllleeeelleeeeeeellllllllllllleeeelhhhlhhhhhhhleeee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  255
ident                                                             
Sbjct sqaaaangvaerlnlrsaiavvkgcrtvqkadmvhnslqpnitvdaqtyevrvdgelits  551
DSSP  lhhhhhhlhhhhllllleeeellllllllhhhllllllllleeelllllleeelleelll


DSSP  ---------------
Query ---------------  255
ident                
Sbjct epadvlpmaqryflf  566
DSSP  lllllllllllllll


No 45: Query=1bksA Sbjct=2gwgA Z-score=5.4

back to top
DSSP  lhhhhhhhhhhhhlllleeEEEEELLLLLH---------------------------HHH
Query meryenlfaqlndrregafVPFVTLGDPGI---------------------------EQS   33
ident                        |                                    
Sbjct --------------xiidiHGHYTTAPKALedwrnrqiagikdpsvxpkvselkisdDEL   46
DSSP  --------------lleeeEEELLLLLHHHhhhhhhhhhhhhlhhhlllhhhllllhHHH


DSSP  HHHHH-HHHHLL-----lLLEEEELlllllllllhhhhhhhhhhhhhllLHHHHHHHHHH
Query LKIID-TLIDAG-----aDALELGVpfsdpladgptiqnanlrafaagvTPAQCFEMLAL   87
ident    |                                               | | |    
Sbjct QASIIeNQLKKXqergsdLTVFSPR---------------agdfnvsstWAAICNELCYR   91
DSSP  HHHHHlLHHHHHhhhlllEEEEELL---------------lllhhhhhhHHHHHHHHHHH


DSSP  HHHHLLL-LLEEEEELHH-hhhllLHHHHHHHHH-HHLLLEEEELL---------lLHHH
Query IREKHPT-IPIGLLMYAN-lvfnnGIDAFYARCE-QVGVDSVLVAD---------vPVEE  135
ident      |                          |    |                  |   
Sbjct VSQLFPDnFIGAAXLPQSpgvdpkTCIPELEKCVkEYGFVAINLNPdpsgghwtspPLTD  151
DSSP  HHHHLLLlEEEEEELLLLllllhhHHHHHHHHHHhLLLLLEEEELLllllllllllLLLL


DSSP  --LHHHHHHHHHLLLEEEEE-----eLLLLlhhHHHH---------hhHHLLlLEEE-ll
Query --SAPFRQAALRHNIAPIFI-----cPPNAdddLLRQ---------vaSYGRgYTYL-la  178
ident     |         |             ||      |                       
Sbjct riWYPIYEKXVELEIPAXIHvstgahYLNAdttAFXQcvagdlfkdfpELKF-VIPHggg  210
DSSP  hhHHHHHHHHHHHLLLEEELlllllhHHHHhhhHHHHhhhllhhhhllLLLE-EELHhhl


DSSP  LLHHHH------------hhhhhHHLL-LLEEELLLlllhhhhHHHHHHL-------lLE
Query LPLHHL------------ieklkEYHA-APALQGFGisspeqvSAAVRAG-------aAG  218
ident     |                                                       
Sbjct AVPYHWgrfrglaqexkkplledHVLNnIFFDTCVY------hQPGIDLLntvipvdnVL  264
DSSP  LLHHHHhhhhhhhhhlllllhhhHLLLlEEEELLLL------lHHHHHHHhhhllhhhEE


DSSP  EEELLHHhhhhhhllllhhhhhhhhhhhhhhHHHLLL-----------------------
Query AISGSAIvkiieknlaspkqmlaelrsfvsaMKAASR-----------------------  255
ident   |                                                         
Sbjct FASEXIG----------avrgidprtgfyydDTKRYIeastiltpeekqqiyegnarrvy  314
DSSP  LLLLLLL----------lllleelllleellLLHHHHhhlllllhhhhhhhhlhhhhhhl


DSSP  ---------------
Query ---------------  255
ident                
Sbjct prldaalkakgkleh  329
DSSP  hhhhhhhhhhhhhll


No 46: Query=1bksA Sbjct=4dziC Z-score=5.3

back to top
DSSP  lhhhhhhhhhhhhllllEEEEEEELLL---------------------------------
Query meryenlfaqlndrregAFVPFVTLGD---------------------------------   27
ident                    |                                        
Sbjct -----------alnyrvIDVDNHYYEPldsftrhldkkfkrrgvqmlsdgkrtwavigdr   49
DSSP  -----------llllleEEEEEELLLLlllllllllhhhlllleeeeelllleeeeelle


DSSP  --------------------------------------------llhhHHHHHHHHHH-H
Query --------------------------------------------pgieQSLKIIDTLI-D   42
ident                                                 |           
Sbjct vnhfipnptfdpiivpgcldllfrgeipdgvdpaslmkverladhpeyQNRDARIAVMdE  109
DSSP  ellllllllllleelllllhhhhhllllllllhhhllleelhhhlhhhLLHHHHHHHHhH


DSSP  LLL-LLEEEE-lLLLLLLlllhhhhhhhhhhhhhllLHHHHHHHHHhhHHHLlLLLEEEE
Query AGA-DALELG-vPFSDPLadgptiqnanlrafaagvTPAQCFEMLAliREKHpTIPIGLL  100
ident      |  |                                 |     |  |  |     
Sbjct QDIeTAFMLPtfGCGVEE---alkhdieatmasvhaFNLWLDEDWGfdRPDH-RIIAAPI  165
DSSP  HLEeEEEEELlhHHHHHH---hllllhhhhhhhhhhHHHHHHHHLLllLLLL-LEEELLL


DSSP  ELHHhhHLLLHHHHHHHHHHHLLLEEEEL---------llLHHH--lHHHHHHHHHLLLE
Query MYANlvFNNGIDAFYARCEQVGVDSVLVA---------dvPVEE--sAPFRQAALRHNIA  149
ident                      |   |||                    |           
Sbjct VSLA--DPTRAVEEVDFVLARGAKLVLVRpapvpglvkprSLGDrshDPVWARLAEAGVP  223
DSSP  LLLL--LHHHHHHHHHHHHHLLLLLEELLlllllllllllLLLLhhhHHHHHHHHHHLLL


DSSP  EEEE------------------------eLLLLlhHHHHHHH--------hhlLLLEEEL
Query PIFI------------------------cPPNAddDLLRQVA--------sygRGYTYLL  177
ident   |                             |  |                        
Sbjct VGFHlsdsgylhiaaawggakdpldqvllDDRAihDTMASMIvhgvftrhpklKAVSIEN  283
DSSP  EEEEllllllhhhhhhllllllhhhhhhhLLHHhhHHHHHHHhllhhhhllllLEEEELL


DSSP  lllhhHHHHH------------------hhHHLL---LLEEEllllllhhhHHHHHHHL-
Query alplhHLIEK------------------lkEYHA---APALQgfgisspeqVSAAVRAG-  215
ident                                                             
Sbjct ---gsYFVHRlikrlkkaantqpqyfpedpVEQLrnnVWIAP--------yYEDDLPELa  332
DSSP  ---llLHHHHhhhhhhhhhhhlhhhllllhHHHHhhhEEELL--------lLLLLHHHHh


