Results: dupa

Query: 1bf6A

MOLECULE: PHOSPHOTRIESTERASE HOMOLOGY PROTEIN;

Select neighbours (check boxes) for viewing as multiple structural alignment or 3D superimposition. The list of neighbours is sorted by Z-score. Similarities with a Z-score lower than 2 are spurious. Each neighbour has links to pairwise structural alignment with the query structure, and to the PDB format coordinate file where the neighbour is superimposed onto the query structure.

Expand gaps

Summary

    No:  Chain   Z    rmsd lali nres  %id PDB  Description
   1:  1bf6-A 56.8  0.0  291   291  100 PDB  MOLECULE: PHOSPHOTRIESTERASE HOMOLOGY PROTEIN;                       
   2:  3k2g-B 40.6  1.5  290   358   31 PDB  MOLECULE: RESINIFERATOXIN-BINDING, PHOSPHOTRIESTERASE-               
   3:  2ob3-A 36.8  2.1  276   329   30 PDB  MOLECULE: PARATHION HYDROLASE;                                       
   4:  2vc5-A 36.6  2.3  279   314   33 PDB  MOLECULE: ARYLDIALKYLPHOSPHATASE;                                    
   5:  2y1h-B 21.0  2.9  232   265   15 PDB  MOLECULE: PUTATIVE DEOXYRIBONUCLEASE TATDN3;                         
   6:  1onx-A 20.1  2.7  241   390   17 PDB  MOLECULE: ISOASPARTYL DIPEPTIDASE;                                   
   7:  3mkv-A 18.5  3.7  241   414   15 PDB  MOLECULE: PUTATIVE AMIDOHYDROLASE;                                   
   8:  3cjp-A 18.4  2.7  218   262   13 PDB  MOLECULE: PREDICTED AMIDOHYDROLASE, DIHYDROOROTASE FAMILY;           
   9:  3gg7-A 18.2  3.0  218   243   16 PDB  MOLECULE: UNCHARACTERIZED METALLOPROTEIN;                            
  10:  1gkp-A 18.1  2.7  231   458    9 PDB  MOLECULE: HYDANTOINASE;                                              
  11:  3giq-A 17.9  3.0  236   475   13 PDB  MOLECULE: N-ACYL-D-GLUTAMATE DEACYLASE;                              
  12:  3ls9-A 17.8  3.3  234   453   15 PDB  MOLECULE: TRIAZINE HYDROLASE;                                        
  13:  2vun-A 17.6  2.9  217   385   14 PDB  MOLECULE: ENAMIDASE;                                                 
  14:  3mtw-A 17.6  3.5  234   404   13 PDB  MOLECULE: L-ARGININE CARBOXYPEPTIDASE CC2672;                        
  15:  2ffi-A 17.6  3.2  233   273   10 PDB  MOLECULE: 2-PYRONE-4,6-DICARBOXYLIC ACID HYDROLASE, PUTATIV          
  16:  3nqb-A 17.5  3.2  226   587   15 PDB  MOLECULE: ADENINE DEAMINASE 2;                                       
  17:  4cqb-A 17.5  3.8  236   402   10 PDB  MOLECULE: N-ISOPROPYLAMMELIDE ISOPROPYL AMIDOHYDROLASE;              
  18:  2paj-A 17.3  3.2  225   421   12 PDB  MOLECULE: PUTATIVE CYTOSINE/GUANINE DEAMINASE;                       
  19:  1k6w-A 17.3  3.6  238   423   12 PDB  MOLECULE: CYTOSINE DEAMINASE;                                        
  20:  4dlf-A 17.1  3.3  238   287    9 PDB  MOLECULE: AMIDOHYDROLASE 2;                                          
  21:  2oof-A 17.0  3.8  234   403   15 PDB  MOLECULE: 4-IMIDAZOLONE-5-PROPANOATE AMIDOHYDROLASE;                 
  22:  2qpx-A 16.9  3.2  235   376   11 PDB  MOLECULE: PREDICTED METAL-DEPENDENT HYDROLASE OF THE TIM-BA          
  23:  3irs-A 16.8  3.3  229   281   12 PDB  MOLECULE: UNCHARACTERIZED PROTEIN BB4693;                            
  24:  4b3z-D 16.7  2.9  225   477    9 PDB  MOLECULE: DIHYDROPYRIMIDINASE-RELATED PROTEIN 1;                     
  25:  4c5y-A 16.3  3.5  230   436   12 PDB  MOLECULE: OCHRATOXINASE;                                             
  26:  4mup-B 15.8  3.4  224   286   15 PDB  MOLECULE: AMIDOHYDROLASE;                                            
  27:  2dvt-A 15.8  3.1  226   325   13 PDB  MOLECULE: THERMOPHILIC REVERSIBLE GAMMA-RESORCYLATE DECARBO          
  28:  3gri-A 15.5  3.2  226   422   11 PDB  MOLECULE: DIHYDROOROTASE;                                            
  29:  2ogj-A 15.5  3.1  225   379   13 PDB  MOLECULE: DIHYDROOROTASE;                                            
  30:  2imr-A 15.5  3.8  235   380   14 PDB  MOLECULE: HYPOTHETICAL PROTEIN DR_0824;                              
  31:  3e74-A 15.3  2.9  215   429   14 PDB  MOLECULE: ALLANTOINASE;                                              
  32:  1a4m-A 15.1  3.6  235   349   11 PDB  MOLECULE: ADENOSINE DEAMINASE;                                       
  33:  1j6p-A 15.1  3.6  228   407   10 PDB  MOLECULE: METAL-DEPENDENT HYDROLASE OF                               
  34:  4rdv-B 15.0  3.6  234   451   11 PDB  MOLECULE: N-FORMIMINO-L-GLUTAMATE IMINOHYDROLASE;                    
  35:  4qrn-A 15.0  3.3  224   352   13 PDB  MOLECULE: 5-CARBOXYVANILLATE DECARBOXYLASE;                          
  36:  1itq-A 14.8  3.5  231   369   12 PDB  MOLECULE: RENAL DIPEPTIDASE;                                         
  37:  2uz9-A 14.8  3.9  230   444   10 PDB  MOLECULE: GUANINE DEAMINASE;                                         
  38:  3pnu-A 14.7  3.0  217   338   12 PDB  MOLECULE: DIHYDROOROTASE;                                            
  39:  3qy6-A 14.6  3.2  195   247   15 PDB  MOLECULE: TYROSINE-PROTEIN PHOSPHATASE YWQE;                         
  40:  4ofc-A 14.3  3.3  217   335   14 PDB  MOLECULE: 2-AMINO-3-CARBOXYMUCONATE-6-SEMIALDEHYDE DECARBOX          
  41:  3icj-A 14.3  3.7  219   468   13 PDB  MOLECULE: UNCHARACTERIZED METAL-DEPENDENT HYDROLASE;                 
  42:  2gwg-A 14.3  3.9  226   329    9 PDB  MOLECULE: 4-OXALOMESACONATE HYDRATASE;                               
  43:  4hk5-D 14.1  3.6  233   380    9 PDB  MOLECULE: URACIL-5-CARBOXYLATE DECARBOXYLASE;                        
  44:  1j5s-A 14.0  3.4  238   451   12 PDB  MOLECULE: URONATE ISOMERASE;                                         
  45:  1a5k-C 13.9  3.0  203   566   11 PDB  MOLECULE: UREASE (GAMMA SUBUNIT);                                    
  46:  1yrr-B 13.9  3.7  206   334   12 PDB  MOLECULE: N-ACETYLGLUCOSAMINE-6-PHOSPHATE DEACETYLASE;               
  47:  3iac-A 13.7  3.5  238   469   13 PDB  MOLECULE: GLUCURONATE ISOMERASE;                                     
  48:  3ooq-A 13.4  3.4  194   384   12 PDB  MOLECULE: AMIDOHYDROLASE;                                            
  49:  4dzi-C 12.6  3.4  209   388   11 PDB  MOLECULE: PUTATIVE TIM-BARREL METAL-DEPENDENT HYDROLASE;             
  50:  1v77-A 11.8  3.4  177   202    5 PDB  MOLECULE: HYPOTHETICAL PROTEIN PH1877;                               
  51:  2a3l-A 11.7  4.0  240   616   11 PDB  MOLECULE: AMP DEAMINASE;                                             
  52:  1m65-A  9.4  4.0  177   234   10 PDB  MOLECULE: HYPOTHETICAL PROTEIN YCDX;                                 
  53:  3au2-A  9.3  4.0  183   575   10 PDB  MOLECULE: DNA POLYMERASE BETA FAMILY (X FAMILY);                     
  54:  3dcp-A  9.2  3.7  176   277    8 PDB  MOLECULE: HISTIDINOL-PHOSPHATASE;                                    
  55:  3f2b-A  8.7  4.0  181   994    6 PDB  MOLECULE: DNA-DIRECTED DNA POLYMERASE III ALPHA CHAIN;               
  56:  1bks-A  6.5  3.8  169   255    7 PDB  MOLECULE: TRYPTOPHAN SYNTHASE;                                       
  57:  2yb1-A  6.5  4.4  156   284   11 PDB  MOLECULE: AMIDOHYDROLASE;                                            
  58:  2anu-A  5.5  3.6  145   224    4 PDB  MOLECULE: HYPOTHETICAL PROTEIN TM0559;                               
  59:  3e38-A  5.1  3.6  151   342    9 PDB  MOLECULE: TWO-DOMAIN PROTEIN CONTAINING PREDICTED PHP-LIKE           


Pairwise Structural Alignments

Notation: three-state secondary structure definitions by DSSP (reduced to H=helix, E=sheet, L=coil) are shown above the amino acid sequence. Structurally equivalent residues are in uppercase, structurally non-equivalent residues (e.g. in loops) are in lowercase. Amino acid identities are marked by vertical bars.

No 1: Query=1bf6A Sbjct=1bf6A Z-score=56.8

back to top
DSSP  LLLLLLEEEEEELLLEELHHHHLLHHHEELLHHHHHHHHHHHHHLLEEEEEELLLHHHLL
Query SFDPTGYTLAHEHLHIDLSGFKNNVDCRLDQYAFICQEMNDLMTRGVRNVIEMTNRYMGR   60
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct SFDPTGYTLAHEHLHIDLSGFKNNVDCRLDQYAFICQEMNDLMTRGVRNVIEMTNRYMGR   60
DSSP  LLLLLLEEEEEELLLEELHHHHLLHHHEELLHHHHHHHHHHHHHLLEEEEEELLLHHHLL


DSSP  LHHHHHHHHHHHLLEEEEEELLLLHHHLLLHHHHLLHHHHHHHHHHHHHLLLLLLLLLEE
Query NAQFMLDVMRETGINVVACTGYYQDAFFPEHVATRSVQELAQEMVDEIEQGIDGTELKAG  120
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct NAQFMLDVMRETGINVVACTGYYQDAFFPEHVATRSVQELAQEMVDEIEQGIDGTELKAG  120
DSSP  LHHHHHHHHHHHLLEEEEEELLLLHHHLLLHHHHLLHHHHHHHHHHHHHLLLLLLLLLEE


DSSP  EEEEEELLLLLLLHHHHHHHHHHHHHHHHHLLLEEEELHHHLLHHHHHHHHHHLLLLHHH
Query IIAEIGTSEGKITPLEEKVFIAAALAHNQTGRPISTHTSFSTMGLEQLALLQAHGVDLSR  180
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct IIAEIGTSEGKITPLEEKVFIAAALAHNQTGRPISTHTSFSTMGLEQLALLQAHGVDLSR  180
DSSP  EEEEEELLLLLLLHHHHHHHHHHHHHHHHHLLLEEEELHHHLLHHHHHHHHHHLLLLHHH


DSSP  EEELLLLLLLLHHHHHHHHHLLLEEEELLLLLLLLLLHHHHHHHHHHHHHLLLHHHEEEL
Query VTVGHCDLKDNLDNILKMIDLGAYVQFDTIGKNSYYPDEKRIAMLHALRDRGLLNRVMLS  240
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct VTVGHCDLKDNLDNILKMIDLGAYVQFDTIGKNSYYPDEKRIAMLHALRDRGLLNRVMLS  240
DSSP  EEELLLLLLLLHHHHHHHHHLLLEEEELLLLLLLLLLHHHHHHHHHHHHHLLLHHHEEEL


DSSP  LLLLLHHHLHHHLLLLLLHHHHLHHHHHHHLLLLHHHHHHHHLHHHHHHLL
Query MDITRRSHLKANGGYGYDYLLTTFIPQLRQSGFSQADVDVMLRENPSQFFQ  291
ident |||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct MDITRRSHLKANGGYGYDYLLTTFIPQLRQSGFSQADVDVMLRENPSQFFQ  291
DSSP  LLLLLHHHLHHHLLLLLLHHHHLHHHHHHHLLLLHHHHHHHHLHHHHHHLL


No 2: Query=1bf6A Sbjct=3k2gB Z-score=40.6

back to top
DSSP  ---------------------LLLLL-LEEEEEELLLEELHHHHL---------------
Query ---------------------SFDPT-GYTLAHEHLHIDLSGFKN---------------   23
ident                            | || ||||  |     |               
Sbjct slselspchvrsgrixtvdgpIPSSAlGHTLXHEHLQNDCRCWWNppqeperqylaeapi   60
DSSP  llllllllllllleeeelleeEEHHHlLLEELLLLLLEELHHHLLllllhhhhhhhhlll


DSSP  ---------------LHHHEELLHHHHHHHHHHHHHLLEEEEEELLLHHHLLLHHHHHHH
Query ---------------NVDCRLDQYAFICQEMNDLMTRGVRNVIEMTNRYMGRNAQFMLDV   68
ident                     ||       |       | |     | |  ||        
Sbjct sieilselrqdpfvnKHNIALDDLDLAIAEVKQFAAVGGRSIVDPTCRGIGRDPVKLRRI  120
DSSP  lhhhhhhhhllhhhlLLLLEELLHHHHHHHHHHHHHLLLLEEEELLLLLLLLLHHHHHHH


DSSP  HHHHLLEEEEEELLLLHHHLLLHHHHLLHHHHHHHHHHHHHLLLLLLLLLEEEEEEEELL
Query MRETGINVVACTGYYQDAFFPEHVATRSVQELAQEMVDEIEQGIDGTELKAGIIAEIGTS  128
ident   |||  ||   |||     ||  |  |    | | | |   | |||    | | ||| |
Sbjct SAETGVQVVXGAGYYLASSXPETAARLSADDIADEIVAEALEGTDGTDARIGLIGEIGVS  180
DSSP  HHHHLLEEEELLLLLLHHHLLHHHHLLLHHHHHHHHHHHHHLLLLLLLLLLLLEEEELLL


DSSP  LlLLLHHHHHHHHHHHHHHHHHLLLEEEELHHH-LLHHHHHHHHHHLLLLHHHEEELLLL
Query EgKITPLEEKVFIAAALAHNQTGRPISTHTSFS-TMGLEQLALLQAHGVDLSRVTVGHCD  187
ident     |  |||    || |   || |   |           | |    | ||      |  
Sbjct S-DFTAEEEKSLRGAARAQVRTGLPLXVHLPGWfRLAHRVLDLVEEEGADLRHTVLCHXN  239
DSSP  L-LLLHHHHHHHHHHHHHHHHHLLLEEELLLLLlLLHHHHHHHHHHLLLLHHHEEELLLH


DSSP  LL-LLHHHHHHHHHLLLEEEELLLLLLL--------LLLHHHHHHHHHHHHHLLLHHHEE
Query LK-DNLDNILKMIDLGAYVQFDTIGKNS--------YYPDEKRIAMLHALRDRGLLNRVM  238
ident                ||   || ||              |         | | | | |  
Sbjct PShXDPVYQATLAQRGAFLEFDXIGXDFfyadqgvqCPSDDEVARAILGLADHGYLDRIL  299
DSSP  HHlLLHHHHHHHHHHLLEEEELLLLLLLeelllleeLLLHHHHHHHHHHHHHLLLHHHEE


DSSP  ELLLLLLHHHLHHHLLLLLLHHHHLHHHHHHHLLLLHHHHHHHHLHHHHHHLL------
Query LSMDITRRSHLKANGGYGYDYLLTTFIPQLRQSGFSQADVDVMLRENPSQFFQ------  291
ident || |      |   || ||      | | ||  |   |        ||   |       
Sbjct LSHDVFVKXXLTRYGGNGYAFVTKHFLPRLRRHGLDDAALETLXVTNPRRVFDasiegh  358
DSSP  ELLLLLLHHHLHHHLLLLLLHHHHLHHHHHHHLLLLHHHHHHHHLHHHHHHHLllllll


No 3: Query=1bf6A Sbjct=2ob3A Z-score=36.8

back to top
DSSP  --------LLLLL--LEEEEEELLLEEL----hhhHLLHhheelLHHHHHHHHHHHHHLL
Query --------SFDPT--GYTLAHEHLHIDL----sgfKNNVdcrldQYAFICQEMNDLMTRG   46
ident                | || |||                                    |
Sbjct drintvrgPITISeaGFTLTHEHICGSSagflrawPEFFgsrkaLAEKAVRGLRRARAAG   60
DSSP  lleeelleEELHHhhLLEEEEELLEELLllhhhhlHHHHllhhhHHHHHHHHHHHHHHLL


DSSP  EEEEEELLLHHHLLLHHHHHHHHHHHLLEEEEEELLLLhhHLLLHHHHLLHHHHHHHHHH
Query VRNVIEMTNRYMGRNAQFMLDVMRETGINVVACTGYYQdaFFPEHVATRSVQELAQEMVD  106
ident ||          ||       | |      || ||       |     ||| || |    
Sbjct VRTIVDVSTFDIGRDVSLLAEVSRAADVHIVAATGLWF--DPPLSMRLRSVEELTQFFLR  118
DSSP  LLEEEELLLHHHLLLHHHHHHHHHHHLLEEELEEELLL--LLLHHHHLLLHHHHHHHHHH


DSSP  HHHLLLLLLLLLEEEEEeEELLLlLLLHHHHHHHHHHHHHHHHHLLLEEEELHHH-LLHH
Query EIEQGIDGTELKAGIIAeIGTSEgKITPLEEKVFIAAALAHNQTGRPISTHTSFS-TMGL  165
ident ||  ||  |   ||||    |   | ||  | |  ||| |   || |  |||  |   | 
Sbjct EIQYGIEDTGIRAGIIX-VATTG-KATPFQELVLKAAARASLATGVPVTTHTAASqRDGE  176
DSSP  HHHLLLLLLLLLLLEEE-EELLL-LLLHHHHHHHHHHHHHHHHHLLLEEEELLHHhLHHH


DSSP  HHHHHHHHLLLLHHHEEELLLLLLLLHHHHHHHHHLLLEEEELLLLLL------------
Query EQLALLQAHGVDLSRVTVGHCDLKDNLDNILKMIDLGAYVQFDTIGKN------------  213
ident  | |     |   |||  || |  | |         |     | |               
Sbjct QQAAIFESEGLSPSRVCIGHSDDTDDLSYLTALAARGYLIGLDHIPYSaiglednasasa  236
DSSP  HHHHHHHHLLLLHHHEEELLHHHLLLHHHHHHHHHLLLEEEELLLLLLlllllllhhhhh


DSSP  --LLLLHHHHHHHHHHHHHLLLHHHEEELLLLL----------LHHHlhhHLLL--LLLH
Query --SYYPDEKRIAMLHALRDRGLLNRVMLSMDIT----------RRSHlkaNGGY--GYDY  259
ident          |     || | |       | | |                       |   
Sbjct llGIRSWQTRALLIKALIDQGYMKQILVSNDWTfgfssyvtniMDVM---DRVNpdGMAF  293
DSSP  hhLLLLHHHHHHHHHHHHHLLLHHHEEELLLLLleellllllhHHHH---HHHLllHHHH


DSSP  HHHLHHHHHHHLLLLHHHHHHHHLHHHHHHLL----
Query LLTTFIPQLRQSGFSQADVDVMLRENPSQFFQ----  291
ident      || ||  |  |         ||  |      
Sbjct IPLRVIPFLREKGVPQETLAGITVTNPARFLSptlr  329
DSSP  HHHLHHHHHHHLLLLHHHHHHHHLHHHHHHHLllll


No 4: Query=1bf6A Sbjct=2vc5A Z-score=36.6

back to top
DSSP  ----------LLLLL-LEEEEEELLLEELHHHHL---lhhheelLHHHHHHHHHHHHHLL
Query ----------SFDPT-GYTLAHEHLHIDLSGFKN---nvdcrldQYAFICQEMNDLMTRG   46
ident                 | || ||||                          |    |  |
Sbjct mriplvgkdsIESKDiGFTLIHEHLRVFSEAVRQqwphlynedeEFRNAVNEVKRAMQFG   60
DSSP  llllllllllLLHHHlLLEELLLLLLLLLHHHHHhlhhhllhhhHHHHHHHHHHHHHHLL


DSSP  EEEEEELLLHHHLLLHHHHHHHHHHHLLEEEEEELLLLHHHLLLHHHHLLHHHHHHHHHH
Query VRNVIEMTNRYMGRNAQFMLDVMRETGINVVACTGYYQDAFFPEHVATRSVQELAQEMVD  106
ident |      |    ||   ||  |   |||| || || |     |     ||  | |     
Sbjct VKTIVDPTVMGLGRDIRFMEKVVKATGINLVAGTGIYIYIDLPFYFLNRSIDEIADLFIH  120
DSSP  LLEEEELLLLLLLLLHHHHHHHHHLLLLEEEELEELLLLLLLLHHHLLLLHHHHHHHHHH


DSSP  HHHLLLLLLLLLEEEEEeEELLLLLLLHHHHHHHHHHHHHHHHHLLLEEEELHHH-LLHH
Query EIEQGIDGTELKAGIIAeIGTSEGKITPLEEKVFIAAALAHNQTGRPISTHTSFS-TMGL  165
ident  |  || ||  |||    |   |  ||   |||  ||| |   |  || ||       ||
Sbjct DIKEGIQGTLNKAGFVX-IAADEPGITKDVEKVIRAAAIANKETKVPIITHSNAHnNTGL  179
DSSP  HHHLLLLLLLLLLLLEE-EELLLLLLLHHHHHHHHHHHHHHHHHLLLEEEELLLLlLHHH


DSSP  HHHHHHHHLLLLHHHEEELLLLLLLLHHHHHHHHHLLLEEEELLLLLLLLLLHHHHHHHH
Query EQLALLQAHGVDLSRVTVGHCDLKDNLDNILKMIDLGAYVQFDTIGKNSYYPDEKRIAML  225
ident ||   |   |||      ||    || | | |  | |     |  |     |  ||    
Sbjct EQQRILTEEGVDPGKILIGHLGDTDNIDYIKKIADKGSFIGLDRYGLDLFLPVDKRNETT  239
DSSP  HHHHHHHHLLLLHHHEEELLHHHLLLHHHHHHHHHLLLEEEELLLLLLLLLLHHHHHHHH


DSSP  HHHHHLLLHHHEEELLLLLLH---hhlhHHLL------LLLLHHHHLHHHHHHHLLLLHH
Query HALRDRGLLNRVMLSMDITRR---shlkANGG------YGYDYLLTTFIPQLRQSGFSQA  276
ident   |   |     | | |                               || |   |    
Sbjct LRLIKDGYSDKIMISHDYCCTidwgtakPEYKpklaprWSITLIFEDTIPFLKRNGVNEE  299
DSSP  HHHHHLLLLLLEEELLLLLLLlllllllHHHHhhhlllLLLLHHHHLHHHHHHLLLLLHH


DSSP  HHHHHHLHHHHHHLL
Query DVDVMLRENPSQFFQ  291
ident        |||  || 
Sbjct VIATIFKENPKKFFS  314
DSSP  HHHHHHLHHHHHHLL


No 5: Query=1bf6A Sbjct=2y1hB Z-score=21.0

back to top
DSSP  llllLLEEEEEELLLEelhhhhllhhhEELLhHHHHHHHHHHHHLLEEEEEELLLHHHLL
Query sfdpTGYTLAHEHLHIdlsgfknnvdcRLDQyAFICQEMNDLMTRGVRNVIEMTNRYMGR   60
ident      |    | ||                                |             
Sbjct ---gVGLVDCHCHLSA-----------PDFD-RDLDDVLEKAKKANVVALVAVAEHSGEF   45
DSSP  ---lLLEEEEEELLLL-----------HHHL-LLHHHHHHHHHHLLEEEEEELLLLHHHH


DSSP  --LHHHHHHHHhhhlLEEEEEELLLLH-----HHLLLHHhhllhHHHHHHHHHHHHllll
Query --NAQFMLDVMretgINVVACTGYYQD-----AFFPEHVatrsvQELAQEMVDEIEqgid  113
ident     |            |  | |                                     
Sbjct ekIMQLSERYN----GFVLPCLGVHPVqgldqRSVTLKD----lDVALPIIENYKD----   93
DSSP  hhHHHHHHHLL----LLEEEEELLLLEellllEELLHHH----hHHHHHHHHHHLL----


DSSP  llllLEEEEEEEELLLL-------llLHHHHHHHHHHHHHHHHHLLLEEEELHhhLLHHH
Query gtelKAGIIAEIGTSEG-------kiTPLEEKVFIAAALAHNQTGRPISTHTSfsTMGLE  166
ident         | | |                   | |           |   |      |  
Sbjct ----RLLAIGEVGLDFSprfagtgeqKEEQRQVLIRQIQLAKRLNLPVNVHSR--SAGRP  147
DSSP  ----LLLEEEEEEEELLllllllhhhHHHHHHHHHHHHHHHHHHLLLEEEEEE--LLHHH


DSSP  HHHHHHHLLLLhhHEEELLLLlllLHHHHHHHHHLLLEEEELlLLLLlllLHHHHHHHHH
Query QLALLQAHGVDlsRVTVGHCDlkdNLDNILKMIDLGAYVQFDtIGKNsyyPDEKRIAMLH  226
ident    |||  |     |     |              |                        
Sbjct TINLLQEQGAE--KVLLHAFD--gRPSVAMEGVRAGYFFSIP-PSII---RSGQKQKLVK  199
DSSP  HHHHHHHLLLL--LEEEELLL--lLHHHHHHHHHLLLEEEEL-HHHH---LLHHHHHHHH


DSSP  HHhhllLHHHEEELLLLL-----lHHHLhhhlllLLLHHHhLHHHHHHHL-LLLHHHH-H
Query ALrdrgLLNRVMLSMDIT-----rRSHLkanggyGYDYLLtTFIPQLRQS-GFSQADV-D  279
ident  |     |    |  |                                |  | |   |  
Sbjct QL----PLTSICLETDSPalgpekQVRN------EPWNIS-ISAEYIAQVkGISVEEViE  248
DSSP  HL----LHHHEEELLLLLllllllLLLL------LHHHHH-HHHHHHHHHhLLLHHHHhH


DSSP  HHHlHHHHHHLL------
Query VMLrENPSQFFQ------  291
ident |    |    |       
Sbjct VTT-QNALKLFPklrhll  265
DSSP  HHH-HHHHHHLLlhhhhl


No 6: Query=1bf6A Sbjct=1onxA Z-score=20.1

back to top
DSSP  ---------------------------------------------------------lll
Query ---------------------------------------------------------sfd    3
ident                                                             
Sbjct midytaagftllqgahlyapedrgicdvlvangkiiavasnipsdivpnctvvdlsgqil   60
DSSP  llllhhhlleeeeeeeeellleeeeeeeeeelleeeeeellllllllllleeeellllee


DSSP  lLLEEEEEELLLEELHhHHLLHHHEELlhhhHHHHHHHHhhlLEEEEEELL---lhHHLL
Query pTGYTLAHEHLHIDLSgFKNNVDCRLDqyafICQEMNDLmtrGVRNVIEMT---nrYMGR   60
ident   |    | ||                               ||  |             
Sbjct cPGFIDQHVHLIGGGG-EAGPTTRTPE---vALSRLTEA---GVTSVVGLLgtdsiSRHP  113
DSSP  eELEEEEEELLLLLLL-LLLHHHLLLL---lLHHHHHHL---LEEEEEELLlllllLLLH


DSSP  --LHHHHHHHHHHhLLEEEEEELLLLHhhlllhhhhllhhhhhHHHHHHHHLLlllllLL
Query --NAQFMLDVMREtGINVVACTGYYQDaffpehvatrsvqelaQEMVDEIEQGidgteLK  118
ident             | ||     || |                                   
Sbjct esLLAKTRALNEE-GISAWMLTGAYHV----------psrtitGSVEKDVAII-----DR  157
DSSP  hhHHHHHHHHHHH-LLEEEEEEELLLL----------llllllLLHHHHHHHL-----LL


DSSP  EEEEEeEELLLLlLLHHHHHHHHHHHHHHHHHL------LLEEEELHHhLLHHHHHHHHH
Query AGIIAeIGTSEGkITPLEEKVFIAAALAHNQTG------RPISTHTSFsTMGLEQLALLQ  172
ident          |               |      |           |       |     | 
Sbjct VIGVX-CAISDHrSAAPDVYHLANMAAESRVGGllggkpGVTVFHMGDsKKALQPIYDLL  216
DSSP  EEEEE-EEELLLlLLLLLHHHHHHHHHHHHHHHhhhlllLEEEEEELLlLLLLHHHHHHH


DSSP  H-LLLLHHHEEELLLLLLL-LHHHHHHHHHLLLEEEELlLLLLlLLLHhhHHHHHHHHHH
Query A-HGVDLSRVTVGHCDLKD-NLDNILKMIDLGAYVQFDtIGKNsYYPDekRIAMLHALRD  230
ident     |  |     |           |     |                            
Sbjct EnCDVPISKLLPTHVNRNVpLFEQALEFARKGGTIDIT-SSID-EPVA--PAEGIARAVQ  272
DSSP  HlLLLLHHHEEEELHHHLHhHHHHHHHHHHLLLLEEEE-LLLL-LLLL--HHHHHHHHHH


DSSP  LLL-HHHEEELLLLLL-------------HHHLhhhlllLLLHHHhLHHHHHHH-LLLLH
Query RGL-LNRVMLSMDITR-------------RSHLkanggyGYDYLLtTFIPQLRQ-SGFSQ  275
ident  |  | || || |                          |   ||      |     || 
Sbjct AGIpLARVTLSSDGNGsqpffddegnlthIGVA------GFETLL-ETVQVLVKdYDFSI  325
DSSP  LLLlHHHEEEELLLLLeeeeellllleeeEEEL------LLHHHH-HHHHHHHHhHLLLH


DSSP  HHHHHHHLHHHHHHLL--------------------------------------------
Query ADVDVMLRENPSQFFQ--------------------------------------------  291
ident  |    |      |                                              
Sbjct SDALRPLTSSVAGFLNltgkgeilpgndadllvmtpelrieqvyargklmvkdgkacvkg  385
DSSP  HHHHHHHLHHHHHHLLlllllllllllllleeeellllleeeeeelleeeeelleellll


DSSP  -----
Query -----  291
ident      
Sbjct tfetd  390
DSSP  lllll


No 7: Query=1bf6A Sbjct=3mkvA Z-score=18.5

back to top
DSSP  ----------------------------------------------------llllLLEE
Query ----------------------------------------------------sfdpTGYT    8
ident                                                          |  
Sbjct lttflfrngalldpdhpdllqgfeiliedgfirevsdkpikssnahvidvkgktimPGLI   60
DSSP  lleeeeeeeeelllllllleeeeeeeeelleeeeeellllllllleeeelllleeeELEE


DSSP  EEEELLLE---ELHHHHLLHhheelLHHHHHHHHHHHHHLLEEEEEELLLhhhlLLHHHH
Query LAHEHLHI---DLSGFKNNVdcrldQYAFICQEMNDLMTRGVRNVIEMTNrymgRNAQFM   65
ident   | |       |                    |     ||   |             | 
Sbjct DLHVHVVAiefNLPRVATLP--nvlVTLRAVPIMRAMLRRGFTTVRDAGG----AGYPFK  114
DSSP  EEEELLLLlllLHHHHLLLL--hhhHHHHHHHHHHHHHHLLEEEEEELLL----LLHHHH


DSSP  HHHH--HHHLLEEEEE-ELLLLHH--HLLL---------------------hhhhLLHHH
Query LDVM--RETGINVVAC-TGYYQDA--FFPE---------------------hvatRSVQE   99
ident   |      |           |      |                            | |
Sbjct QAVEsgLVEGPRLFVSgRALSQTGghADPRarsdymppdspcgccvrvgalgrvaDGVDE  174
DSSP  HHHHllLLLLLEEEELlLEEELLLllLLLLllllllllllllllllllllleeelLLHHH