DSSP  ------lLEEEELLhHHHHhhhllllhhhhhhhhhHHHHHHhHLLL--------------
Query ------aAGAISGSaIVKIieknlaspkqmlaelrSFVSAMkAASR--------------  255
ident            |                               |                
Sbjct rvigvdkILFGSDW-PHGE--------------glASPVSF-TAELkgfsesdirkimrd  376
DSSP  hhhlhhhLLLLLLL-LLLL--------------llLLHHHH-HHHHllllhhhhhhhhlh


DSSP  ------------
Query ------------  255
ident             
Sbjct naldllgvqvgs  388
DSSP  hhhhhhllllll


No 47: Query=1bksA Sbjct=2vc5A Z-score=5.2

back to top
DSSP  -----lhhhhhhHHHHH-----------------------------------------hl
Query -----meryenlFAQLN-----------------------------------------dr   14
ident                                                             
Sbjct mriplvgkdsieSKDIGftlihehlrvfseavrqqwphlynedeefrnavnevkramqfg   60
DSSP  llllllllllllHHHLLleelllllllllhhhhhhlhhhllhhhhhhhhhhhhhhhhhll


DSSP  lLLEEEEEEE-----------------------------------lllLLHHHHHHHHHH
Query rEGAFVPFVT-----------------------------------lgdPGIEQSLKIIDT   39
ident       | |                                         |         
Sbjct vKTIVDPTVMglgrdirfmekvvkatginlvagtgiyiyidlpfyflnRSIDEIADLFIH  120
DSSP  lLEEEELLLLlllllhhhhhhhhhlllleeeeleellllllllhhhllLLHHHHHHHHHH


DSSP  HHHL-------LLLLEEEELlLLLLllllhhhhhhhhhhhhhlLLHHHHHHHHHHHHHHL
Query LIDA-------GADALELGVpFSDPladgptiqnanlrafaagVTPAQCFEMLALIREKH   92
ident  |          |                                        |      
Sbjct DIKEgiqgtlnKAGFVXIAA-DEPG----------------itKDVEKVIRAAAIANKET  163
DSSP  HHHLlllllllLLLLEEEEL-LLLL----------------llHHHHHHHHHHHHHHHHH


DSSP  LlLLEEEEEL-HHHHhlllhhHHHHHHHHHL----LLEEEElllLHHHLHHhHHHHHHLL
Query PtIPIGLLMY-ANLVfnngidAFYARCEQVG----VDSVLVadvPVEESAPfRQAALRHN  147
ident    ||       |                 |                             
Sbjct K-VPIITHSNaHNNT----glEQQRILTEEGvdpgKILIGH-lgDTDNIDY-IKKIADKG  216
DSSP  L-LLEEEELLlLLLH----hhHHHHHHHHLLllhhHEEELL-hhHLLLHHH-HHHHHHLL


DSSP  LEEEEE-ELLL---LLHHHHHHHHHH------lLLLEEEL-------------------L
Query IAPIFI-CPPN---ADDDLLRQVASY------gRGYTYLL-------------------A  178
ident                 |                                           
Sbjct SFIGLDrYGLDlflPVDKRNETTLRLikdgysdKIMISHDycctidwgtakpeykpklaP  276
DSSP  LEEEELlLLLLlllLHHHHHHHHHHHhhlllllLEEELLLlllllllllllhhhhhhhlL


DSSP  LLH-HHHHHHHHHHLllleeellllllhhhhhhhhhhllleeeellhhhhhhhhllllhh
Query LPL-HHLIEKLKEYHaapalqgfgisspeqvsaavragaagaisgsaivkiieknlaspk  237
ident         |                                                   
Sbjct RWSiTLIFEDTIPFL----------------------------------------krngv  296
DSSP  LLLlLHHHHLHHHHH----------------------------------------hllll


DSSP  hhhhhhhhhhhhhhhlll
Query qmlaelrsfvsamkaasr  255
ident                   
Sbjct neeviatifkenpkkffs  314
DSSP  lhhhhhhhhlhhhhhhll


No 48: Query=1bksA Sbjct=2qpxA Z-score=4.9

back to top
DSSP  lhhhhhhhhhhhhlllleeEEEEellLLLHH-----------------------------
Query meryenlfaqlndrregafVPFVtlgDPGIE-----------------------------   31
ident                             |                               
Sbjct --gxddlsefvdqvplldhHCHF--lIDGKVpnrddrlaqvsteadkdypladtknrlay   56
DSSP  --lllllhhhhhhlleeeeEELL--lLLLLLllhhhhhhhhlllllllllhhhhlllhhh


DSSP  --------------------------hhhhhhhhhhhLLLLLEEEELlllllllllhhHH
Query --------------------------qslkiidtlidAGADALELGVpfsdpladgptIQ   65
ident                                           |                 
Sbjct hgflalakefaldannplaaxndpgyatynhrifghfHFKELLIDTG---------fvPD  107
DSSP  hhhhhhhhhhllllllllllllhhhhhhhhhhhhhhlLEEEEEEELL---------llLL


DSSP  HHHhhhhhhlllhhhhhhhhhhhhhhllLLLEEEEELHhHHHLL------------LHHH
Query NANlrafaagvtpaqcfemlalirekhpTIPIGLLMYAnLVFNN------------GIDA  113
ident                                                             
Sbjct DPI-------------ldldqtaelvgiPVKAIYRLET-HAEDFxlehdnfaawwqAFSN  153
DSSP  LLL-------------llhhhhhhhhllLEEEEEEHHH-HHHHHhlllllhhhhhhHHHH


DSSP  HHHHHHHHLLLEEEELL-----------------------------------llhhHLHH
Query FYARCEQVGVDSVLVAD-----------------------------------vpveESAP  138
ident         |                                                   
Sbjct DVKQAKAHGFVGFXSIAayrvglhlepvnvieaaagfdtwkhsgekrltskplidyXLYH  213
DSSP  HHHLLLLLLLLLEEELHhhhlllllllllhhhhhhhhhhhhhhlllllllhhhhhhHHHH


DSSP  HHHHHHHLLLEEEEEEL----------LLLLHhHHHHHHHH----lLLLEEELlllHHHH
Query FRQAALRHNIAPIFICP----------PNADDdLLRQVASY----gRGYTYLLalpLHHL  184
ident              |              |                            |  
Sbjct VAPFIIAQDXPLQFHVGygdadtdxylGNPLL-XRDYLKAFtkkglKVVLLHC-ypYHRE  271
DSSP  HHHHHHHHLLLEEEEELlllllllhhhLLHHH-HHHHHHHHhhhllLEEEEEL-llLHHH