DSSP  HHHHHHHHHHLlllllllLEEEEEEEELL--------LLLLlhHHHHHHHHHHHHHHHHL
Query LAQEMVDEIEQgidgtelKAGIIAEIGTS--------EGKItpLEEKVFIAAALAHNQTG  151
ident        |           |  |               |      |    |        |
Sbjct VRRAVREELQM-------GADQIXIMASGgvasptdpVGVF-gYSEDEIRAIVAEAQGRG  226
DSSP  HHHHHHHHHHH-------LLLLEEEELLLllllllllLLLL-lLLHHHHHHHHHHHHLLL


DSSP  LLEEEELHHHLLHHHHHHHHhhllllhhhEEELLLLlLLLHHHHHHHHHLLLEEEELLLL
Query RPISTHTSFSTMGLEQLALLqahgvdlsrVTVGHCDlKDNLDNILKMIDLGAYVQFDTIG  211
ident      |                        |  |                ||||      
Sbjct TYVLAHAYTPAAIARAVRCG--------vRTIEHGN-LIDDETARLVAEHGAYVVPTLVT  277
DSSP  LLEEEEELLHHHHHHHHHLL--------lLEEEELL-LLLHHHHHHHHHHLLEEELLHHH


DSSP  LL-------------------LLLLhHHHHHHHHHHHhLLLHhHEEELLLLLLhhhlhhh
Query KN-------------------SYYPdEKRIAMLHALRdRGLLnRVMLSMDITRrshlkan  252
ident                                       |          |          
Sbjct YDalasegekyglppesiakiADVH-GAGLHSIEIMK-RAGV-KMGFGTDLLG-------  327
DSSP  HHhhhhhlllllllhhhhllhHHHH-LLHHHHHHHHH-HHLL-LLLLLLLLLH-------


DSSP  lLLLLlHHHHlHHHHHHhLLLLHHHHHHHHLHHHHHHLL---------------------
Query gGYGYdYLLTtFIPQLRqSGFSQADVDVMLRENPSQFFQ---------------------  291
ident                |     | | |                                  
Sbjct -EAQR-LQSD-EFRILA-EVLSPAEVIASATIVSAEVLGmqdklgrivpgahadvlvvdg  383
DSSP  -HHHH-HLLH-HHHHHH-LLLLHHHHHHHLLHHHHHHLLllllllllllllllleeeell


DSSP  -------------------------------
Query -------------------------------  291
ident                                
Sbjct nplksvdcllgqgehiplvmkdgrlfvnele  414
DSSP  llllllllllllllllleeeelleeeeelll


No 8: Query=1bf6A Sbjct=3cjpA Z-score=18.4

back to top
DSSP  lllllLEEEEEELLLeelhhhhllhhheeLLHHHHHHHHHHHHhllEEEEEELL------
Query sfdptGYTLAHEHLHidlsgfknnvdcrlDQYAFICQEMNDLMtrgVRNVIEMT------   54
ident           | |                         |       |   |         
Sbjct -----LIIDGHTHVI--------------LPVEKHIKIMDEAG---VDKTILFStsihpe   38
DSSP  -----LLEEEEEELL--------------LLHHHHHHHHHHHL---LLEEEEELllllhh


DSSP  ----------------------------lHHHLL--LHHHHHHHHhhhlLEEEEEELLLL
Query ----------------------------nRYMGR--NAQFMLDVMretgINVVACTGYYQ   84
ident                              |                      |       
Sbjct tavnlrdvkkemkklndvvngktnsmidvRRNSIkeLTNVIQAYP----SRYVGFGNVPV   94
DSSP  hlllhhhhhhhhhhhhhhhlllllllhhhHHHHHhhHHHHHHHLL----LLEEEEELLLL


DSSP  HhhlllhhhhLLHHHHHHHHHHHHHLLllllllLEEEEEEEELlLLLLlhhHHHHhHHHH
Query DaffpehvatRSVQELAQEMVDEIEQGidgtelKAGIIAEIGTsEGKItplEEKVfIAAA  144
ident            |           |         |   | |                    
Sbjct G---------LSENDTNSYIEENIVNN------KLVGIGELTP-ASGQ---IKSL-KPIF  134
DSSP  L---------LLHHHHHHHHHHHLLLL------LLLEEEEELL-LLLL---HHHH-HHHH


DSSP  HHHHHH-LLLEEEELHHHL---LHHHHHHHHHHlLLLHhHEEELLLLLLLLHHHHHHHHH
Query LAHNQT-GRPISTHTSFST---MGLEQLALLQAhGVDLsRVTVGHCDLKDNLDNILKMID  200
ident          ||  |           |   |  |       |  ||               
Sbjct KYSMDSgSLPIWIHAFNPLvlqDIKEIAELCKA-FPKV-PVILGHMGGSNWMTAVELAKE  192
DSSP  HHHHHLlLLLEEELLLLLLlhhHHHHHHHHHHH-LLLL-LEEEHHHHHHHHHHHHHHHHH


DSSP  LL-LEEEELLLlllllLLHHHHHHHHHHHhhlllHHHEEELLLLLLhhhlhhhlllLLLH
Query LG-AYVQFDTIgknsyYPDEKRIAMLHALrdrglLNRVMLSMDITRrshlkanggyGYDY  259
ident     |                       |             |                 
Sbjct IQnLYLDTSAY-----FSTFVLKIVINEL-----PLKCIFGTDMPF---------gDLQL  233
DSSP  LLlEEEELLLL-----LLHHHHHHHHHHL-----LLLEELLLLLLL---------lLHHH


DSSP  HHhLHHHHHHhllLLHHHHHHHHLHHHHHHLL-
Query LLtTFIPQLRqsgFSQADVDVMLRENPSQFFQ-  291
ident      |                |  | |     
Sbjct SI-EAIKKMS---NDSYVANAVLGDNISRLLNi  262
DSSP  HH-HHHHHHL---LLHHHHHHHHLHHHHHHHLl


No 9: Query=1bf6A Sbjct=3gg7A Z-score=18.2

back to top
DSSP  lllllLEEEEEELLLEelhhhhllhhheELLHHHHHHHHHHHHhlleEEEEELL-LHHH-
Query sfdptGYTLAHEHLHIdlsgfknnvdcrLDQYAFICQEMNDLMtrgvRNVIEMT-NRYM-   58
ident           | ||                                   |   |      
Sbjct -----SLIDFHVHLDL------------YPDPVAVARACEERQ----LTVLSVTtTPAAw   39
DSSP  -----LLEEEEELHHH------------LLLHHHHHHHHHHLL----LEEEELLlLHHHh


DSSP  lLLHHHHHHHHhhhllEEEEEELLLLHhHLLLHHHhllhhhhhHHHHHHHHllllllllL
Query gRNAQFMLDVMretgiNVVACTGYYQDaFFPEHVAtrsvqelaQEMVDEIEqgidgtelK  118
ident                  |    |        |  |                         
Sbjct rGTLALAAGRP-----HVWTALGFHPE-VVSERAA------dlPWFDRYLP--------E   79
DSSP  hHHHHHHLLLL-----LEEELLLLLHH-HLLLLHH------hlHHHHHHHH--------H


DSSP  EEEEEEEELLLL----llLHHHHHHHHHHHHHHHHH-LLLEEEELHhhLLHHHHHHHHHH
Query AGIIAEIGTSEG----kiTPLEEKVFIAAALAHNQT-GRPISTHTSfsTMGLEQLALLQA  173
ident      | |                ||           ||  | |        | |  | |
Sbjct TRFVGEVGLDGSpslrgtWTQQFAVFQHILRRCEDHgGRILSIHSR--RAESEVLNCLEA  137
DSSP  LLEEEEEELLLLhhhhhhHHHHHHHHHHHHHHHHHLlLEEEEEELL--LLHHHHHHHHHH


DSSP  LLLlhhHEEELLLLlllLHHHHHHHHHLLLEEEeLLLLlllllLHHHHHHHHHHHhhllL
Query HGVdlsRVTVGHCDlkdNLDNILKMIDLGAYVQfDTIGknsyyPDEKRIAMLHALrdrgL  233
ident                          | ||                 |  |          
Sbjct NPR-sgTPILHWYS--gSVTELRRAISLGCWFS-VGPT---mvRTQKGAALIRSM----P  186
DSSP  LHH-heEEEEELLL--lLHHHHHHHHHLLLEEE-ELHH---hhLLHHHHHHHHHL----L


DSSP  HHHEEELLLLLLhhhlhhhLLLLL-LHHHhLHHHHHHH-LLLL-HHHHHHHhLHHHHHHL
Query LNRVMLSMDITRrshlkanGGYGY-DYLLtTFIPQLRQ-SGFS-QADVDVMlRENPSQFF  290
ident   ||    |          |               |                 || |   
Sbjct RDRVLTETDGPF---leldGQAALpWDVK-SVVEGLSKiWQIPaSEVERIV-KENVSRLL  241
DSSP  HHHEEELLLLLL---leelLEELLhHHHH-HHHHHHHHhHLLLhHHHHHHH-HHHHHHHH


DSSP  L-
Query Q-  291
ident   
Sbjct Gt  243
DSSP  Hl


No 10: Query=1bf6A Sbjct=1gkpA Z-score=18.1

back to top
DSSP  -----------------------------------------------llllLLEEEEEEL
Query -----------------------------------------------sfdpTGYTLAHEH   13
ident                                                     |    | |
Sbjct pllikngeiitadsrykadiyaegetitrigqnleappgtevidatgkyvfPGFIDPHVH   60
DSSP  leeeelleeeelleeeeleeeelllllleeellllllllleeeelllleeeELEEEEEEL


DSSP  LLEELHHhhllhhHEELLHhhHHHHHHHHHHLLEEEEEELLLHH--------hllLHHHH
Query LHIDLSGfknnvdCRLDQYafICQEMNDLMTRGVRNVIEMTNRY--------mgrNAQFM   65
ident                                 |    |||                    
Sbjct IYLPFMA------TFAKDT--HETGSKAALMGGTTTYIEMCCPSrnddalegyqlWKSKA  112
DSSP  LLLEELL------EELLLL--HHHHHHHHHHLLEEEEEEEELLLllllhhhhhhhHHHHH


DSSP  HHHHhhhLLEEEEEELLLlhhhlllhhhhllHHHHHHHHHHHHHLlllllllLEEEEEeE
Query LDVMretGINVVACTGYYqdaffpehvatrsVQELAQEMVDEIEQgidgtelKAGIIAeI  125
ident                                                            |
Sbjct EGNS---YCDYTFHMAVS-----------kfDEKTEGQLREIVAD-------GISSFX-I  150
DSSP  LLLL---LLEEEEEEELL-----------llLLLHHHHHHHHHHL-------LLLEEE-E


DSSP  ELLLllllhHHHHHHHHHHHHHHHHLLLEEEELH--------------------------
Query GTSEgkitpLEEKVFIAAALAHNQTGRPISTHTS--------------------------  159
ident   |                      |     |                            
Sbjct FLSYknffgVDDGEMYQTLRLAKELGVIVTAHCEnaelvgrlqqkllsegktgpewheps  210
DSSP  EELLlllllLLHHHHHHHHHHHHHHLLEEEEEELlhhhhhhhhhhhhhlllllhhhllll


DSSP  -----HHLLHHHHHHHHHHLLLlhhHEEELLLLlllLHHHHHHHHHLL-----LEEEELL
Query -----FSTMGLEQLALLQAHGVdlsRVTVGHCDlkdNLDNILKMIDLG-----AYVQFDT  209
ident                 |   |       | |                       |     
Sbjct rpeavEAEGTARFATFLETTGA---TGYVVHLS---CKPALDAAMAAKargvpIYIESVI  264
DSSP  llhhhHHHHHHHHHHHHHHHLL---EEEELLLL---LHHHHHHHHHHHhllllEEEEEEH


DSSP  L--LLLL-----------------LLLHHHHHHHHHHHHhllLHHHEEELLLLLLHH---
Query I--GKNS-----------------YYPDEKRIAMLHALRdrgLLNRVMLSMDITRRS---  247
ident                            |      |                |        
Sbjct PhfLLDKtyaerggveamkyimspPLRDKRNQKVLWDAL--aQGFIDTVGTDHCPFDteq  322
DSSP  HhhHLLHhhhhllhhhhhllllllLLLLLHHHHHHHHHH--hLLLLLEEELLLLLLLhhh


DSSP  --------hlhhhllLLLLHHHHLHHHHHH-HLLLLHHHHHHHHLHHHHHHLL-------
Query --------hlkanggYGYDYLLTTFIPQLR-QSGFSQADVDVMLRENPSQFFQ-------  291
ident                                                    |        
Sbjct kllgkeaftaipngiPAIEDRVNLLYTYGVsRGRLDIHRFVDAASTKAAKLFGlfprkgt  382
DSSP  hhhhlllhhhlllllLLLLLHHHHHHHHHLlLLLLLHHHHHHHHLHHHHHHLLlllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  291
ident                                                             
Sbjct iavgsdadlvvydpqyrgtisvktqhvnndyngfegfeidgrpsvvtvrgkvavrdgqfv  442
DSSP  lllllllleeeeelllleellhhhllllllllllllleelleeeeeeelleeeeelleel


DSSP  ----------------
Query ----------------  291
ident                 
Sbjct gekgwgkllrrepmyf  458
DSSP  llllllllllllllll


No 11: Query=1bf6A Sbjct=3giqA Z-score=17.9

back to top
DSSP  ---------------------------------------------------llllLLEEE
Query ---------------------------------------------------sfdpTGYTL    9
ident                                                         |   
Sbjct ekldfkitggwiidgtgaprrradlgvrdgriaaigelgahparhawdasgkivaPGFID   60
DSSP  lleeeeeelleelllllllleeleeeeelleeeeeelllllleeeeeelllleeeELEEE


DSSP  EEELLLEelhhhhllhhheeLLHHHHHhhHHHHHHLLEEEEEEL----LLHH--------
Query AHEHLHIdlsgfknnvdcrlDQYAFICqeMNDLMTRGVRNVIEM----TNRY--------   57
ident  | |                                |   |                   
Sbjct VHGHDDL-------------MFVEKPD--LRWKTSQGITTVVVGncgvSAAPaplpgnta  105
DSSP  LLLLLLL-------------HHHHLLL--LHHHHLLLEEEEEELllllLLLLllllllll


DSSP  --------------hllLHHHH-HHHHhhhLLEEEEEELLLlhhhLLLH-----HHHL-L
Query --------------mgrNAQFM-LDVMretGINVVACTGYYqdafFPEH-----VATR-S   96
ident                                ||| |  |                 |   
Sbjct aalallgetplfadvpaYFAALdAQRP---MINVAALVGHA-nlrLAAMrdpqaAPTAaE  161
DSSP  hhhhhhllllllllhhhHHHHHhHLLL---LLEEEEEEEHH-hhhHHHLlllllLLLHhH


DSSP  HHHHHHHHHHHHHLlllllllLEEEEEeEELLLlllLHHHHHHHHHHHHHHHHHLLLEEE
Query VQELAQEMVDEIEQgidgtelKAGIIAeIGTSEgkiTPLEEKVFIAAALAHNQTGRPIST  156
ident  |          |         |      |                 |       |    
Sbjct QQAMQDMLQAALEA-------GAVGFS-TGLAYqpgAVAQAAELEGLARVAAERRRLHTS  213
DSSP  HHHHHHHHHHHHHH-------LLLEEE-EELLLllhHHLLHHHHHHHHHHHHHLLLEEEE


DSSP  ELHHH-----LLHHHHHHHHHHLLLlhhHEEELLLLLL------LLHHHHHHHHHLL---
Query HTSFS-----TMGLEQLALLQAHGVdlsRVTVGHCDLK------DNLDNILKMIDLG---  202
ident |             | ||     |       | |                          
Sbjct HIRNEadgveAAVEEVLAIGRGTGC---ATVVSHHKCMmpqnwgRSRATLANIDRAReqg  270
DSSP  ELLLLlllhhHHHHHHHHHHHHHLL---EEEELLLLLLlhhhllLHHHHHHHHHHHHhll


DSSP  --LEEEElLLLLL-----------------------------------------------
Query --AYVQFdTIGKN-----------------------------------------------  213
ident                                                             
Sbjct veVALDI-YPYPGsstiliperaetiddiritwstphpecsgeyladiaarwgcdkttaa  329
DSSP  llEEEEE-LLLLEeeeellhhhllllllleeeeelllhhhllllhhhhhhhhlllhhhhh