DSSP  HHHHHHHL-lLLEEELLL-LLLHHHHHHHHHHL--------LLEEEELLhhHHHHhhlll
Query IEKLKEYH-aAPALQGFG-ISSPEQVSAAVRAG--------AAGAISGSaiVKIIeknla  234
ident    |                  |   |                 |   |           
Sbjct AGYLASVFpnLYFDISLLdNLGPSGASRVFNEAvelapytrILFASDAS--TYPE-----  324
DSSP  HHHHHHHLllEEEELLLHhHHLHHHHHHHHHHHlllllhhhEELLLLLL--LLHH-----


DSSP  lhhhhhhhhhhhhhhHHHLLL---------------------------------------
Query spkqmlaelrsfvsaMKAASR---------------------------------------  255
ident                                                             
Sbjct -----------xyglAARQFKqalvahfnqlpfvdlaqkkawinaicwqtsaklyhqere  373
DSSP  -----------hhhhHHHHHHhhhhhhhhllllllhhhhhhhhhhhhlhhhhhhlllhhh


DSSP  ---
Query ---  255
ident    
Sbjct lrv  376
DSSP  hll


No 49: Query=1bksA Sbjct=2anuA Z-score=4.8

back to top
DSSP  lhhhhhhhhhhhhLLLLEEE-eEEELLlllhhHHHHHHHHHHHLLL-LLEEEEL------
Query meryenlfaqlndRREGAFV-pFVTLGdpgieQSLKIIDTLIDAGA-DALELGV------   52
ident                         |             |     |               
Sbjct -------------TEWLLCDfhVHTNXsdghlPLGEVVDLFGKHGVdVVSITDHivdrrt   47
DSSP  -------------LEEEEEEeeELLLLlllllLHHHHHHHHHHLLLlEEEEEEEeelhhh


DSSP  ------------LLLLlllllhhhhhhhhhhhhhllLHHHHHHHHHHHHHHLL----LLL
Query ------------PFSDpladgptiqnanlrafaagvTPAQCFEMLALIREKHP----TIP   96
ident                                             |             | 
Sbjct leqrkrngeplgAITE-------------------dKFQDYLKRLWREQKRAWeeygXIL   88
DSSP  hhhhhhllllllLLLL-------------------lLHHHHHHHHHHHHHHHHhhhlLEE


DSSP  E-EEEELHHhhhlllhhhhhhhhhhhllleeeellllhhHLHHHHHHHHHLLLEEEEEEL
Query I-GLLMYANlvfnngidafyarceqvgvdsvlvadvpveESAPFRQAALRHNIAPIFICP  155
ident | |     |                                          |   |   |
Sbjct IpGVEITNN-----------tdlyhivavdvkeyvdpslPVEEIVEKLKEQNALVIAAHP  137
DSSP  EeEEEEEEL-----------llleeeeeellllllllllLHHHHHHHHHHLLLEEEELLL


DSSP  -----llllhHHHHHHHHHLLlLEEEL--lllHHHHHHHHHhhlllLEEEllllllhhhh
Query -----pnaddDLLRQVASYGRgYTYLL--alpLHHLIEKLKeyhaaPALQgfgisspeqv  208
ident                                       |                     
Sbjct drkklswylwANXERFKDTFD-AWEIAnrddlFNSVGVKKY-----RYVA----------  181
DSSP  lllllllhhhHLLLLLLLLLL-EEEEEelleeLHHHHHLLL-----LEEE----------


DSSP  hhhhhhllleeEELLhHHHH-----------hhhllllhhhhhhhhhhhhhHHHHlll
Query saavragaagaISGSaIVKI-----------ieknlaspkqmlaelrsfvsAMKAasr  255
ident             |                                             
Sbjct -----------NSDF-HELWhvyswktlvkseknieaikeairkntdvaiyLXRK---  224
DSSP  -----------ELLL-LLHHhhlleeeeeeelllhhhhhhhhhhllleeeeELLL---


No 50: Query=1bksA Sbjct=1v77A Z-score=4.8

back to top
DSSP  ------lhhhhhhhhhhhHLLLLEEEEEEELLLllhhhHHHHHHHHHHL-LLLLEEEELL
Query ------meryenlfaqlnDRREGAFVPFVTLGDpgieqSLKIIDTLIDA-GADALELGVP   53
ident                          |                        |  |  |  |
Sbjct vkfiemdirdkeayelakEWFDEVVVSIKFNEE----vDKEKLREARKEyGKVAILLSNP   56
DSSP  llleeeeellhhhhhhhhHHLLEEEEEEEELLL----lLHHHHHHHHHHhLLEEEEEELL


DSSP  llllllllhhhhhhhhhhhhhllLHHHHHHHHHHHHhhllLLLEEEEEL-HHHHhlllhh
Query fsdpladgptiqnanlrafaagvTPAQCFEMLALIRekhpTIPIGLLMY-ANLVfnngid  112
ident                         |                  |                
Sbjct -----------------------KPSLVRDTVQKFK----SYLIYVESNdLRVI-----r   84
DSSP  -----------------------LHHHHHHHHHHLL----LLEEEEELLlHHHH-----h


DSSP  hhHHHHhhhlLLEEEELLL---lhhhLHHHHHHHHHLLLEEEEEE--LLLL---------
Query afYARCeqvgVDSVLVADV---pveeSAPFRQAALRHNIAPIFIC--PPNA---------  158
ident           ||      |                  | |  |                 
Sbjct ysIEKG----VDAIISPWVnrkdpgiDHVLAKLMVKKNVALGFSLrpLLYSnpyeranll  140
DSSP  hhHHLL----LLEEELLLLlllllllLHHHHHHHHHHLLEEEEELhhHHHLlhhhhhhhh


DSSP  ---lhhhhhhhhhhlLLLEEE------llllhHHHHHHHH-------hHLLLLeeellll
Query ---dddllrqvasygRGYTYL------lalplHHLIEKLK-------eYHAAPalqgfgi  202
ident                |                  ||              |         
Sbjct rfmmkawklvekykvRRFLTSsaqekwdvrypRDLISLGVvigmeipqAKASI-------  193
DSSP  hhhhhhhhhhhhhllLEEEELllllhhhlllhHHHHHHHHhllllhhhHHHLL-------


DSSP  llhhhhhhhhhhllleeeellhhhhhhhhllllhhhhhhhhhhhhhhhhhlll
Query sspeqvsaavragaagaisgsaivkiieknlaspkqmlaelrsfvsamkaasr  255
ident                                                      
Sbjct --------------------------------------------smypeiilk  202
DSSP  --------------------------------------------lhhhhhhhl


No 51: Query=1bksA Sbjct=1j5sA Z-score=4.7

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct hmflgedylltnraavrlfnevkdlpivdphnhldakdivenkpwndiwevegatdhyvw   60
DSSP  llllllllllllhhhhhhhhhhlllleeellllllhhhhhhllllllhhhhhllllhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct elmrrcgvseeyitgsrsnkekwlalakvfprfvgnptyewihldlwrrfnikkviseet  120
DSSP  hhhhhllllhhhllllllhhhhhhhhhhhhhhhlllhhhhhhhhhhhhhllllllllhhh


DSSP  -----------lhhhhhhhhhhhhlLLLEEEEE-------------------------EE
Query -----------meryenlfaqlndrREGAFVPF-------------------------VT   24
ident                           |                                 
Sbjct aeeiweetkkklpemtpqkllrdmkVEILCTTDdpvstlehhrkakeavegvtilptwRP  180
DSSP  hhhhhhhhhhhlllllhhhhhhhllEEEEELLLllllllhhhhhhhhhlllleeelllLL


DSSP  LLL---------------------------lLHHHHHHHHHHHHHLLLLLEEEEL-----
Query LGD---------------------------pGIEQSLKIIDTLIDAGADALELGV-----   52
ident                                      |        |  |          
Sbjct DRAmnvdkegwreyvekmgerygedtstldgFLNALWKSHEHFKEHGCVASDHALlepsv  240
DSSP  HHHhllllllhhhhhhhhhhhhllllllhhhHHHHHHHHHHHHHLLLLLEEEEEElllll


DSSP  ----lllllllllhhhhhhhhhhhhhllLHHHHHHHHHHHHHHLLlLLEEEEEL------
Query ----pfsdpladgptiqnanlrafaagvTPAQCFEMLALIREKHPtIPIGLLMY------  102
ident                               |                   |         
Sbjct yyvdenraravhekafsgekltqdeindYKAFMMVQFGKMNQETN-WVTQLHIGalrdyr  299
DSSP  llllhhhhhhhhhhhlllllllhhhhhhHHHHHHHHHHHHHHHHL-LEEEEEELeellll


DSSP  ------------------HHHHhlllHHHHHHHHHHH---LLLEEEELllLHHHLHHHHH
Query ------------------ANLVfnngIDAFYARCEQV---GVDSVLVAdvPVEESAPFRQ  141
ident                                               |             
Sbjct dslfktlgpdsggdistnFLRI----AEGLRYFLNEFdgkLKIVLYVL--DPTHLPTIST  353
DSSP  hhhhhhlllllllleellLLLH----HHHHHHHHHHLlllLLEEEEEL--LHHHHHHHHH


DSSP  HHHHLL-LEEE-EEELllLLHHHHHHHHHH--------lLLLEEEL---llLHHHHHHHH
Query AALRHN-IAPI-FICPpnADDDLLRQVASY--------gRGYTYLL---alPLHHLIEKL  188
ident  |                           |                           |  
Sbjct IARAFPnVYVGaPWWF-nDSPFGMEMHLKYlasvdllynLAGMVTDsrkllSFGSRTEMF  412
DSSP  HHHHLLlEEELlLLLL-lLLHHHHHHHHHHhhllllhhhLLLLLLLlllllHHHHHHHHH


DSSP  HHHLllleeellllllhhhhhhhhhhllleeeellhhhhhhhhllllhhhhhhhhhhhhh
Query KEYHaapalqgfgisspeqvsaavragaagaisgsaivkiieknlaspkqmlaelrsfvs  248
ident                                                             
Sbjct RRVL----------------------------snvvgemvekgqipikearelvkhvsyd  444
DSSP  HHHH----------------------------hhhhhhhhhlllllhhhhhhhhhhhhlh


DSSP  hhhhlll
Query amkaasr  255
ident        
Sbjct gpkalff  451
DSSP  hhhhhhl


No 52: Query=1bksA Sbjct=3qy6A Z-score=4.6

back to top
DSSP  lhhhhhhhhhhhhlllleEEEE--EELL-----LLLHHHHHHHHHHHHHLLLLLEEEELL
Query meryenlfaqlndrregaFVPF--VTLG-----DPGIEQSLKIIDTLIDAGADALELGVP   53
ident                           |            |          |         
Sbjct ------------------MIDIhcHILPamddgAGDSADSIEMARAAVRQGIRTIIATPH   42
DSSP  ------------------LEELllLLLLlllllLLLHHHHHHHHHHHHHLLLLEEELLLE


DSSP  --LLLLllllhhhhhhhhhhhhhllLHHHHHHHHHH------hhhhllllleeEEELHHh
Query --FSDPladgptiqnanlrafaagvTPAQCFEMLAL------irekhptipigLLMYANl  105
ident                           ||   |                            
Sbjct hnNGVY-----------------knEPAAVREAADQlnkrlikediplhvlpgQEIRIY-   84
DSSP  elLLLL-----------------llLHHHHHHHHHHhhhhhhhllllleeellLEEELL-


DSSP  hhllLHHHHHH---hhhhhLLLEEEELL--lLHHH-LHHHHHHHHHLLLEEEE-EELL--
Query vfnnGIDAFYA---rceqvGVDSVLVAD--vPVEE-SAPFRQAALRHNIAPIF-ICPP--  156
ident           |             |       |                 |         
Sbjct ---gEVEQDLAkrqllslnDTKYILIEFpfdHVPRyAEQLFYDLQLKGYIPVIaHPERnr  141
DSSP  ---lLHHHHHHllllllhhHLLEEEEELlllLLLLlHHHHHHHHHHLLLEEEEeLHHHlh


DSSP  --LLLHHHHHHHH-HHLLllEEEL------------lLLHHHHHHHHhhhlllLEEEL--
Query --NADDDLLRQVA-SYGRgyTYLL------------aLPLHHLIEKLkeyhaaPALQG--  199
ident        ||                                 | |               
Sbjct eiRENPSLLYHLVeKGAA--SQITsgslagifgkqlkAFSLRLVEAN-----lIHFVAsd  194
DSSP  hhHHLLHHHHHHHhLLLE--EEEEhhhhlllllhhhhHHHHHHHHLL-----lLLEEEll


DSSP  --------lLLLLhhHHHHHHHHLlleeeellhhhhhhhhllllhhhhhhhhhhhhhhhh
Query --------fGISSpeQVSAAVRAGaagaisgsaivkiieknlaspkqmlaelrsfvsamk  251
ident                                                             
Sbjct ahnvktrnfHTQE--ALYVLEKEF---------gselpymltenaelllrnqtifrqppq  243
DSSP  lllllllllLHHH--HHHHHHHHH---------llhhhhhhhhhhhhhhlllllllllll


DSSP  hlll
Query aasr  255
ident     
Sbjct pvkr  247
DSSP  llll


No 53: Query=1bksA Sbjct=3iacA Z-score=4.2

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct atfxtedfllkndiartlyhkyaapxpiydfhchlspqeiaddrrfdnlgqiwlegdhyk   60
DSSP  llllllllllllhhhhhhhhhlllllleeellllllhhhhhhllllllhhhhhhllllhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct wralrsagvdeslitgketsdyekyxawantvpktlgnplyhwthlelrrpfgitgtlfg  120
DSSP  hhhhhhllllhhhlllllllhhhhhhhhhhhhhhllllhhhhhhhhhhhlllllllllll