DSSP  ----------LLLLHHHHHHHHHhhhhlllHHHEEELLLLLLHHhlhhHLLLL-LLHHHH
Query ----------SYYPDEKRIAMLHalrdrglLNRVMLSMDITRRShlkaNGGYG-YDYLLT  262
ident                                   |   |                    |
Sbjct rrlapagaiyFAMDEDEVKRIFQ-------HPCCMVGSDGLPND----ARPHPrLWGSFT  378
DSSP  hhhlleeeeeELLLHHHHHHHHH-------LLLEEELLLLLLLL----LLLLLhHHHHHH


DSSP  LHHHHH-HHLL-LLHHHHHHHHLHHHHHHLL-----------------------------
Query TFIPQL-RQSG-FSQADVDVMLRENPSQFFQ-----------------------------  291
ident        |                 |   |                              
Sbjct RVLGRYvREARlMTLEQAVARMTALPARVFGfaergvlqpgawadvvvfdpdtvadratw  438
DSSP  HHHHHHhHHLLlLLHHHHHHHHLHHHHHHHLlllllllllllllleeeelllllllllll


DSSP  -------------------------------------
Query -------------------------------------  291
ident                                      
Sbjct deptlasvgiagvlvngaevfpqppadgrpgqvlrax  475
DSSP  llllllllleeeeeelleeeellllllllllllllll


No 12: Query=1bf6A Sbjct=3ls9A Z-score=17.8

back to top
DSSP  ----------------------------------------------------llllLLEE
Query ----------------------------------------------------sfdpTGYT    8
ident                                                          |  
Sbjct milirgltrvitfddqereledadilidgpkivavgkdlsdrsvsrtidgrgmialPGLI   60
DSSP  leeeeeeeeeellllllleeeeeeeeeelleeeeeellllllllleeeellleeeeELEE


DSSP  EEEELLLE--------------------ELHHHHLLH----hheeLLHHHHHHHHHHHHH
Query LAHEHLHI--------------------DLSGFKNNV----dcrlDQYAFICQEMNDLMT   44
ident   | ||                       |                              
Sbjct NSHQHLYEgamraipqlervtmaswlegVLTRSAGWWrdgkfgpdVIREVARAVLLESLL  120
DSSP  EEEELHHHhhhlllhhhllllhhhhhhhHHHHHHHHHhlllllhhHHHHHHHHHHHHHHH


DSSP  LLEEEEEELLLHH----hllLHHHHHHHHHHHLLEEEEEELLLLHH----------HLLL
Query RGVRNVIEMTNRY----mgrNAQFMLDVMRETGINVVACTGYYQDA----------FFPE   90
ident  |   |                          ||   |                  |   
Sbjct GGITTVADQHLFFpgatadsYIDATIEAATDLGIRFHAARSSMTLGkseggfcddlFVEP  180
DSSP  LLEEEEEEEELLLlllllllHHHHHHHHHHHHLLEEEEEELLLLLLhhhlllllhhHLLL


DSSP  hhhhllHHHHHHHHHHHHHLL--lllllllEEEEEEEELLlllllhhHHHHHHHHHHHHH
Query hvatrsVQELAQEMVDEIEQG--idgtelkAGIIAEIGTSegkitplEEKVFIAAALAHN  148
ident       |    |     | |                 |             | | |    
Sbjct ------VDRVVQHCLGLIDQYhepepfgmvRIALGPCGVP-----ydKPELFEAFAQMAA  229
DSSP  ------HHHHHHHHHHHHHHHlllllllleEEEELLLLLL-----llLHHHHHHHHHHHH


DSSP  HHLLLEEEELHH------------hLLHHHHHHHHHhllllHHHEEELLLLlLLLHHHHH
Query QTGRPISTHTSF------------sTMGLEQLALLQahgvdLSRVTVGHCDlKDNLDNIL  196
ident        ||                |                 ||   |         | 
Sbjct DYDVRLHTHFYEpldagmsdhlygmTPWRFLEKHGW----aSDRVWLAHAV-VPPREEIP  284
DSSP  HHLLEEEEEELLllhhhhhhhhhllLHHHHHHHLLL----lLLLEEEEELL-LLLHHHHH


DSSP  HHHHLLLEEEElLLLL--LLLLLHhhhhhHHHHHHhLLLHhHEEELLLLLLhhhlhhhll
Query KMIDLGAYVQFdTIGK--NSYYPDekriaMLHALRdRGLLnRVMLSMDITRrshlkangg  254
ident    | |       |                            |                 
Sbjct EFADAGVAIAH-LIAPdlRMGWGL----aPIREYL-DAGI-TVGFGTTGSA-------sn  330
DSSP  HHHHHLLEEEE-LHHHhhHLLLLL----lLHHHHH-HLLL-EEEELLLLLL-------ll


DSSP  LLLLhHHHLhHHHHHHL-----------LLLHHHHHHHHLHHHHHHLL------------
Query YGYDyLLTTfIPQLRQS-----------GFSQADVDVMLRENPSQFFQ------------  291
ident  |   ||                       |      |                      
Sbjct DGGN-LLGD-LRLAALAhrpadpnepekWLSARELLRMATRGSAECLGrpdlgvleegra  388
DSSP  LLLL-HHHH-HHHHHHHlhhhllllhhhLLLHHHHHHHLLHHHHHHLLllllllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  291
ident                                                             
Sbjct adiacwrldgvdrvgvhdpaiglimtglsdraslvvvngqvlvenerpvladlerivant  448
DSSP  lleeeeelllhhhlllllhhhhhhhlllllllleeeelleeeeelleellllhhhhhhhh


DSSP  -----
Query -----  291
ident      
Sbjct talip  453
DSSP  hhhll


No 13: Query=1bf6A Sbjct=2vunA Z-score=17.6

back to top
DSSP  -------------------------------------------------------llllL
Query -------------------------------------------------------sfdpT    5
ident                                                             
Sbjct sktiiknigkivsgdikspvlqadtivvedgliaaiggeelmkdagdatiidaagstvtP   60
DSSP  leeeeellleeellllllleellleeeeelleeeeeelhhhhlllllleeeelllleeeE


DSSP  LEEEEEELLLeelhhhhllhhhEELLHhhhhHHHHHHHHLLEEEEEELLlhHHLL-----
Query GYTLAHEHLHidlsgfknnvdcRLDQYaficQEMNDLMTRGVRNVIEMTnrYMGR-----   60
ident |    | |                                ||   |              
Sbjct GLLDTHVHVS-------ggdyaPRQKT---mDFISSALHGGVTTMISAG--SPHFpgrpk  108
DSSP  LEEEEEELLL-------llleeHHHLE---eLHHHHHHLLLEEEEEELL--LLLLlllll


DSSP  -----------LHHHHHHHHhHHLLEEE-EEELLllhhhlllhhhhllHHHHHHHHHHHH
Query -----------NAQFMLDVMrETGINVV-ACTGYyqdaffpehvatrsVQELAQEMVDEI  108
ident                        |  |                                 
Sbjct daagtkalaitLSKSYYNAR-PAGVKVHgGAVIL-------------eKGLTEEDFIEMK  154
DSSP  lhhhhhhhhhhHHHHHHHLL-HHHLEEElLEELL-------------lLLLLHHHHHHHH


DSSP  HLlllllllLEEEEEEEElllllllhHHHHHHHHHHHHHHhHLLLEEEELHH------hL
Query EQgidgtelKAGIIAEIGtsegkitpLEEKVFIAAALAHNqTGRPISTHTSF------sT  162
ident             |  | |          |        ||   |     ||         |
Sbjct KE-------GVWIVGEVG---lgtikNPEDAAPMVEWAHK-HGFKVQMHTGGtsipgssT  203
DSSP  HL-------LLLEEEEEL---lllllLHHHHHHHHHHHHH-LLLEEEEELLLlllllllL


DSSP  LHHHHHHHHHhllllhhhEEELLLLL---LLLHHHHHHHHH-LLLEEEElLLLLllllLH
Query MGLEQLALLQahgvdlsrVTVGHCDL---KDNLDNILKMID-LGAYVQFdTIGKnsyyPD  218
ident                     | |                 |                   
Sbjct VTADDVIKTK-------pDVVSHINGgptAISVQEVDRIMDeTDFAMEI-VQCG----NP  251
DSSP  LLHHHHHHHL-------lLEEELLLLlllLLLHHHHHHHHHhLLLEEEE-ELLL----LH


DSSP  HHHHHHHHHHHHLLLHHHEEELLLLLLHHHlhhhllLLLLHHHhLHHHHHHHL-LLLHHH
Query EKRIAMLHALRDRGLLNRVMLSMDITRRSHlkanggYGYDYLLtTFIPQLRQS-GFSQAD  277
ident              | | ||    |                  |     |           
Sbjct KIADYVARRAAEKGQLGRVIFGNDAPSGTG------LIPLGIL-RNMCQIASMsDIDPEV  304
DSSP  HHHHHHHHHHHHHLLHHHEEEELLLLLLLL------LLLLHHH-HHHHHHHHHlLLLHHH


DSSP  HHHHHLHHHHHHLL----------------------------------------------
Query VDVMLRENPSQFFQ----------------------------------------------  291
ident    |   |                                                    
Sbjct AVCMATGNSTAVYGlntgviapgkeadliimdtplgsvaedamgaiaagdipgisvvlid  364
DSSP  HHHHHLHHHHHHHLllllllllllllleeeeelllllllllhhhhhhhlllleeeeeeel


DSSP  ---------------------
Query ---------------------  291
ident                      
Sbjct geavvtksrntppakraakil  385
DSSP  leeeellllllllllllleel


No 14: Query=1bf6A Sbjct=3mtwA Z-score=17.6

back to top
DSSP  -----------------------------------------------------llllLLE
Query -----------------------------------------------------sfdpTGY    7
ident                                                           | 
Sbjct aeikavsaarlldvasgkyvdnplvivtdgritsigkkgdavpagatavdlpgvtllPGL   60
DSSP  lleeeeeeeeeeelllleeeeleeeeeelleeeeeeellllllllleeeeeeeeeeeELE


DSSP  EEEEELLLEelhhhHLLHH---heeLLHHhHHHHHHHHHHLLEEEEEELLlhhHLLL-HH
Query TLAHEHLHIdlsgfKNNVD---crlDQYAfICQEMNDLMTRGVRNVIEMTnryMGRN-AQ   63
ident    | ||         |                        |   |              
Sbjct IDMHVHLDSlaevgGYNSLeysdrfWSVV-QTANAKKTLEAGFTTVRNVG--aADYDdVG  117
DSSP  EEEEELLLLlllllHHHHHhllhhhHHHH-HHHHHHHHHHLLEEEEEELL--lLLLHhHH


DSSP  HHHHHHH--HHLLEEEEE-ELLLL--HHHLL----------lhhhhLLHHHHHHHHHHHH
Query FMLDVMR--ETGINVVAC-TGYYQ--DAFFP----------ehvatRSVQELAQEMVDEI  108
ident            |   |                               |  |         
Sbjct LREAIDAgyVPGPRIVTAaISFGAtgGHCDStffppsmdqknpfnsDSPDEARKAVRTLK  177
DSSP  HHHHHHLllLLLLEEEELlLLEELllLLLLLllllhhhllllllllLLHHHHHHHHHHHH


DSSP  HLlllllllLEEEEEeEELL----------LLLLlhhHHHHHHHHHHHHHHHLLLEEEEL
Query EQgidgtelKAGIIAeIGTS----------EGKItplEEKVFIAAALAHNQTGRPISTHT  158
ident           |  |  |                          |        |     | 
Sbjct KY-------GAQVIX-ICATggvfsrgnepGQQQ--lTYEEMKAVVDEAHMAGIKVAAHA  227
DSSP  HL-------LLLEEE-EELLllllllllllLLLL--lLHHHHHHHHHHHHHLLLEEEEEE


DSSP  HHHLLHHHHHHHHhhllllhhhEEELLLLllLLHH-HHHHHHHLLLEEEELLLLLL----
Query SFSTMGLEQLALLqahgvdlsrVTVGHCDlkDNLD-NILKMIDLGAYVQFDTIGKN----  213
ident        |               |  |       |  |      |||   |         
Sbjct HGASGIREAVRAG--------vDTIEHAS--LVDDeGIKLAVQKGAYFSMDIYNTDytqa  277
DSSP  LLHHHHHHHHHLL--------lLEEEELL--LLLHhHHHHHHHHLLEEELLLLLHHhhhh


DSSP  ---------------LLLLhHHHHHHHHHHHHLLLhhHEEELLLLLlhhhlhhhllLLLL
Query ---------------SYYPdEKRIAMLHALRDRGLlnRVMLSMDITrrshlkanggYGYD  258
ident                     |            |         |            |   
Sbjct egkkngvlednlrkdRDIG-ELQRENFRKALKAGV--KMVYGTDAG---------iYPHG  325
DSSP  hhhhhlllhhhhhhhHHHH-HHHHHHHHHHHHHLL--EEELLLLLL---------lLLLL


DSSP  HHHhLHHHHHHHLLLLHHHHHHHHLHHHHHHLL---------------------------
Query YLLtTFIPQLRQSGFSQADVDVMLRENPSQFFQ---------------------------  291
ident              |                                              
Sbjct DNA-KQFAVMVRYGATPLQAIQSATLTAAEALGrskdvgqvavgrygdmiavagdpladv  384
DSSP  LHH-HHHHHHHHLLLLHHHHHHHLLHHHHHHHLllllllllllllllleeeelllllllh


DSSP  --------------------
Query --------------------  291
ident                     
Sbjct ttlekpvfvmkggavvkapx  404
DSSP  hhhhllleeeelleeeelll


No 15: Query=1bf6A Sbjct=2ffiA Z-score=17.6

back to top
DSSP  llllLLEEEEEELLL----eelhHHHLLHHhEELLhhhHHHHHHHHHHLLEEEEEELL--
Query sfdpTGYTLAHEHLH----idlsGFKNNVDcRLDQyafICQEMNDLMTRGVRNVIEMT--   54
ident           | |                                |   |          
Sbjct --lhLTAIDSHAHVFsrglnlasQRRYAPN-YDAP---LGDYLGQLRAHGFSHGVLVQps   54
DSSP  --llLLLEELLLLLLlhhhhhhlLLLLLLL-LLLL---HHHHHHHHHHLLLLEELLLLlh


DSSP  lHHHLLL--HHHHHHHHhhhllEEEEEELLllhhhlllhhhhllhhhHHHHhHHHHHLLl
Query nRYMGRN--AQFMLDVMretgiNVVACTGYyqdaffpehvatrsvqeLAQEmVDEIEQGi  112
ident                |                                  |         
Sbjct fLGTDNRylLSALQTVP----gQLRGVVXL----------------eRDVE-QATLAEX-   92
DSSP  hHLLLLHhhHHHHHHLL----lLLLLLLLL----------------lLLLL-HHHHHHH-


DSSP  lllLLLEEEEEeEELLLLLLLhHHHH-hHHHHHHHHHHHLLLEEEELhHHLLHHHHHHHH
Query dgtELKAGIIAeIGTSEGKITpLEEK-vFIAAALAHNQTGRPISTHTsFSTMGLEQLALL  171
ident     |                                  |     |             |
Sbjct --aRLGVRGVR-LNLXGQDXP-DLTGaqWRPLLERIGEQGWHVELHR-QVADIPVLVRAL  147
DSSP  --hLLLLLEEE-LLLLLLLLL-LLLLllLHHHHHHHHHHLLEEEELL-LLLLHHHHHHHH


DSSP  HhLLLLhhHEEELL-LLLLL-------lHHHHHHhHHLL--LEEEELLLLLLLL---lLH
Query QaHGVDlsRVTVGH-CDLKD-------nLDNILKmIDLG--AYVQFDTIGKNSY---yPD  218
ident |            |                  |          |    |           
Sbjct Q-PYGL--DIVIDHfGRPDArrglgqpgFAELLT-LSGRgkVWVKVSGIYRLQGspeeNL  203
DSSP  L-LLLL--LEEELHhHLLLLllllllllHHHHLL-LLLLllEEEEEELHHHLLLlhhhHH


DSSP  HHHHHHHHHHHHLLLHHHEEELLLLL-LHHHlhhhLLLLLLHHHhLHHHHHHhllLLHHH
Query EKRIAMLHALRDRGLLNRVMLSMDIT-RRSHlkanGGYGYDYLLtTFIPQLRqsgFSQAD  277
ident       | ||       |     |                          |     |   
Sbjct AFARQALCALEAHYGAERLXWGSDWPhTQHE----SEVSFGSAV-EQFEALG---CSAQL  255
DSSP  HHHHHHHHHHHHHLLHHHEEEELLLLlLLLL----LLLLHHHHH-HHHHHHL---LLHHH