DSSP  -------------------------------------------lhhhhhhhhhhhHLLLL
Query -------------------------------------------meryenlfaqlnDRREG   17
ident                                                           | 
Sbjct pdtaesiwtqcneklatpafsargixqqxnvrxvgttddpidsleyhrqiaaddsIDIEV  180
DSSP  hhhhhhhhhhhhhhhllhhhlhhhhhhhlleeeeelllllllllhhhhhhhhlllLLLEE


DSSP  EEEEEEE-LLLL---------------------lhhHHHHHHHHHHHLL----LLLEEEE
Query AFVPFVT-LGDP---------------------gieQSLKIIDTLIDAG----ADALELG   51
ident |                                             |        |   |
Sbjct APSWRPDkVFKIeldgfvdylrkleaaadvsitrfdDLRQALTRRLDHFaacgCRASDHG  240
DSSP  ELLLLLHhHHLLllllhhhhhhhhhhhhllllllhhHHHHHHHHHHHHHhhllLLEEEEE


DSSP  LLL-------lllllllhhhhhhhhhhhhhllLHHHHHHHHHHHHHHLL--LLLEEEEEL
Query VPF-------sdpladgptiqnanlrafaagvTPAQCFEMLALIREKHP--TIPIGLLMY  102
ident                                         |               |   
Sbjct IETlrfapvpddaqldailgkrlagetlseleIAQFTTAVLVWLGRQYAarGWVXQLHIG  300
DSSP  ELLllllllllhhhhhhhhhhhhllllllhhhHHHHHHHHHHHHHHHHHhhLLEEEEEEL


DSSP  -----------------------HHHHhlllhHHHHHHHHHHL-------lLEEEELLLL
Query -----------------------ANLVfnngiDAFYARCEQVG-------vDSVLVADVP  132
ident                         |            |                      
Sbjct airnnntrxfrllgpdtgfdsigDNNI-----SWALSRLLDSXdvtnelpkTILYCLNPR  355
DSSP  eellllhhhhhhhllllllleelLLLL-----HHHHHHHHHHHhlllllleEEEEELLHH


DSSP  hhhLHHHHHHHHHLL-------LEEEEEelllLLHHHHHHHHHHL-------llLEEEL-
Query veeSAPFRQAALRHN-------IAPIFIcppnADDDLLRQVASYG-------rgYTYLL-  177
ident                                    |                     |  
Sbjct --dNEVLATXIGNFQgpgiagkVQFGSGwwfnDQKDGXLRQLEQLsqxgllsqfVGXLTd  413
DSSP  --hHHHHHHHHHHLLlllllllEEELLLlhhhLLHHHHHHHHHHHhhhllhhhlLLLLLl


DSSP  --llLHHHHHHHHHHHLllleeellllllhhhhhhhhhhllleeeellhhhhhhhhllll
Query --alPLHHLIEKLKEYHaapalqgfgisspeqvsaavragaagaisgsaivkiieknlas  235
ident           |                                                 
Sbjct srsfLSYTRHEYFRRIL------------------------cnllgqwaqdgeipddeax  449
DSSP  llllLLLHHHHHHHHHH------------------------hhhhhhhhhlllllllhhh


DSSP  hhhhhhhhhhhhhhhhhlll
Query pkqmlaelrsfvsamkaasr  255
ident                     
Sbjct lsrxvqdicfnnaqryftik  469
DSSP  hhhhhhhhhlhhhhhhllll


No 54: Query=1bksA Sbjct=3icjA Z-score=4.1

back to top
DSSP  -----------------------------------------------lhhhhhhhhhhhh
Query -----------------------------------------------meryenlfaqlnd   13
ident                                                             
Sbjct cmkalingtiytsfspvkkvsglvisnervlyagdsstalriaelaggeiidlkgkfvmp   60
DSSP  leeeeelleeeeeelleeeeleeeeelleeeeeelhhhhhhhhhhhlleeeelllleeee


DSSP  lllleeeeeeELLLlLHHH-----------------------------------------
Query rregafvpfvTLGDpGIEQ-----------------------------------------   32
ident            ||    |                                          
Sbjct affdshlhldELGM-SLEMvdlrgvksmeelvervkkgrgriifgfgwdqdelgrwptre  119
DSSP  leeeeeelhhHHHH-HHHLeellllllhhhhhhhhhlllllleeeeeelhhhhlllllhh


DSSP  -----------------------------------hhhhhhhhhhllllleeeellLLLL
Query -----------------------------------slkiidtlidagadalelgvpFSDP   57
ident                                                             
Sbjct dldvidrpvflyrrcfhvavmnskmidllnlkpskdfdestgivreraleesrkiiNEKI  179
DSSP  hhlllllleeeeelllleeeelhhhhhhhllllllleelllleeehhhhhhhhhhhHHLL


DSSP  llllhhhhhhhhhhhhhlLLHHHHHHHHHHHHHHLLlLLEEEE-ELHHHHHlllhhhHHH
Query ladgptiqnanlrafaagVTPAQCFEMLALIREKHPtIPIGLL-MYANLVFnngidaFYA  116
ident                                         |                   
Sbjct --------------ltvkDYKHYIESAQEHLLSLGV-HSVGFMsVGEKALK-----aLFE  219
DSSP  --------------llhhHHHHHHHHHHHHHHHLLE-EEEEEEeELHHHHH-----hHHH


DSSP  HH---hHHLLLEEEELLLLHHHL---HHHHhhhHHLL--LEEEEEELL------------
Query RC---eQVGVDSVLVADVPVEES---APFRqaaLRHN--IAPIFICPP------------  156
ident                                                             
Sbjct LEregrLKMNVFAYLSPELLDKLeelNLGK---FEGRrlRIWGVXLFVdgslgartalls  276
DSSP  HHhlllLLLEEEEEELHHHHHHHhhhLLLL---EELLleEEEEEEEELllllllllllll


DSSP  -----------------LLLHHHHHHHH-HHLLllEEEL------llLHHHHHHHHHhhl
Query -----------------NADDDLLRQVA-SYGRgyTYLL------alPLHHLIEKLKeyh  192
ident                                                      |      
Sbjct epytdnpttsgelvmnkDEIVEVIERAKpLGLD--VAVHaigdkavdVALDAFEEAE---  331
DSSP  llllllllllllllllhHHHHHHHHHHLlLLLE--EEEEellhhhhhHHHHHHHHHL---


DSSP  llLEEELlLLLLHH-hhhHHHHHLLLEEEEllhhhhhhhhllllhhhhhhhHHHH-----
Query aaPALQGfGISSPE-qvsAAVRAGAAGAISgsaivkiieknlaspkqmlaeLRSF-----  246
ident           |                                                 
Sbjct -fSGRIE-HASLVRddqlERIKELKVRISA-------------------qpHFIVsdwwi  370
DSSP  -lLLEEE-ELLLLLhhhhHHHHHHLLEEEE-------------------llLHHHhlllh