DSSP  HHHHHLHHHHHHLL----
Query VDVMLRENPSQFFQ----  291
ident     |       |     
Sbjct RQALLLDTARALFGfele  273
DSSP  HHHHHLHHHHHHLLllll


No 16: Query=1bf6A Sbjct=3nqbA Z-score=17.5

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct epadlnddtlraravaaargdqrfdvlitggtlvdvvtgelrpadigivgaliasvhepa   60
DSSP  llhhhllhhhhhhhhhhhhlllleeeeeelleeelllllleeeleeeeelleeeeeelll


DSSP  -------------llllLLEEEEEELLLeelhhhhllhhheELLHhhHHHHHHHHHHLLE
Query -------------sfdpTGYTLAHEHLHidlsgfknnvdcrLDQYafICQEMNDLMTRGV   47
ident                   |    | |                               |||
Sbjct srrdaaqvidaggayvsPGLIDTHXHIE------------sSXIT--PAAYAAAVVARGV  106
DSSP  lllleeeeeelllleeeELEEEEEELHH------------hHLLL--HHHHHHHHHLLLE


DSSP  EEEEELLL--HHHL---LLHHHHHHHHHhHLLEEEEEELLLlhhHLLLHhhhllhhhHHH
Query RNVIEMTN--RYMG---RNAQFMLDVMReTGINVVACTGYYqdaFFPEHvatrsvqeLAQ  102
ident                                               |           | 
Sbjct TTIVWDPHefGNVHgvdGVRWAAKAIEN-LPLRAILLAPSC-vpSAPGL-erggadfDAA  163
DSSP  EEEEELLHhhHHHHlhhHHHHHHHHHLL-LLLEEEEEELLL-llLLLLL-lllllllLHH


DSSP  HHHHHHHLllllllLLEEEEEEEELLlllLLHHhhHHHHHHHHHHHHHLLLEEEELhhHL
Query EMVDEIEQgidgteLKAGIIAEIGTSegkITPLeeKVFIAAALAHNQTGRPISTHTsfST  162
ident    |             | ||||      |             |          |     
Sbjct ILADLLSW------PEIGGIAEIXNXrgvIERD--PRXSGIVQAGLAAEKLVCGHA--RG  213
DSSP  HHHHHHLL------LLEEEEEEELLHhhhHLLL--HHHHHHHHHHHHHLLEEEELL--LL


DSSP  LHHHHHHHHHHLLllhhhEEELlLLLLllHHHHHHHHHLLLEEEElLLLLlllllHHHHH
Query MGLEQLALLQAHGvdlsrVTVGhCDLKdnLDNILKMIDLGAYVQFdTIGKnsyypDEKRI  222
ident      |    | |                          |               |    
Sbjct LKNADLNAFXAAG----vSSDH-ELVS--GEDLXAKLRAGLTIEL-RGSH-----DHLLP  260
DSSP  LLHHHHHHHHHLL----lLEEL-LLLL--HHHHHHHHHLLLEEEE-ELLL-----HHHHH


DSSP  HHHHHHHHL-LLHHHEEELLLLLLHHHLHhhlLLLL-LHHHhLHHHHHHhllLLHHHHHH
Query AMLHALRDR-GLLNRVMLSMDITRRSHLKangGYGY-DYLLtTFIPQLRqsgFSQADVDV  280
ident     ||     |   | |  |      |      |  |                      
Sbjct EFVAALNTLgHLPQTVTLCTDDVFPDDLL---QGGGlDDVV-RRLVRYG---LKPEWALR  313
DSSP  HHHHHHHHHlLLLLLEEEELLLLLHHHHH---HLLLhHHHH-HHHHHLL---LLHHHHHH


DSSP  HHLHHHHHHLL-------------------------------------------------
Query MLRENPSQFFQ-------------------------------------------------  291
ident     |  |                                                    
Sbjct AATLNAAQRLGrsdlgliaagrradivvfedlngfsarhvlasgravaeggrxlvdiptc  373
DSSP  HHLHHHHHHHLlllllllllllllleeeellllllleeeeeelleeeeelleelllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  291
ident                                                             
Sbjct dttvlkgsxklplrxandflvksqgakvrlatidrprftqwgeteadvkdgfvvppegat  433
DSSP  llhhhllllllllllhhhhllllllleeeeeeeellllleeeeeeeeeelleelllllee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  291
ident                                                             
Sbjct xisvthrhgxaepttktgfltgwgrwngafattvshdshnltvfggnagdxalaanavig  493
DSSP  eeeeellllllllleeeeeeellllllleeeelllllllleeeeellhhhhhhhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  291
ident                                                             
Sbjct tgggxavasegkvtailplplsglvsdapleevarafedlreavgkvvewqppylvfkac  553
DSSP  llleeeeeelleeeeeeelllllllllllhhhhhhhhhhhhhhhhhhlllllllllhhhh


DSSP  ----------------------------------
Query ----------------------------------  291
ident                                   
Sbjct fgatlacnigphqtdxgiadvltgkvxespviev  587
DSSP  hlllllllllleelllleeelllleeellleeel


No 17: Query=1bf6A Sbjct=4cqbA Z-score=17.5

back to top
DSSP  ------------------------------------------------llllLLEEEEEE
Query ------------------------------------------------sfdpTGYTLAHE   12
ident                                                      |   || 
Sbjct skdfdliirnaylsekdsvydigivgdriikieakiegtvkdeidakgnlvsPGFVDAHT   60
DSSP  llleeeeeeeeeelllleeeeeeeelleeeeeelllllleeeeeellllleeELEEEEEE


DSSP  LLLE------------------------eLHHHhllhhheelLHHHHHHHHHHHHHLLEE
Query HLHI------------------------dLSGFknnvdcrldQYAFICQEMNDLMTRGVR   48
ident |                                                        |  
Sbjct HMDKsftstgerlpkfwsrpytrdaaiedGLKY-yknatheeIKRHVIEHAHMQVLHGTL  119
DSSP  LHHHllllllllllllllllllhhhhhhhHHHH-hhhllhhhHHHHHHHHHHHHHHLLEE


DSSP  EEEELLLHH-----hLLLH--HHHHHHHHhhLLEEEEEELLLLHhhLLLHhhhllhhhhH
Query NVIEMTNRY-----mGRNA--QFMLDVMRetGINVVACTGYYQDafFPEHvatrsvqelA  101
ident                   |             |                           
Sbjct YTRTHVDVDsvaktkAVEAvlEAKEELKD--LIDIQVVAFAQSGffVDLE--------sE  169
DSSP  EEEEEEELLlllllhHHHHhhHHHHHLLL--LLEEEEEEELLLLllLLLL--------hH


DSSP  HHHHHHHHLlllllllLEEEEEeEELLLlLLLHHHHHHHHHHHHHHHHHLLLEEEELHHH
Query QEMVDEIEQgidgtelKAGIIAeIGTSEgKITPLEEKVFIAAALAHNQTGRPISTHTSFS  161
ident                                    |                |  |    
Sbjct SLIRKSLDM-------GCDLVG-GVDPA-TRENNVEGSLDLCFKLAKEYDVDIDYHIHDI  220
DSSP  HHHHHHHHH-------LLLEEE-LLLLL-LLLLLHHHHHHHHHHHHHHLLLEEEEEELLL


DSSP  -----lLHHHHHHHHHHLLlLHHHEEELLLLLLL------LHHHHHHHHHLLLEEEElLL
Query -----tMGLEQLALLQAHGvDLSRVTVGHCDLKD------NLDNILKMIDLGAYVQFdTI  210
ident                   |    |||  |               |    | |        
Sbjct gtvgvySINRLAQKTIENG-YKGRVTTSHAWCFAdapsewLDEAIPLYKDSGMKFVT-CF  278
DSSP  hhhhhhHHHHHHHHHHHLL-LLLLEEEEELLHHHhllhhhHHHHHHHHHHHLLEEEE-EL


DSSP  LLlllllHHHHhhHHHHHHhLLLHhHEEELLLLL-LHHHLhhhlLLLLLhHHHL--HHHH
Query GKnsyypDEKRiaMLHALRdRGLLnRVMLSMDIT-RRSHLkangGYGYDyLLTT--FIPQ  267
ident                  |             |                |          |
Sbjct SS----tPPTM--PVIKLL-EAGI-NLGCASDNIrDFWVP----FGNGD-MVQGalIETQ  325
DSSP  LL----lLLLL--LHHHHH-HLLL-EEEEELLLLlLLLLL----LLLLL-HHHHhhHHHH


DSSP  HHHLL--lLHHHHHHHHLHHHHHHLL----------------------------------
Query LRQSG--fSQADVDVMLRENPSQFFQ----------------------------------  291
ident                |                                            
Sbjct RLELKtnrDLGLIWKMITSEGARVLGieknygievgkkadlvvlnslspqwaiidqakrl  385
DSSP  HHLLLlhhHHHHHHHHHLHHHHHHHLlhhhlllllllllleeeellllhhhhhhhlllee


DSSP  -----------------
Query -----------------  291
ident                  
Sbjct cvikngriivkdeviva  402
DSSP  eeeelleeeeelleell


No 18: Query=1bf6A Sbjct=2pajA Z-score=17.3

back to top
DSSP  --------------------------------------------------------llll
Query --------------------------------------------------------sfdp    4
ident                                                             
Sbjct pstlirnaaaimtggrgtaddpsrvpgpdirivgdtidaigalaprpgetivdatdcviy   60
DSSP  leeeeellleelllllllllllllllllleeeelleeeeellllllllleeeelllleee


DSSP  LLEEEEEELLL-------eELHHhhllhhheeLLHHHHHHHHHHHHHLLEEEEEELLLHH
Query TGYTLAHEHLH-------iDLSGfknnvdcrlDQYAFICQEMNDLMTRGVRNVIEMTNRY   57
ident       | ||                                  |   |   |      |
Sbjct PAWVNTHHHLFqsllkgepFRAL-----fderRFRLAARIGLIELARSGCATVADHNYVY  115
DSSP  ELEELLLLLHHhhhlllllLHHH-----llhhHHHHHHHHHHHHHHLLLEEEEEELLLLL


DSSP  ----hllLHHHHHHHHHHHLLEEEEEELLlLHHH---------lLLHHhhlLHHHHHHHH
Query ----mgrNAQFMLDVMRETGINVVACTGYyQDAF---------fPEHVatrSVQELAQEM  104
ident                    |   |   |                                
Sbjct ypgmpfdSSAILFEEAEKLGLRFVLLRGG-ATQTrqleadlptaLRPE---TLDAYVADI  171
DSSP  lllllllHHHHHHHHHHHLLLEEEEEELL-LLLLllllllllhhHLLL---LHHHHHHHH


DSSP  HHHHHLL--lllllllEEEEE-EEELLlllllhHHHHHHHHHHHHHHHHLLLEEEELHhh
Query VDEIEQG--idgtelkAGIIA-EIGTSegkitpLEEKVFIAAALAHNQTGRPISTHTSfs  161
ident                     |                     |      |     | |  
Sbjct ERLAARYhdaspramrRVVMApTTVLY-----sISPREMRETAAVARRLGLRMHSHLSgk  226
DSSP  HHHHHHLlllllllleEEEELlLLLLL-----lLLHHHHHHHHHHHHHLLLEEEEELLll


DSSP  lLHHHHHHHHhhllllHHHEEELLLLllLLHH-HHHHHHHLLLEEEELLLLLLLLllhhh
Query tMGLEQLALLqahgvdLSRVTVGHCDlkDNLD-NILKMIDLGAYVQFDTIGKNSYypdek  220
ident                  | |   |          |      |  |               
Sbjct sPVAFCGEHD----wlGSDVWYAHLV--KVDAdEIALLAQTGTGVAHCPQSNGRL-----  275
DSSP  lHHHHHHHLL----llLLLEEEELLL--LLLHhHHHHHHHHLLEEEELHHHHHLL-----


DSSP  hhhHHHHHHhLLLHhHEEELLLLLLhhhlhhhllLLLL--HHHHlHHHHHHHLL-LLHHH
Query riaMLHALRdRGLLnRVMLSMDITRrshlkanggYGYD--YLLTtFIPQLRQSG-FSQAD  277
ident                 |    |               |                  | | 
Sbjct ---PVREMA-DAGV-PVSIGVDGAA-------snEAADmiSEVH-MTWLAQRARlASIAE  322
DSSP  ---LLLLHH-HHLL-LEEELLLHHH-------hlLLLLhhHHHH-HHHHHHHHLlLLHHH


DSSP  HHHHHLHHHHHHLL----------------------------------------------
Query VDVMLRENPSQFFQ----------------------------------------------  291
ident |                                                           
Sbjct VIHWGTAGGARVMGldevgkvavgyaadiavyrlddpryfglhdpaigpvasggrpsvma  382
DSSP  HHHHHLHHHHHHHLlllllllllllllleeeeelllhhhlllllhhhhhhhllllleeee


DSSP  ---------------------------------------
Query ---------------------------------------  291
ident                                        
Sbjct lfsagkrvvvddliegvdikelggearrvvrellrevvv  421
DSSP  eeelleeeeellllllllhhhhhhhhhhhhhhhhhhhhl


No 19: Query=1bf6A Sbjct=1k6wA Z-score=17.3

back to top
DSSP  -----------------------------------------------llllLLEEEEEEL
Query -----------------------------------------------sfdpTGYTLAHEH   13
ident                                                          | |
Sbjct alqtiinarlpgeeglwqihlqdgkisaidaqsgvmpitensldaeqglviPPFVEPHIH   60
DSSP  llleeeeellllllleeeeeeelleeeeeeeellllllllleeelllleeeLLEEEEEEL


DSSP  LLE-------------elhhhHLLH------hheeLLHHHHHHHHHHHHHLLEEEEEELL
Query LHI-------------dlsgfKNNV------dcrlDQYAFICQEMNDLMTRGVRNVIEMT   54
ident |                                  |      |        |   |    
Sbjct LDTtqtagqpnwnqsgtlfegIERWaerkallthdDVKQRAWQTLKWQIANGIQHVRTHV  120
DSSP  LLLllllllllllllllhhhhHHHHhllhhhllhhHHHHHHHHHHHHHHHLLEEEEEEEE


DSSP  LHH--hllLHHHHHHHHHHH--LLEEEEEELLLLHhhLLLHhhhllhhhhHHHHHHHHHL
Query NRY--mgrNAQFMLDVMRET--GINVVACTGYYQDafFPEHvatrsvqelAQEMVDEIEQ  110
ident             || |  |    |                                    
Sbjct DVSdatltALKAMLEVKQEVapWIDLQIVAFPQEGilSYPN--------gEALLEEALRL  172
DSSP  ELLllllhHHHHHHHHHHHHllLLEEEEEEELLLLllLLLL--------hHHHHHHHHHL


DSSP  lllllllLEEEEEeEELLLlllLHHHHHHHHHHHHHHHHHLLLEEEELHHH-----LLHH
Query gidgtelKAGIIAeIGTSEgkiTPLEEKVFIAAALAHNQTGRPISTHTSFS-----TMGL  165
ident         |                                | |  |             
Sbjct -------GADVVG-AIPHFeftREYGVESLHKTFALAQKYDRLIDVHCDEIddeqsRFVE  224
DSSP  -------LLLEEE-ELHHHlllHHHHHHHHHHHHHHHHHHLLEEEEEELLLlllllLHHH


DSSP  HHHHHHHHlLLLHHHEEELLLLLLL------LHHHHHHHHHLLLEEEElLLLL-LLLL--
Query EQLALLQAhGVDLSRVTVGHCDLKD------NLDNILKMIDLGAYVQFdTIGK-NSYY--  216
ident    ||         |||  |                      |                 
Sbjct TVAALAHH-EGMGARVTASHTTAMHsyngayTSRLFRLLKMSGINFVA-NPLVnIHLQgr  282
DSSP  HHHHHHHH-HLLHHHEEEEELHHHHhllhhhHHHHHHHHHHHLLEEEE-LHHHhHHHLll


DSSP  -----lHHHHhhHHHHHHHLLLhhHEEELLLLL-LHHHlhhhlLLLLLHHHhLHHHHHHH
Query -----pDEKRiaMLHALRDRGLlnRVMLSMDIT-RRSHlkangGYGYDYLLtTFIPQLRQ  270
ident                     |    |    |              |    |         
Sbjct fdtypkRRGI-tRVKEMLESGI--NVCFGHDDVfDPWY-----PLGTANML-QVLHMGLH  333
DSSP  llllllLLLL-lLHHHHHHLLL--LEEELLLLLlLLLL-----LLLLLLHH-HHHHHHHH


DSSP  ------lLLLHHhHHHHHLHHHHHHLL---------------------------------
Query ------sGFSQAdVDVMLRENPSQFFQ---------------------------------  291
ident        |                                                    
Sbjct vcqlmgyGQIND-GLNLITHHSARTLNlqdygiaagnsanliilpaengfdalrrqvpvr  392
DSSP  hlllllhHHHHH-HHHHHLHHHHHHLLllllllllllllleeeellllhhhhhhhlllll


DSSP  -------------------------------
Query -------------------------------  291
ident                                
Sbjct ysvrggkviastqpaqttvyleqpeaidykr  423
DSSP  eeeelleeeeellllleeeellleeeellll


No 20: Query=1bf6A Sbjct=4dlfA Z-score=17.1

back to top
DSSP  llllLLEEEEEELLlEELH-HHHL-------lhHHEELlhhhHHHHHHHHHHLLEEEEEE
Query sfdpTGYTLAHEHLhIDLS-GFKN-------nvDCRLDqyafICQEMNDLMTRGVRNVIE   52
ident           | |                                             | 
Sbjct ----ALRIDSHQHF-WRYRaADYPwigagmgvlARDYL----PDALHPLMHAQALGASIA   51
DSSP  ----LLLEEEEELL-LLLLhHHLLllllllhhhLLLLL----HHHHHHHHHHLLLLEEEE


DSSP  LL--lHHHL--LLHHHHHHHHhhhlLEEEEEELLllhhhlllhhhhllHHHHHHHHhhhh
Query MT--nRYMG--RNAQFMLDVMretgINVVACTGYyqdaffpehvatrsVQELAQEMvdei  108
ident                   |                                ||       
Sbjct VQaraGRDEtaFLLELACDEA----RIAAVVGWE-----------dlrAPQLAERV----   92
DSSP  ELlllLHHHhhHHHHHHLLLL----LEEEEEELL-----------lllLLLHHHHH----


DSSP  HLLLlllLLLEEEEEeEELLL-LLLLHHHHH-hHHHHHHHHHHHLLLEEEELHhHLLHHH
Query EQGIdgtELKAGIIAeIGTSE-GKITPLEEK-vFIAAALAHNQTGRPISTHTSfSTMGLE  166
ident          |                       |                          
Sbjct AEWR---GTKLRGFR-HQLQDeADVRAFVDDadFARGVAWLQANDYVYDVLVF-ERQLPD  147
DSSP  HLLL---LLLEEEEE-ELHHHlLLHHHHHHLhhHHHHHHHHHHLLLEEEELLL-HHHHHH


DSSP  HHHHHHHlLLLHhHEEELL-LLLLL------------LHHHHHHHHHLL-LEEEELLLLL
Query QLALLQAhGVDLsRVTVGH-CDLKD------------NLDNILKMIDLG-AYVQFDTIGK  212
ident   |               |                            |            
Sbjct VQAFCAR-HDAH-WLVLDHaGKPALaefdrddtalarWRAALRELAALPhVVCKLSGLVT  205
DSSP  HHHHHHH-LLLL-LEEEHHhHLLLHhhllllllhhhhHHHHHHHHHLLLlEEEEELLLLL


DSSP  LLL-------lLHHHHHHHHHHHHHLlLHHHEEELLLLLLhhhlhhhlLLLLLHHHhLHH
Query NSY-------yPDEKRIAMLHALRDRgLLNRVMLSMDITRrshlkangGYGYDYLLtTFI  265
ident                    | |  |     | |   |              ||       
Sbjct EADwrrglrasDLRHIEQCLDAALDAfGPQRLMFGSDWPV-----cllAASYDEVA-SLV  259
DSSP  LLLllllllhhHHHHHHHHHHHHHHHhLHHHEEELLLLLH-----hhhLLLHHHHH-HHH


DSSP  HHHHHLLLLHHHHHHHHLHHHHHHLL--
Query PQLRQSGFSQADVDVMLRENPSQFFQ--  291
ident      |  | |                 
Sbjct ERWAESRLSAAERSALWGGTAARCYAlp  287
DSSP  HHHHHHHLLHHHHHHHLLHHHHHHLLll


No 21: Query=1bf6A Sbjct=2oofA Z-score=17.0

back to top
DSSP  ---------------------------------------------------------lll
Query ---------------------------------------------------------sfd    3
ident                                                             
Sbjct lncervwlnvtpatlrsdladygllephalgvhegrihalvpxqdlkypahwqdxkgklv   60
DSSP  lllleeeeeeeellllllllllllllleeeeeelleeeeeeehhhllllllleellllee


DSSP  lLLEEEEEELLLE-----------------------------ELHHhhllhhheeLLHHH
Query pTGYTLAHEHLHI-----------------------------DLSGfknnvdcrlDQYAF   34
ident   |    | ||                                                 
Sbjct tPGLIDCHTHLIFagsraeefelrqkgvpyaeiarkgggiisTVRA--traasedQLFEL  118
DSSP  eELEEEEEELLLLllllhhhhhhhhhlllhhhhhhllllhhhHHHH--hhhllhhHHHHH


DSSP  HHHHHHHHHHLLEEEEEELLLHHH-----llLHHHHHHHHHHHLLEEEEEE-LLLLhhhL
Query ICQEMNDLMTRGVRNVIEMTNRYM-----grNAQFMLDVMRETGINVVACT-GYYQdafF   88
ident        |   ||  |                            | |             
Sbjct ALPRVKSLIREGVTTVEIKSGYGLtledelkXLRVARRLGEALPIRVKTTLlAAHA---V  175
DSSP  HHHHHHHHHHHLEEEEEEELLLLLlhhhhhhHHHHHHHHHHHLLLEEEEEEeEELL---L


DSSP  LLHH---HHLLHHHHHH-HHHHHHHLLllllllLEEEEEeEELLLllllhHHHHHHHHHH
Query PEHV---ATRSVQELAQ-EMVDEIEQGidgtelKAGIIAeIGTSEgkitpLEEKVFIAAA  144
ident |          |    |       | |       |                         
Sbjct PPEYrddPDSWVETICQeIIPAAAEAG------LADAVD-VFCEH---igFSLAQTEQVY  225
DSSP  LHHHlllHHHHHHHHHHlHHHHHHHLL------LLLEEE-EEELL---llLLHHHHHHHH


DSSP  HHHHHHLLLEEEELHHHLLhhHHHHHHhhlllLHHHEEELLLLlllLHHHHHHHHHLLLE
Query LAHNQTGRPISTHTSFSTMglEQLALLqahgvDLSRVTVGHCDlkdNLDNILKMIDLGAY  204
ident ||  | |     |            |            | |         |      |  
Sbjct LAADQYGLAVKGHXDQLSN-lGGSTLA----aNFGALSVDHLE-ylDPEGIQALAHRGVV  279
DSSP  HHHHHLLLEEEEEELLLLL-lLHHHHH----hHLLLLEEEELL-llLHHHHHHHHHHLLE


DSSP  EEElLLLL-LLLLLHHHHhhHHHHHHhLLLHhHEEELLLLLLhhhlhhhlLLLL-LHHHh
Query VQFdTIGK-NSYYPDEKRiaMLHALRdRGLLnRVMLSMDITRrshlkangGYGY-DYLLt  262
ident                        |||          | ||                    
Sbjct ATL-LPTAfYFLKETKLP--PVVALR-KAGV-PXAVSSDINP-----gtaPIVSlRXAX-  328
DSSP  EEE-LHHHhHHLLLLLLL--LHHHHH-HLLL-LEEELLLLLL-----lllLLLLhHHHH-


DSSP  LHHHHHhhlLLLHHHHHHHHLHHHHHHLL-------------------------------
Query TFIPQLrqsGFSQADVDVMLRENPSQFFQ-------------------------------  291
ident      |   |                                                  
Sbjct NXACTL--fGLTPVEAXAGVTRHAARALGeqeqlgqlrvgxladflvwncghpaelsyli  386
DSSP  HHHHHH--hLLLHHHHHHHLLHHHHHHLLllllllllllllllleeeellllllhhhhll


DSSP  -----------------
Query -----------------  291
ident                  
Sbjct gvdqlvsrvvngeetlh  403
DSSP  lllleeeeeelleelll


No 22: Query=1bf6A Sbjct=2qpxA Z-score=16.9

back to top
DSSP  -------lllllLEEEEEELLleelhhhhllhhheELLH---------------------
Query -------sfdptGYTLAHEHLhidlsgfknnvdcrLDQY---------------------   32
ident                  | |               |                        
Sbjct gxddlsefvdqvPLLDHHCHF--------------LIDGkvpnrddrlaqvsteadkdyp   46
DSSP  lllllhhhhhhlLEEEEEELL--------------LLLLllllhhhhhhhhlllllllll


DSSP  ----------------------------------HHHHHHHHHHHHLLEEEEEELLlhhH
Query ----------------------------------AFICQEMNDLMTRGVRNVIEMTnryM   58
ident                                                        |    
Sbjct ladtknrlayhgflalakefaldannplaaxndpGYATYNHRIFGHFHFKELLIDT---G  103
DSSP  hhhhlllhhhhhhhhhhhhhllllllllllllhhHHHHHHHHHHHHLLEEEEEEEL---L


DSSP  LLL---hHHHHHHHHHHLLEEEEEELLLlhhhLLLH-----hHHLLhHHHHHHHHHHHHL
Query GRN---aQFMLDVMRETGINVVACTGYYqdafFPEH-----vATRSvQELAQEMVDEIEQ  110
ident                  || | |                   |    |            
Sbjct FVPddpiLDLDQTAELVGIPVKAIYRLE-thaEDFXlehdnfAAWW-QAFSNDVKQAKAH  161
DSSP  LLLllllLLHHHHHHHHLLLEEEEEEHH-hhhHHHHlllllhHHHH-HHHHHHHHLLLLL


DSSP  lllllllLEEEEEeEELLLLLL----------------------------LHHHHHHHHH
Query gidgtelKAGIIAeIGTSEGKI----------------------------TPLEEKVFIA  142
ident                                                    ||       
Sbjct -------GFVGFX-SIAAYRVGlhlepvnvieaaagfdtwkhsgekrltsKPLIDYXLYH  213
DSSP  -------LLLLEE-ELHHHHLLlllllllhhhhhhhhhhhhhhlllllllHHHHHHHHHH


DSSP  HHHHHHHHLLLEEEELHH--------hLLHHHhHHHHHHLLLL-hhHEEELLLLllLLHH
Query AALAHNQTGRPISTHTSF--------sTMGLEqLALLQAHGVD-lsRVTVGHCDlkDNLD  193
ident  |        |   |               |                |   ||       
Sbjct VAPFIIAQDXPLQFHVGYgdadtdxylGNPLL-XRDYLKAFTKkglKVVLLHCY--PYHR  270
DSSP  HHHHHHHHLLLEEEEELLllllllhhhLLHHH-HHHHHHHHHHhllLEEEEELL--LLHH


DSSP  HHHHHHHLL--LEEEELL-LLLLllllHHHHHHHHHHHHHLLLHHHEEELLLLLLHhhlh
Query NILKMIDLG--AYVQFDT-IGKNsyypDEKRIAMLHALRDRGLLNRVMLSMDITRRshlk  250
ident             |                                |     |        
Sbjct EAGYLASVFpnLYFDISLlDNLG----PSGASRVFNEAVELAPYTRILFASDASTY----  322
DSSP  HHHHHHHHLllEEEELLLhHHHL----HHHHHHHHHHHLLLLLHHHEELLLLLLLL----


DSSP  hhllLLLLHHHHLHHHHHHHLL---------lLHHHHHHHHLHHHHHHLL-------
Query anggYGYDYLLTTFIPQLRQSG---------fSQADVDVMLRENPSQFFQ-------  291
ident       |      |   |                |                      
Sbjct ---pEXYGLAARQFKQALVAHFnqlpfvdlaqKKAWINAICWQTSAKLYHqerelrv  376
DSSP  ---hHHHHHHHHHHHHHHHHHHhllllllhhhHHHHHHHHHLHHHHHHLLlhhhhll


No 23: Query=1bf6A Sbjct=3irsA Z-score=16.8

back to top
DSSP  llllLLEEEEEELLL---EELH--hHHLLHH--------------heeLLHHHHHHHHHH
Query sfdpTGYTLAHEHLH---IDLS--gFKNNVD--------------crlDQYAFICQEMND   41
ident                                                         ||  
Sbjct ----LKIIDFRLRPPamgFLNAriyTRPDIRnrftrqlgfepapsaeeKSLELMFEEMAA   56
DSSP  ----LLLEELLLLLLlhhHHHLhhhHLHHHHhhhhhhhlllllhhhhhLLHHHHHHHHHH


DSSP  HHhllEEEEEELLLH-----HHLL--LHHHHHHHHhhhlLEEEEEELLllhhhlllhhhh
Query LMtrgVRNVIEMTNR-----YMGR--NAQFMLDVMretgINVVACTGYyqdaffpehvat   94
ident                            |                                
Sbjct AG---IEQGVCVGRNssvlgSVSNadVAAVAKAYP----DKFHPVGSI----------ea   99
DSSP  LL---LLEEEEELLEellleELLHhhHHHHHHHLL----LLEEEEEEL----------ll


DSSP  LLHHHHHHHHHHHHHlllllllLLEEEEEeEELLllllLHHH--HHHHHHHHHHHHHHLL
Query RSVQELAQEMVDEIEqgidgteLKAGIIAeIGTSegkiTPLE--EKVFIAAALAHNQTGR  152
ident     |    |            |   |           ||                  | 
Sbjct ATRKEAMAQMQEILD-------LGIRIVN-LEPG-vwaTPMHvdDRRLYPLYAFCEDNGI  150
DSSP  LLHHHHHHHHHHHHH-------LLLLLEE-ELHH-hllLLLLllLHHHHHHHHHHHHLLL


DSSP  LEEEELHH-------hLLHHHHHHHHHHlLLLHhHEEELLLlLLLLHHHHHHHHHLL-LE
Query PISTHTSF-------sTMGLEQLALLQAhGVDLsRVTVGHCdLKDNLDNILKMIDLG-AY  204
ident |    |          |        |     ||  |   |         |         |
Sbjct PVIMMTGGnagpdityTNPEHIDRVLGD-FPDL-TVVSSHGnWPWVQEIIHVAFRRPnLY  208
DSSP  LEEEELLLlllllhhhHLHHHHHHHHHH-LLLL-LEEEEHHhLLLHHHHHHHHHHLLlEE


DSSP  EEELLLLLlllllHHHHHHHHHHHHHLLLHHHEEELLLLLLhhhlhhhlllLLLHHHHLH
Query VQFDTIGKnsyypDEKRIAMLHALRDRGLLNRVMLSMDITRrshlkanggyGYDYLLTTF  264
ident    |              |         |  |                           |
Sbjct LSPDMYLY-----NLPGHADFIQAANSFLADRMLFGTAYPM---------cPLKEYTEWF  254
DSSP  EELHHHHL-----LLLLHHHHHHHHLLHHHHLLLLLLLLLL---------lLHHHHHHHH


DSSP  HHHHhhllLLHHHHHHHHLHHHHHHLL----
Query IPQLrqsgFSQADVDVMLRENPSQFFQ----  291
ident                  |  |          
Sbjct LTLP----IKPDAMEKILHGNAERLLAqagr  281
DSSP  HLLL----LLHHHHHHHHLHHHHHHHHhlll


No 24: Query=1bf6A Sbjct=4b3zD Z-score=16.7

back to top
DSSP  ------------------------------------------------llllLLEEEEEE
Query ------------------------------------------------sfdpTGYTLAHE   12
ident                                                      |      
Sbjct drllikggriinddqslyadvyledglikqigenlivpggvktieangrmviPGGIDVNT   60
DSSP  leeeeeeeeeelllleeeeeeeeelleeeeeellllllllleeeelllleeeELEEEEEE