DSSP  ----------hhHHHHLLL-----------------------------------------
Query ----------vsAMKAASR-----------------------------------------  255
ident                                                             
Sbjct vnrvgeerakwaYRLKTLSsitklgfstdspiepadpwvsidaavnryvvdpgervsree  430
DSSP  hhhhhhhhhhhlLLHHHHHhhlleeellllllllllhhhhhhhhhhlllllhhhlllhhh


DSSP  --------------------------------------
Query --------------------------------------  255
ident                                       
Sbjct alhlythgsaqvtlaedlgklergfraeyiildrdplk  468
DSSP  hhhhllhhhhhhlllllllllllllllleeeellllll


No 55: Query=1bksA Sbjct=3f2bA Z-score=4.1

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct vrrletiveeerrvvvqgyvfdaevselksgrtlltmkitdytnsilvkmfsrdkedael   60
DSSP  lllhhhlllleeeeeeeeeeeeeeeeellllleeeeeeeelllleeeeeeelllhhhhhh


DSSP  --------------------------------lhhhhhhhhhhhhllllEEEEEEEL---
Query --------------------------------meryenlfaqlndrregAFVPFVTL---   25
ident                                                             
Sbjct msgvkkgmwvkvrgsvqndtfvrdlviiandlneiaanerqdtapegekRVELHLHTpms  120
DSSP  hhlllllleeeeeeeeeeelllleeeeeeeeeeeellllllllllllllLLLLLLLLlll


DSSP  --LLLLhhHHHHHHHHHHHLLL-LLEEEELlllllllllhhhhhhhhhhhhhlllhhhhH
Query --GDPGieQSLKIIDTLIDAGA-DALELGVpfsdpladgptiqnanlrafaagvtpaqcF   82
ident            | |      |                                       
Sbjct qmDAVT--SVTKLIEQAKKWGHpAIAVTDH---------------------------avV  151
DSSP  llLLLL--LHHHHHHHHHHLLLlLEEELLL---------------------------llL


DSSP  HHHHHHHHHLL----LLLEEEEELH-----------------------hHHHLLLHhhhh
Query EMLALIREKHP----TIPIGLLMYA-----------------------nLVFNNGIdafy  115
ident                    ||                                       
Sbjct QSFPEAYSAAKkhgmKVIYGLEANIvddpfhvtllaqnetglknlfklvSLSHIQY----  207
DSSP  LLHHHHHHHHHhhllLEEEEEEEEEellleeeeeeellhhhhhhhhhhhHHHHLLL----


DSSP  hhhhhhllleeeellllhhhLHHHHHHHhhLLLEEEEE-----ELLLllhhHHHHHhHHL
Query arceqvgvdsvlvadvpveeSAPFRQAAlrHNIAPIFI-----CPPNadddLLRQVaSYG  170
ident                                               |             
Sbjct ------------fhrvpripRSVLVKHR--DGLLVGSGcdkgeLFDN----VEDIA-RFY  248
DSSP  ------------lllllleeHHHHHHLL--LLEEEELLlllllLLLL----LLLLH-HHL


DSSP  LlLEEEL----------------lLLHHHHHHHHHHHLLlLEEEL---------------
Query RgYTYLL----------------aLPLHHLIEKLKEYHAaPALQG---------------  199
ident                                         |                   
Sbjct D-FLEVHppdvykplyvkdeemikNIIRSIVALGEKLDI-PVVATgnvhylnpedkiyrk  306
DSSP  L-LEEELlhhhhlllllllhhhhhHHHHHHHHHHHHLLL-LEEELlllllllhhhhhhhh


DSSP  --------------------lllllHHHHHHH------HHHLLLE---------------
Query --------------------fgissPEQVSAA------VRAGAAG---------------  218
ident                           |                                 
Sbjct ilihsqgganplnrhelpdvyfrttNEMLDCFsflgpeKAKEIVVdntqkiasligdvkp  366
DSSP  hhhhllhhhlllllllllllllllhHHHHHHHhhhhhhHHHHHHLhhhhhhhhlllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  218
ident                                                             
Sbjct ikdelytpriegadeeiremsyrrakeiygdplpklveerlekelksiighgfaviylis  426
DSSP  llllllllllllhhhhhhhhhhhhhhhhhlllllhhhhhhhhhhhhhhhhlllhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  218
ident                                                             
Sbjct hklvkkslddgylvgsrgsvgssfvatmteitevnplpphyvcpnckhseffndgsvgsg  486
DSSP  hhhhhhhhhllllleelhhhhhlhhhhhllllllllllleeelllllleeellllllllh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  218
ident                                                             
Sbjct fdlpdkncprcgtkykkdghdipfetflgfkgdkvpdidlnfsgeyqprahnytkvlfge  546
DSSP  hhllllllllllllleeellllllhhhhllllllllleeeeeelllhhhhhhhhhhhhll


DSSP  ----------------------------eeellhhhhhhhHLLLL---------------
Query ----------------------------aisgsaivkiieKNLAS---------------  235
ident                                                             
Sbjct dnvyragtigtvadktaygfvkayasdhnlelrgaeidrlAAGCTgvkrttgqhpggiiv  606
DSSP  lleeeeeeeeellhhhhhhhhhhhhhhllllllhhhhhhhHHHHLlleeeeeeeeeeeee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  235
ident                                                             
Sbjct vpdymeiydftpiqypaddtssewrtthfdfhsihdnllkldilghddptvirmlqdlsg  666
DSSP  llllllhhhllleelhhhllllllleeeeehhhhllllleeeeeeehhhhhhhhhhhhhl


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  235
ident                                                             
Sbjct idpktiptddpdvmgifssteplgvtpeqimcnvgtigipefgtrfvrqmleetrpktfs  726
DSSP  llhhhlllllhhhhhlllllhhhlllhhhhllllllllllllllhhhhhhhhhhllllhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  235
ident                                                             
Sbjct elvqisglshgtdvwlgnaqeliqngtctlsevigcrddimvyliyrglepslafkimes  786
DSSP  hhhhhhhhllllllllllhhhhhhlllllhhhllllhhhhhhhhhhllllhhhhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  235
ident                                                             
Sbjct vrkgkgltpefeaemrkhdvpewyidsckkikymfpkahaaayvlmavriayfkvhhpll  846
DSSP  hlllllllhhhhhhhhhllllhhhhhhhhhllllllhhhhhhhhhhhhhhhhhhhhlhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  235
ident                                                             
Sbjct yyasyftvraedfdldamikgsaairkrieeinakgiqatakekslltvlevalemcerg  906
DSSP  hhhhhhhhllllllhhhhhhlhhhhhhhhhhhhhlhhhllhhhhhhhhhhhhhhhhhhll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  235
ident                                                             
Sbjct fsfknidlyrsqatefvidgnslippfnaipglgtnvaqaivrareegeflskedlqqrg  966
DSSP  leellllllllllllleeelleeellhhhlllllhhhhhhhhhhhhllllllhhhhhhhh


DSSP  --------hhhhhhhhhhhhhhhhhlll
Query --------pkqmlaelrsfvsamkaasr  255
ident                             
Sbjct klsktlleylesrgcldslpdhnqlslf  994
DSSP  lllhhhhhhhhhllllllllllllllll