DSSP  LLLeelhhhhllhhheELLHHHHHHHHHHHHHLLEEEEEELLLHH--------hllLHHH
Query HLHidlsgfknnvdcrLDQYAFICQEMNDLMTRGVRNVIEMTNRY--------mgrNAQF   64
ident  |                      |        |    |                     
Sbjct YLQ-------------KTAADDFFQGTRAALVGGTTMIIDHVVPEpgsslltsfekWHEA  107
DSSP  LLL-------------LLLLLLHHHHHHHHHHLLEEEEEEEELLLllllhhhhhhhHHHH


DSSP  HHHHHhhhLLEEEEEELLLlhhhLLLHhhhllhhHHHHHHHHHHHLLllllllLEEEEEe
Query MLDVMretGINVVACTGYYqdafFPEHvatrsvqELAQEMVDEIEQGidgtelKAGIIAe  124
ident                                       |                     
Sbjct ADTKS---CCDYSLHVDIT----SWYD-------GVREELEVLVQDK------GVNSFQ-  146
DSSP  HHLLL---LLEEEEEEELL----LLLL-------LHHHHHHHHHHLL------LLLEEE-


DSSP  EELLLllllhHHHHHHHHHHHHHHHHLLLEEEELH-------------------------
Query IGTSEgkitpLEEKVFIAAALAHNQTGRPISTHTS-------------------------  159
ident                   |       |  |  |                           
Sbjct VYMAYkdvyqMSDSQLYEAFTFLKGLGAVILVHAEngdliaqeqkrilemgitgpeghal  206
DSSP  EELLLlllllLLHHHHHHHHHHHHHHLLEEEEELLlhhhhhhhhhhhhhllllllhhhhh


DSSP  ------HHLLHHHHHHHHHHlLLLHhhEEELLLlLLLL-HHHHHHHHH--LLLEEEELLL
Query ------FSTMGLEQLALLQAhGVDLsrVTVGHCdLKDN-LDNILKMID--LGAYVQFDTI  210
ident                            |            | |                 
Sbjct srpeelEAEAVFRAITIAGR-INCP--VYITKV-MSKSaADIIALARKkgPLVFGEPIAA  262
DSSP  hllhhhHHHHHHHHHHHHHH-HLLL--EEEEEE-LLHHhHHHHHHHHHhlLLEEEEELHH


DSSP  --LLLL-----------------------llLHHHHHHHHHHHhhlllhhHEEELLLLLL
Query --GKNS-----------------------yyPDEKRIAMLHALrdrgllnRVMLSMDITR  245
ident   |                                    |                    
Sbjct slGTDGthywsknwakaaafvtspplspdptTPDYLTSLLACG------dLQVTGSGHCP  316
DSSP  hhHLLLhhhhlllhhhhhhllllllllllllHHHHHHHHHHHL------lLLLLLLLLLL


DSSP  HH-----------hlhhhllLLLLHHHHLHHHHHHHLL-LLHHHHHHHHLHHHHHHLL--
Query RS-----------hlkanggYGYDYLLTTFIPQLRQSG-FSQADVDVMLRENPSQFFQ--  291
ident  |                   |     |         |             |    |   
Sbjct YStaqkavgkdnftlipegvNGIEERMTVVWDKAVATGkMDENQFVAVTSTNAAKIFNly  376
DSSP  LLhhhhhhhlllhhhlllllLLLLLHHHHHHHHHLLLLlLLHHHHHHHHLHHHHHHHLll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  291
ident                                                             
Sbjct prkgriavgsdadvviwdpdklktitakshksaveynifegmechgsplvvisqgkivfe  436
DSSP  llllllllllllleeeeeeeeeeelllllllllllllllllleeeeeeeeeeelleeeee


DSSP  -----------------------------------------
Query -----------------------------------------  291
ident                                          
Sbjct dgninvnkgmgrfiprkafpehlyqrvkirnkvfglqgvsr  477
DSSP  lleellllllllllllllllhhhhhhhhhhhhhllllllll


No 25: Query=1bf6A Sbjct=4c5yA Z-score=16.3

back to top
DSSP  --------------------------------------------------------llll
Query --------------------------------------------------------sfdp    4
ident                                                             
Sbjct deakvtiiyagllipgdgeplrnaalvisdkiiafvgseadipkkylrstqsthrvpvlm   60
DSSP  lllleeeeeeeeellllllleeeeeeeeelleeeeeeehhhllhhhhhhllleeeeeeee


DSSP  LLEEEEEELLLeelhhhhLLHHHE-------elLHHHHHHHHHHHHHLLEEEEEELLlhh
Query TGYTLAHEHLHidlsgfkNNVDCR-------ldQYAFICQEMNDLMTRGVRNVIEMTnry   57
ident  |    | |            |             |            |           
Sbjct PGLWDCHMHFG---gdddYYNDYTsglathpasSGARLARGCWEALQNGYTSYRDLA---  114
DSSP  ELEEEEEELLL---llllLLLLLHhhhhllhhhHHHHHHHHHHHHHHLLEEEEEELL---


DSSP  hlllHHHHHHHH--HHHLLEEEEE-ELLLLHHH---------------LLLH--------
Query mgrnAQFMLDVM--RETGINVVAC-TGYYQDAF---------------FPEH--------   91
ident                  | ||        | |                            
Sbjct -gygCEVAKAINdgTIVGPNVYSSgAALSQTAGhgdifalpagevlgsYGVMnprpgywg  173
DSSP  -llhHHHHHHHHllLLLLLEEEELlLEEELLLLllllllllhhhhhhhHLLLllllllll


DSSP  ----hhhLLHHHHHHHHHHHHHlllllllLLEEEEEEEELL--------LLLLlhHHHHH
Query ----vatRSVQELAQEMVDEIEqgidgteLKAGIIAEIGTS--------EGKItpLEEKV  139
ident          | |        |          |  |                         
Sbjct agplciaDGVEEVRRAVRLQIR-------RGAKVIXVMASGgvmsrddnPNFA-qFSPEE  225
DSSP  llleeelLLHHHHHHHHHHHHH-------HLLLLEEEELLLllllllllLLLL-lLLHHH


DSSP  HHHHHHHHHHHLLLEEEELhHHLL-HHHHHHHHhhllllhhhEEELLLLllLLHH-HHHH
Query FIAAALAHNQTGRPISTHTsFSTM-GLEQLALLqahgvdlsrVTVGHCDlkDNLD-NILK  197
ident             |  | |                            |             
Sbjct LKVIVEEAARQNRIVSAHV-HGKAgIMAAIKAG--------cKSLEHVS--YADEeVWEL  274
DSSP  HHHHHHHHHHLLLLEEEEE-LLHHhHHHHHHHL--------lLEEEELL--LLLHhHHHH


DSSP  HHHLLLEEEELLLLLL------------------LLLLhHHHHHHHHHHHHLLLhhHEEE
Query MIDLGAYVQFDTIGKN------------------SYYPdEKRIAMLHALRDRGLlnRVML  239
ident |   |                                               |      |
Sbjct MKEKGILYVATRSVIEiflasngeglvkeswaklQALA-DSHLKAYQGAIKAGV--TIAL  331
DSSP  HHHHLLEEELLHHHHHhhhhhllllllllhhhllLHHH-HHHHHHHHHHHHLLL--LEEL


DSSP  LLLLllhhhlhhhllllLLHHHhLHHHHHHHL-LLLHHHHHHHHLHHHHHHLL-------
Query SMDItrrshlkanggygYDYLLtTFIPQLRQS-GFSQADVDVMLRENPSQFFQ-------  291
ident   |                              |            |             
Sbjct GTDT-----------apGGPTA-LELQFAVERgGMTPLEAIKAATANAPLSVGpqapltg  379
DSSP  LLLL-----------llLLLLH-HHHHHHHHLlLLLHHHHHHHHLLLHHHHHHhhlllll


DSSP  ---------------------------------------------------------
Query ---------------------------------------------------------  291
ident                                                          
Sbjct qlregyeadvialeenpledikvfqepkavthvwkggklfkgpgigpwgedarnpfl  436
DSSP  llllllllleeeelllllllhhhhhlhhheeeeeelleeeellllllllllllllll


No 26: Query=1bf6A Sbjct=4mupB Z-score=15.8

back to top
DSSP  -----------llllLLEEEEEELLL---eeLHHHHlLHHH--eeLLHHHHHHHHHHHHh
Query -----------sfdpTGYTLAHEHLH---idLSGFKnNVDC--rlDQYAFICQEMNDLMt   44
ident                 |      |                              |  |  
Sbjct lvrklsgtapnpafpRGAVDTQMHMYlpgypALPGG-PGLPpgalPGPEDYRRLMQWLG-   58
DSSP  lllllllllllllllLLLEELLLLLLlllllLLLLL-LLLLllllLLHHHHHHHHHHHL-


DSSP  llEEEEEELL----lHHHLLLHHHHHHHHhhhllEEEEEELLllhhhlllhhhhllhhhH
Query rgVRNVIEMT----nRYMGRNAQFMLDVMretgiNVVACTGYyqdaffpehvatrsvqeL  100
ident      ||        |  |                  |                      
Sbjct --IDRVIITQgnahqRDNGNTLACVAEMG----eAAHAVVII-----------------D   95
DSSP  --LLEEEEELlhhhlLLLHHHHHHHHHHH----hHEEEEELL-----------------L


DSSP  HHHhHHHHHLLllllLLLEEEEEeEELLlllllhhHHHHHHHHHHHHHHHLLLEEEELHH
Query AQEmVDEIEQGidgtELKAGIIAeIGTSegkitplEEKVFIAAALAHNQTGRPISTHTSF  160
ident |       |               |                |                  
Sbjct ATTtEKDMEKL---tAAGTVGAR-IMDL--pggavNLSELDAVDERAHAADWMVAVQFDG  149
DSSP  LLLlHHHHHHH---hHLLEEEEE-EELL--lllllLHHHHHHHHHHHHHLLLEEEEELLH


DSSP  HLL--hHHHHHHHHhllllhhHEEELLLLLL--------lLHHHHHHHHHLL-LEEEELL
Query STM--gLEQLALLQahgvdlsRVTVGHCDLK--------dNLDNILKMIDLG-AYVQFDT  209
ident       |  |           |    |                  || || |     |  
Sbjct NGLldhLPRLQKIR------sRWVFDHHGKFfkgirtdgpEMAALLKLIDRGnLWFKFAG  203
DSSP  HHHhhhHHHHHLLL------lEEEELHHHHLllllllllhHHHHHHHHHHHLlEEEEELL


DSSP  LLLLLL--lLHHHHHHHHHHHHHlLLHHHEEELLLL-LLHHhlhHHLLLLLL-HHHHlHH
Query IGKNSY--yPDEKRIAMLHALRDrGLLNRVMLSMDI-TRRShlkANGGYGYD-YLLTtFI  265
ident     |    |     |            |                               
Sbjct VYESSRkswPYADVAAFSRVIAA-HAPERIVWGTNWpHNSV-reTAAYPDDArLAEL-TL  260
DSSP  HHHLLLlllLLHHHHHHHHHHHH-HLHHHEEELLLLlLLLL-llHHHLLLHHhHHHH-HH


DSSP  HHHhhllLLHHHHHHHHLHHHHHHLL----
Query PQLrqsgFSQADVDVMLRENPSQFFQ----  291
ident   |       |     | |||   |     
Sbjct GWL----PDEAARHRALVENPEALFKlspv  286
DSSP  LLL----LLHHHHHHHHLHHHHHHHLllll


No 27: Query=1bf6A Sbjct=2dvtA Z-score=15.8

back to top
DSSP  lllllLEEEEEElLLEE--LHHHHL-------LHHHE--ELLHhhHHHHHHHHHHLLEEE
Query sfdptGYTLAHEhLHID--LSGFKN-------NVDCR--LDQYafICQEMNDLMTRGVRN   49
ident      |     |                           |                |   
Sbjct ---mqGKVALEE-HFAIpeTLQDSAgfvpgdyWKELQhrLLDI--QDTRLKLMDAHGIET   54
DSSP  ---llLEEEEEE-EELLhhHHHHHLllllllhHHHHHhhHHLL--LLHHHHHHHHLLEEE


DSSP  EEELL-----------------LHHH-lLLHHHHHHHHhhhlLEEEEEELLllhhhlllh
Query VIEMT-----------------NRYM-gRNAQFMLDVMretgINVVACTGYyqdaffpeh   91
ident  |                     |      |               |             
Sbjct MILSLnapavqaipdrrkaieiARRAndVLAEECAKRP----DRFLAFAAL---------  101
DSSP  EEEEElllhhhhlllhhhhhhhHHHHhhHHHHHHHHLL----LLEEEEELL---------


DSSP  hhhLLHHHHHHHHHHHHHLLllllllLEEEEEeEELL---lllllHHHH--hhhHHHHHH
Query vatRSVQELAQEMVDEIEQGidgtelKAGIIAeIGTS---egkitPLEE--kvfIAAALA  146
ident            |                                 ||             
Sbjct -plQDPDAATEELQRCVNDL------GFVGAL-VNGFsqegdgqtPLYYdlpqyRPFWGE  153
DSSP  -llLLHHHHHHHHHHHHHLL------LLLEEE-EELLllllllllLLLLllhhhHHHHHH


DSSP  HHHHLLLEEEEL-----------------------HHHL---LHHHHH-HHHHHLLLLHh
Query HNQTGRPISTHT-----------------------SFST---MGLEQL-ALLQAHGVDLs  179
ident       |   |                                 |      |      | 
Sbjct VEKLDVPFYLHPrnplpqdsriydghpwllgptwaFAQEtavHALRLMaSGLFDEHPRL-  212
DSSP  HHHHLLLEEEELllllhhhlhhhlllhhhlhhhlhHHHHhhhHHHHHHhLLHHHHLLLL-


DSSP  HEEELLLLLLLLHHH---------------------hHHHHHLLLEEEELLLLllllllh
Query RVTVGHCDLKDNLDN---------------------iLKMIDLGAYVQFDTIGknsyypd  218
ident     ||                                                      
Sbjct NIILGHMGEGLPYMMwridhrnawvklpprypakrrfMDYFNENFHITTSGNF-------  265
DSSP  LEEELHHHLLHHHHHhhhhhllllllllllllllllhHHHHHHHEEEELLLLL-------


DSSP  hhHHHHHHHHHHLLLHHHEEELLLLLLhhhlhhhlllLLLHHHhLHHHHHHhllLLHHHH
Query ekRIAMLHALRDRGLLNRVMLSMDITRrshlkanggyGYDYLLtTFIPQLRqsgFSQADV  278
ident   |   |          |   | |               |                 || 
Sbjct --RTQTLIDAILEIGADRILFSTDWPF---------eNIDHAS-DWFNATS---IAEADR  310
DSSP  --LHHHHHHHHLLLLHHHEELLLLLLL---------lLHHHHH-HHHHHLL---LLHHHH


DSSP  HHHHLHHHHHHLL--
Query DVMLRENPSQFFQ--  291
ident     | |    |   
Sbjct VKIGRTNARRLFKld  325
DSSP  HHHHLHHHHHHLLll


No 28: Query=1bf6A Sbjct=3griA Z-score=15.5

back to top
DSSP  -----------------------------------------------llllLLEEEEEEL
Query -----------------------------------------------sfdpTGYTLAHEH   13
ident                                                     |    | |
Sbjct xklikngkvlqngelqqadilidgkvikqiapaiepsngvdiidakghfvsPGFVDVHVH   60
DSSP  leeeelleeeelleeeeleeeeelleeeeeellllllllleeeelllleeeELEEEEEEL


DSSP  LLEElhhhhllhhhEELLhhHHHHHHHHHHHLLEEEEEELLLhHHLL--------LHHHH
Query LHIDlsgfknnvdcRLDQyaFICQEMNDLMTRGVRNVIEMTNrYMGR--------NAQFM   65
ident |                    |          |   |    |                  
Sbjct LREP----------GGEYkeTIETGTKAAARGGFTTVCPXPNtRPVPdsvehfeaLQKLI  110
DSSP  LLLL----------LLLLllLHHHHHHHHHHLLEEEEEELLLlLLLLllhhhhhhHHHHH


DSSP  HHHHhhhLLEEEEEELL---LLHHhlllhhhhllhhhHHHHHHHHHHlllllllLLEEEE
Query LDVMretGINVVACTGY---YQDAffpehvatrsvqeLAQEMVDEIEqgidgteLKAGII  122
ident  |        |                                             |   
Sbjct DDNA---QVRVLPYASIttrQLGK-------------ELVDFPALVK-------EGAFAF  147
DSSP  HHHL---LLEELLLEELlhhHLLL-------------LLLLHHHHHL-------LLLLLE