No 56: Query=1bksA Sbjct=2yb1A Z-score=4.0

back to top
DSSP  lhhhhhhhhhhhhlllLEEE-eEEELLlllhhhHHHHHHHHHHLL--lLLEEEELlllll
Query meryenlfaqlndrreGAFV-pFVTLGdpgieqSLKIIDTLIDAG--aDALELGVpfsdp   57
ident                       |                    |                
Sbjct ----------------ANIDlhFHSRT-sdgalTPTEVIDRAAARapaLLALTDH-----   38
DSSP  ----------------LLEEllLLLLL-lllllLHHHHHHHHHLLlllEEEELLL-----


DSSP  llllhhhhhhhhhhhhhlllhhhhhHHHHHHHHHLL----LLLEEEEelhhhhhlllhhh
Query ladgptiqnanlrafaagvtpaqcfEMLALIREKHP----TIPIGLLmyanlvfnngida  113
ident                            ||               |               
Sbjct ----------------------dctGGLAEAAAAAArrgiPFLNGVE-------------   63
DSSP  ----------------------lllLLHHHHHHHHHhlllLEEEEEE-------------


DSSP  hhhhhhhhllleeeELLLL-----------------------------------------
Query fyarceqvgvdsvlVADVP-----------------------------------------  132
ident               |                                             
Sbjct --------------VSVSWgrhtvhivglgidpaepalaaglksiregrlerarqmgasl  109
DSSP  --------------EEEEElleeeeeeeellllllhhhhhhhhhhhllhhhhhhhhhhhh


DSSP  -----------------------------------------------------------h
Query -----------------------------------------------------------v  133
ident                                                             
Sbjct eaagiagcfdgamrwcdnpemisrthfarhlvdsgavkdmrtvfrkyltpgkpgyvshqw  169
DSSP  hhlllllhhhhhhlllllhhhllhhhhhhhhhhllllllhhhhhhhllllllllllllll


DSSP  hHLHHHHHHHHHLLLEEEE-EELL-LLLH-HHHHHHHHHL---LLLEEE-----llLLHH
Query eESAPFRQAALRHNIAPIF-ICPP-NADD-DLLRQVASYG---RGYTYL-----laLPLH  182
ident                                  |                         |
Sbjct aSLEDAVGWIVGAGGMAVIaHPGRyDMGRtLIERLILDFQaagGQGIEVasgshslDDMH  229
DSSP  lLHHHHHHHHHHLLLEEEElLHHHlLLLHhHHHHHHHHHHhllLLEEEEeellllhHHHH


DSSP  HHHHHHHHHLlLLEEEllllllhhhhhhhhhhllleeEELLhHHHHH-----hhllllhh
Query HLIEKLKEYHaAPALQgfgisspeqvsaavragaagaISGSaIVKII-----eknlaspk  237
ident              |                        |                     
Sbjct KFALHADRHG-LYASS---------------------GSDF-HAPGEdvghtedlppicr  266
DSSP  HHHHHHHHHL-LEEEE---------------------ELLL-LLLLLlllllllllllll


DSSP  hhhhhhhhhhhhhhhlll
Query qmlaelrsfvsamkaasr  255
ident                   
Sbjct piwrelearilrpadaen  284
DSSP  lhhhhlhhhlllllhhhl


No 57: Query=1bksA Sbjct=4ofcA Z-score=3.8

back to top
DSSP  lhhhhhhhhhhhhlllleeeeeeelllllhhhhhhhhhhhhhllllleeeelllllllll
Query meryenlfaqlndrregafvpfvtlgdpgieqslkiidtlidagadalelgvpfsdplad   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  lhhhhhhhhhhhhhlllhhhhhhhhhhhhhhllLLLEE-EEELHH---------------
Query gptiqnanlrafaagvtpaqcfemlalirekhpTIPIG-LLMYAN---------------  104
ident                                                             
Sbjct ---------------------------------MKIDIhSHILPKewpdlkkrfgyggwv   27
DSSP  ---------------------------------LLEEEeEELLLLllllhhhhhllllle


DSSP  ------------------hhhLLLHhhHHHHHHHHL------LLEEEEL-----------
Query ------------------lvfNNGIdaFYARCEQVG------VDSVLVA-----------  129
ident                                           |                 
Sbjct qlqhhskgeakllkdgkvfrvVRENcwDPEVRIREMdqkgvtVQALSTVpvmfsywakpe   87
DSSP  eeeeeelleeeeeelleeeeeEEHHhlLHHHHHHHHhhhlllEEEEELLhhhhlllllhh


DSSP  --llLHHHL-HHHHHHHHHLL--LEEEEEELLLLLHHHHHHHHHHL----LLLEEEL---
Query --dvPVEES-APFRQAALRHN--IAPIFICPPNADDDLLRQVASYG----RGYTYLL---  177
ident                               |  |                          
Sbjct dtlnLCQLLnNDLASTVVSYPrrFVGLGTLPMQAPELAVKEMERCVkelgFPGVQIGthv  147
DSSP  hhhhHHHHHhHHHHHHHHHLLllEEEEELLLLLLHHHHHHHHHHHHhlllLLEEEEElee


DSSP  ------lLLHHHHHHHHHHHLLlLEEELL----------------------LLLLhhHHH
Query ------aLPLHHLIEKLKEYHAaPALQGF----------------------GISSpeQVS  209
ident          |                                                 |
Sbjct newdlnaQELFPVYAAAERLKC-SLFVHPwdmqmdgrmakywlpwlvgmpaETTI-aICS  205
DSSP  lleelllHHHHHHHHHHHHHLL-EEEEELllllllhhhhlllhhhhlhhhhHHHH-hHHH


DSSP  H-hHHHL------lLEEEELLHH----------------------------hhhhhhlll
Query A-aVRAG------aAGAISGSAI----------------------------vkiieknla  234
ident                    |                                        
Sbjct MimGGVFekfpklkVCFAHGGGAfpftvgrishgfsmrpdlcaqdnpmnpkkylgsfytd  265
DSSP  HhlLLHHhhlllllEEELHHHLLhhhhhhhhhhhhhhlhhhhlllllllhhhhlllleee


DSSP  lhhhHHHHHHHHHHHHH-------------------------------------------
Query spkqMLAELRSFVSAMK-------------------------------------------  251
ident         |                                                   
Sbjct alvhDPLSLKLLTDVIGkdkvilgtdypfplgelepgkliesmeefdeetknklkagnal  325
DSSP  llllLHHHHHHHHHHHLllleelllllllllllllllhhhhhlllllhhhhhhhhlhhhh


DSSP  ------hlll
Query ------aasr  255
ident           
Sbjct aflglerkqf  335
DSSP  hhhlllhhhl


No 58: Query=1bksA Sbjct=3e38A Z-score=3.7

back to top
DSSP  lhhhhhhhhhHHHL--LLLEEEE-EEELLL-llhhHHHHHHHHHHHLLLLLEEEELLLLL
Query meryenlfaqLNDR--REGAFVP-FVTLGD-pgieQSLKIIDTLIDAGADALELGVPFSD   56
ident             |                            |     | ||  |      
Sbjct --aqrrneiqVPDLdgYTTLKCDfHXHSVFsdglvWPTVRVDEAYRDGLDAISLTEHIEY   58
DSSP  --llllllllLLLLllLEEEEEElLLLLLLlllllLHHHHHHHHHHLLLLEELLEEELLL


DSSP  lllllhhhhhhHHHHhHHLLLHHHHHHHHHHHHHHLLlLLEEEEElhhhhhlllhhhhhh
Query pladgptiqnaNLRAfAAGVTPAQCFEMLALIREKHPtIPIGLLMyanlvfnngidafya  116
ident                          |       ||   |                     
Sbjct -----------RPHKqDVVSDHNRSFDLCREQAEKLG-ILLIKGS----------eitra   96
DSSP  -----------LLLLlLLLLLLLHHHHHHHHHHHHHL-LEELLEE----------eeell


DSSP  hhhhhlllEEEE------llllhhHLHHHHHHHhhlllEEEEE----------elLLLLH
Query rceqvgvdSVLV------advpveESAPFRQAAlrhniAPIFI----------cpPNADD  160
ident           |                           |  |                  
Sbjct xapghfnaIFLSdsnpleqkdykdAFREAKKQG-----AFXFWnhpgwdsqqpdtTKWWP  151
DSSP  lllleeeeELLLllhhhllllhhhHHHHHHHLL-----LEEEEllllllllllllLLLLH


DSSP  HHHHHHHHHLlllEEEL------llLHHHHHHHHHhhllllEEELlllllhhhhhhhhhh
Query DLLRQVASYGrgyTYLL------alPLHHLIEKLKeyhaapALQGfgisspeqvsaavra  214
ident                                             |               
Sbjct EHTALYQEGC-xhGIEVanghlyxpEAIQWCLDKN-----lTXIG---------------  190
DSSP  HHHHHHHLLL-llEEEEeelleellHHHHHHHHHL-----lEEEE---------------


DSSP  llleeEELLhhHHHH---------------------------------------------
Query gaagaISGSaiVKII---------------------------------------------  229
ident       |       |                                             
Sbjct -----TSDI--HQPIqtdydfekgehrtxtfvfakerslqgirealdnrrtaayfhelli  243
DSSP  -----ELLL--LLLHhhhllhhhllllleeeeeellllhhhhhhhhhllleeeeelleee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  229
ident                                                             
Sbjct gredllrpffekcvkieevsrneqgvtlsitnvtdlvlklkktahdtllvyfrdxtlkph  303
DSSP  llhhhhhhhhhhheeeeeeeeelleeeeeeeellllleeeeelllllleellleeeelll


DSSP  -------------hhllllhhhhhhhhhhhhhhhhhlll
Query -------------eknlaspkqmlaelrsfvsamkaasr  255
ident                                        
Sbjct trytvrigfkqgikggdvnfevtnfivapdkglkytisl  342
DSSP  eeeeeeeeellllllleeeeeeeeeeeelleeeeeeeel


No 59: Query=1bksA Sbjct=3ooqA Z-score=3.7

back to top
DSSP  lhhhhhhhhhhHHLL---------------------------------------lleeee
Query meryenlfaqlNDRR---------------------------------------egafvp   21
ident                                                             
Sbjct --kilfknatvFPITsrpfkgdvlvsngkvekvgeniedpdaeivdltgkflfpgfvdah   58
DSSP  --leeeeeeeeLLLLllleeeeeeeelleeeeeelllllllleeeelllleeeeleeeee


DSSP  EEELLLL--------------------------lHHHHhHHHHHHHHLLLLLEEEELlll
Query FVTLGDP--------------------------gIEQSlKIIDTLIDAGADALELGVpfs   55
ident                                     |    |      |           
Sbjct SHIGLFEegvgyyysdgneatdpvtphvkaldgfNPQD-PAIERALAGGVTSVXIVP---  114
DSSP  ELLLLLLllllhhhlllllllllllllllhhhhlLLLL-HHHHHHHLLLEEEEEELL---


DSSP  llllllhhhhhhhhhhhhhlllhhhhhhhhhHHHHHLLLlleeeeelhhhhhlllhhhhh
Query dpladgptiqnanlrafaagvtpaqcfemlaLIREKHPTipigllmyanlvfnngidafy  115
ident                                 | |                         
Sbjct --------------gsanpvggqgsvikfrsIIVEECIV---------------------  139
DSSP  --------------llllleeeeeeeeelllLLHHHHEE---------------------


DSSP  hhhhhhLLLEEEEL-------------------llLHHHLH-------------------
Query arceqvGVDSVLVA-------------------dvPVEESA-------------------  137
ident              |                                              
Sbjct -----kDPAGLKXAfgenpkrvygerkqtpstrxgTAGVIRdyftkvknyxkkkelaqke  194
DSSP  -----eEEEEEEEEllhhhhhhhhhlllllllhhhHHHHHHhhhhhhhhhhhhhhhhhhl


DSSP  -----------hhHHHHHHLLLEEEEEELLLLlhhHHHHHHHHL-----LLLEEELlllH
Query -----------pfRQAALRHNIAPIFICPPNAdddLLRQVASYG-----RGYTYLLalpL  181
ident                  ||  |                                      
Sbjct gkeftetdlkxevGEXVLRKKIPARXHAHRAD---DILTAIRIAeefgfNLVIEHG-teA  250
DSSP  llllllllhhhhhHHHHHLLLLLEEEEELLHH---HHHHHHHHHhhhllLEEEEEL-llH


DSSP  HHHHHHHHHHLLlLEEELlLLLL-------hhhhHHHHHHL-----lLEEEEL--LHHHh
Query HHLIEKLKEYHAaPALQGfGISS-------peqvSAAVRAG-----aAGAISG--SAIVk  227
ident       | |    |   |                                          
Sbjct YKISKVLAEKKI-PVVVG-PLLTfrtklelkdltXETIAKLlkdgvlIALXCDhpVIPL-  307
DSSP  HHHHHHHHHHLL-LEEEL-LLLLllllhhhllllLLHHHHHhhllllEEELLLllLLLH-


DSSP  hhhhllllhhhhhhhhhhHHHHHH----------HLLL----------------------
Query iieknlaspkqmlaelrsFVSAMK----------AASR----------------------  255
ident                   |                                         
Sbjct -----------------eFATVQAataxrygakeEDLLkiltvnpakilgledrigsiep  350
DSSP  -----------------hHHHHHHhhhhhhlllhHHHHhlllhhhhhhllllllllllll


DSSP  ----------------------------------
Query ----------------------------------  255
ident                                   
Sbjct gkdadlvvwsghpfdxksvvervyidgvevfrre  384
DSSP  llllleeeelllllllllleeeeeelleeeeell