DSSP  EeEELLlllllhHHHHHHHHHHHHHHHHLLLEEEELH-----------------------
Query AeIGTSegkitpLEEKVFIAAALAHNQTGRPISTHTS-----------------------  159
ident                                |  |                         
Sbjct T-DDGV----gvQTASXXYEGXIEAAKVNKAIVAHCEdnsliyggaxhegkrskelgipg  202
DSSP  E-ELLL----llLLHHHHHHHHHHHHHHLLLEEELLLlhhhllllleellhhhhhhllle


DSSP  ----HHLL-HHHHHHHHHHLLLlhhHEEELLLLlllLHHHHHHHHHLL-----LEEEElL
Query ----FSTM-GLEQLALLQAHGVdlsRVTVGHCDlkdNLDNILKMIDLG-----AYVQFdT  209
ident                |  | |       | |              |             |
Sbjct ipniCESVqIARDVLLAEAAGC---HYHVCHVS---TKESVRVIRDAKragihVTAEV-T  255
DSSP  ellhHHHHhHHHHHHHHHHHLL---LEEELLLL---LHHHHHHHHHHHhllllEEEEE-L


DSSP  LLL-----------------llLLLHHHHHHHHHHHHhlLLHHHEEELLLLLLHH-----
Query IGK-----------------nsYYPDEKRIAMLHALRdrGLLNRVMLSMDITRRS-----  247
ident                                 |                |          
Sbjct PHHlllteddipgnnaiykxnpPLRSTEDREALLEGL--LDGTIDCIATDHAPHArdeka  313
DSSP  HHHhhllhhhlllllhhhllllLLLLHHHHHHHHHHH--HLLLLLEELLLLLLLLhhhhl


DSSP  --hlhhhllLLLL-HHHHLHHHHHH-HLLLLHHHHHHHHLHHHHHHLL------------
Query --hlkanggYGYD-YLLTTFIPQLR-QSGFSQADVDVMLRENPSQFFQ------------  291
ident                                       |   |   |             
Sbjct qpxekapfgIVGSeTAFPLLYTHFVkNGDWTLQQLVDYLTIKPCETFNleygtlkengya  373
DSSP  lllllllllLLLLlLHHHHHHHHHLlLLLLLHHHHHHHHLHHHHHHLLllllllllllll


DSSP  -------------------------------------------------
Query -------------------------------------------------  291
ident                                                  
Sbjct dltiidldseqeikgedflskadntpfigykvygnpiltxvegevkfeg  422
DSSP  leeeeelllleellhhhllllllllllllleelleeeeeeelleeeeel


No 29: Query=1bf6A Sbjct=2ogjA Z-score=15.5

back to top
DSSP  ---------------------------------------------------llllLLEEE
Query ---------------------------------------------------sfdpTGYTL    9
ident                                                         |   
Sbjct qapilltnvkpvgfgkgasqsstdiliggdgkiaavgsalqapadtqridaafisPGWVD   60
DSSP  llleeeeeeeellllllllllleeeeellllleeeeelllllllleeelllleeeELEEE


DSSP  EEELLLEElhhhhllhhHEELlhhhHHHH-HHHHHhllEEEEEE-LLLH--hhllLHHHH
Query AHEHLHIDlsgfknnvdCRLDqyafICQE-MNDLMtrgVRNVIE-MTNR--ymgrNAQFM   65
ident  | |                        |         |                     
Sbjct LHVHIWHG--------gTDIS---iRPSEcGAERG---VTTLVDaGSAGeanfhgFREYI  106
DSSP  EEELLLLL--------lLLLL---lLHHHlLHHHL---EEEEEEeLLLLlllhhhHHHHL


DSSP  HHHHhhhLLEEEEEELLL--------lhHHLLlhHHHLlhhhHHHHHHHHHHLLlllllL
Query LDVMretGINVVACTGYY--------qdAFFPehVATRsvqeLAQEMVDEIEQGidgteL  117
ident             |                                               
Sbjct IEPS---RERIKAFLNLGsiglvacnrvPELR--DIKD---iDLDRILECYAEN----sE  154
DSSP  LLLL---LLEEEEEEELLllllllllllLLLL--LHHH---lLHHHHHHHHHLL----lL


DSSP  LEEEEEeEELLLllLLHHHHHHHHHHHHHHHHHLLLEEEELHH-hlLHHHHHHHHhhlll
Query KAGIIAeIGTSEgkITPLEEKVFIAAALAHNQTGRPISTHTSF-stMGLEQLALLqahgv  176
ident           |                        |   |         | |  |     
Sbjct HIVGLX-VRASHviTGSWGVTPVKLGKKIAKILKVPXXVHVGEppaLYDEVLEIL-----  208
DSSP  LEEEEE-EEELHhhHLLLLLHHHHHHHHHHHHHLLLEEEEELLlllLHHHHHHHL-----


DSSP  lHHHEEELLLLLL----LLHH---HHHHHHHLL-LEEEELLLLLlllllhhhHHHHHHHH
Query dLSRVTVGHCDLK----DNLD---NILKMIDLG-AYVQFDTIGKnsyypdekRIAMLHAL  228
ident       | ||                                |               | 
Sbjct -GPGDVVTHCFNGksgsSIXEdedLFNLAERCEgIRLDIGHGGA------sfSFKVAEAA  261
DSSP  -LLLLEEELLLLLllllLLLLlhhHHHHHHHLLlLEEELLLLLL------llLHHHHHHH


DSSP  HHLLLHhHEEELLLLLlHHHLhhhLLLLlLHHHhLHHHHHHHLLLLHHHHHHHHLHHHHH
Query RDRGLLnRVMLSMDITrRSHLkanGGYGyDYLLtTFIPQLRQSGFSQADVDVMLRENPSQ  288
ident   ||||     | |                 |  |    |         |      ||  
Sbjct IARGLL-PFSISTDLH-GHSX---NFPV-WDLA-TTXSKLLSVDXPFENVVEAVTRNPAS  314
DSSP  HHLLLL-LLLLLLLLL-LLLL---LLLL-LLHH-HHHHHHHHLLLLHHHHHHLLLHHHHH


DSSP  HLL---------------------------------------------------------
Query FFQ---------------------------------------------------------  291
ident                                                             
Sbjct VIRldxenrldvgqradftvfdlvdadleatdsngdvsrlkrlfepryavigaeaiaasr  374
DSSP  HLLllllllllllllleeeeeeeeeeeeeeellllleeeeeeeeeeeeeeelleeeelll


DSSP  -----
Query -----  291
ident      
Sbjct yipra  379
DSSP  lllll


No 30: Query=1bf6A Sbjct=2imrA Z-score=15.5

back to top
DSSP  --------------------------------------------------llllLLEEEE
Query --------------------------------------------------sfdpTGYTLA   10
ident                                                            |
Sbjct htprlltcdvlytgaqspggvvvvgetvaaaghpdelrrqyphaaeeragaviaPPPVNA   60
DSSP  lleeeeeeleeelleelleeeeeelleeeeeelhhhhhhhlllleeeellleelLLLLEE


DSSP  EELLLEE--LHHH--------hlLHHHE-ELLHHHHHHHHHHHHHLLEEEEEELLLHhhl
Query HEHLHID--LSGF--------knNVDCR-LDQYAFICQEMNDLMTRGVRNVIEMTNRymg   59
ident | ||                       | |   |        |   |   |         
Sbjct HTHLDMSayEFQAlpyfqwipevVIRGRhLRGVAAAQAGADTLTRLGAGGVGDIVWA--p  118
DSSP  EEELLLLhhHHHHlhhhhllhhhHHHHLlLLHHHHHHHHHHHHHHLLLLLEEEEELL--h


DSSP  lLHHHHHHHHhhhLLEEEEEELLLLHhhlllhHHHLlHHHHHHHHHHHHHLLLllLLLL-
Query rNAQFMLDVMretGINVVACTGYYQDaffpehVATRsVQELAQEMVDEIEQGIdgTELK-  118
ident       |                                |         |          
Sbjct eVMDALLARE---DLSGTLYFEVLNP------FPDK-ADEVFAAARTHLERWR--RLERp  166
DSSP  hHHHHHHLLL---LLLEEEEEEELLL------LHHH-HHHHHHHHHHHHHHHH--LLLLl


DSSP  --eEEEEEEELLlllllhhHHHHHHHHHHHHHHHLLLEEEELHH----------------
Query --aGIIAEIGTSegkitplEEKVFIAAALAHNQTGRPISTHTSF----------------  160
ident                                   | |   |                   
Sbjct glrLGLSPHTPF-----tvSHRLMRLLSDYAAGEGLPLQIHVAEhptelemfrtgggplw  221
DSSP  leeEEEEELLLL-----llLHHHHHHHHHHHHHHLLLLEEEELLlhhhhhhhhhlllllh


DSSP  -----------------------hLLHHHHHHHHHhllllHHHEEELLLLlLLLHHHHHH
Query -----------------------sTMGLEQLALLQahgvdLSRVTVGHCDlKDNLDNILK  197
ident                         |       |         | |  |       | |  
Sbjct dnrmpalyphtlaevigrepgpdlTPVRYLDELGV----lAARPTLVHMV-NVTPDDIAR  276
DSSP  hhllhhhllllhhhhhllllllllLHHHHHHHHLL----hHHLLEEEELL-LLLHHHHHH


DSSP  HHHLLLEEEeLLLL--LLLLLLHhhhhhHHHHHHhLLLHhHEEELLLLLLhhhlhhhllL
Query MIDLGAYVQfDTIG--KNSYYPDekriaMLHALRdRGLLnRVMLSMDITRrshlkanggY  255
ident     |  |                       |         | |  |             
Sbjct VARAGCAVV-TCPRsnHHLECGT----fDWPAFA-AAGV-EVALGTDSVA-------sgE  322
DSSP  HHHHLLLEE-ELHHhhHHLLLLL----lLHHHHH-HLLL-LEEELLLLHH-------hhL


DSSP  LLL--HHHHlHHHHHHhLLLLHHHHHHHHLHHHHHHLL----------------------
Query GYD--YLLTtFIPQLRqSGFSQADVDVMLRENPSQFFQ----------------------  291
ident         | |  ||   |                                         
Sbjct TLNvrEEVT-FARQLY-PGLDPRVLVRAAVKGGQRVVGtpflrrgetwqegfrwelsrdl  380
DSSP  LLLlhHHHH-HHHHHL-LLLLHHHHHHHHHHHHHHHHLlllllllllllhhhlhhhllll


No 31: Query=1bf6A Sbjct=3e74A Z-score=15.3

back to top
DSSP  -----------------------------------------------llllLLEEEEEEL
Query -----------------------------------------------sfdpTGYTLAHEH   13
ident                                                     |   || |
Sbjct sfdliikngtvilenearvvdiavkggkiaaigqdlgdakevxdasglvvsPGXVDAHTH   60
DSSP  leeeeeelleeelllleeeleeeeelleeeeeellllleeeeeelllleeeELEEEEEEL


DSSP  LleelhhhhllhhheellhhHHHHHHHHHHHLLEEEEEELLLhhHLLL--------HHHH
Query LhidlsgfknnvdcrldqyaFICQEMNDLMTRGVRNVIEMTNryMGRN--------AQFM   65
ident                                 |    ||                     
Sbjct I-------------------GYETGTRAAAKGGITTXIEXPL--NQLPatvdrasiELKF   99
DSSP  L-------------------LHHHHHHHHHHLLEEEEEELLL--LLLLllllhhhhHHHH


DSSP  HHHHHHHLLEEEEEELLllhhhlllhhhhllhhHHHHHHHHHHHLlllllllLEEEEeEE
Query LDVMRETGINVVACTGYyqdaffpehvatrsvqELAQEMVDEIEQgidgtelKAGIIaEI  125
ident         |      |                           |                
Sbjct DAAKGKLTIDAAQLGGL--------------vsYNIDRLHELDEV-------GVVGF-XC  137
DSSP  HHHLLLLLLEEEELEEL--------------llLLLLLHHHHHHH-------LLLLE-EE


DSSP  ELllllllhhHHHHHHHHHHHHHHHLLLEEEELH--------------------------
Query GTsegkitplEEKVFIAAALAHNQTGRPISTHTS--------------------------  159
ident               |   |      | |   |                            
Sbjct FV-----rdvNDWQFFKGAQKLGELGQPVLVHCEnalicdelgeeakregrvtahdyvas  192
DSSP  EL-----lllLHHHHHHHHHHHHHHLLLEEEELLlhhhhhhhhhhhhhhllllhhhhhhl


DSSP  -----HHLLHHHHHHHHHHLLLlhhHEEELLLLlllLHHHHHHHHHLL-----LEEEElL
Query -----FSTMGLEQLALLQAHGVdlsRVTVGHCDlkdNLDNILKMIDLG-----AYVQFdT  209
ident              | |    |    |  | |                             
Sbjct rpvftEVEAIRRVLYLAKVAGC---RLHVCHVS---SPEGVEEVTRARqegqdITCES-C  245
DSSP  llhhhHHHHHHHHHHHHHHHLL---LEEELLLL---LHHHHHHHHHHHhllllEEEEE-L


DSSP  LLL-----------------llLLLHH-HHHHHHHHHHHlllHHHEEELLLLLLHH----
Query IGK-----------------nsYYPDE-KRIAMLHALRDrglLNRVMLSMDITRRS----  247
ident                          |          |          |  |         
Sbjct PHYfvldtdqfeeigtlakcspPIRDLeNQKGXWEKLFN---GEIDCLVSDHSPCPpexk  302
DSSP  LHHhhllhhhhhhhlhhhllllLLLLHhHHHHHHHHHHL---LLLLEELLLLLLLLllll


DSSP  ----hlhhhllLLLLHHHHLHHHHHH-HLLLLHHHHHHHHLHHHHHHLL-----------
Query ----hlkanggYGYDYLLTTFIPQLR-QSGFSQADVDVMLRENPSQFFQ-----------  291
ident             |                | |          |    |            
Sbjct agnixkawggiAGLQSCXDVXFDEAVqKRGXSLPXFGKLXATNAADIFGlqqkgriapgk  362
DSSP  lllllllllllLLHHHHHHHHHHHHLlLLLLLHHHHHHHHLHHHHHHLLlllllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  291
ident                                                             
Sbjct dadfvfiqpnssyvltnddleyrhkvspyvgrtigaritktilrgdviydieqgfpvapk  422
DSSP  llleeeeelllleellhhhllllllllllllleelleeeeeeelleeeeellllllllll


DSSP  -------
Query -------  291
ident        
Sbjct gqfilkh  429
DSSP  lleelll


No 32: Query=1bf6A Sbjct=1a4mA Z-score=15.1

back to top
DSSP  -llllLLEEEEEELLLE----------------------------------------elH
Query -sfdpTGYTLAHEHLHI----------------------------------------dlS   19
ident            | ||                                             
Sbjct tpafnKPKVELHVHLDGaikpetilyfgkkrgialpadtveelrniigmdkplslpgflA   60
DSSP  lllllLLEEEEEEEHHHlllhhhhhhhhhhhllllllllhhhhhhhhlllllllhhhhhL


DSSP  HHHLLH-------hheeLLHHHHHHHHHHHHhllEEEEEELLLHHHL-------------
Query GFKNNV-------dcrlDQYAFICQEMNDLMtrgVRNVIEMTNRYMG-------------   59
ident  |                                |  |                      
Sbjct KFDYYMpviagcreaikRIAYEFVEMKAKEG---VVYVEVRYSPHLLanskvdpmpwnqt  117
DSSP  LHHHHHhhhlllhhhhhHHHHHHHHHHHHLL---EEEEEEEELLHHHllllllllhhhll


DSSP  -----------lLHHHHHHHHHHHLLEEEEEELLLLHHhlllhhhhllhhHHHHHHHHHH
Query -----------rNAQFMLDVMRETGINVVACTGYYQDAffpehvatrsvqELAQEMVDEI  108
ident               |         || |                          |     
Sbjct egdvtpddvvdlVNQGLQEGEQAFGIKVRSILCCMRHQ-----------pSWSLEVLELC  166
DSSP  lllllhhhhhhhHHHHHHHHHHHHLLEEEEEEEEELLL-----------hHHHHHHHHHH


DSSP  HLLlllllLLEEEEEeEELLLLLLLhHHHH-HHHHHHHHHHHHLLLEEEEL-HHHL--LH
Query EQGidgteLKAGIIAeIGTSEGKITpLEEK-VFIAAALAHNQTGRPISTHT-SFST--MG  164
ident                     |              |       |     |          
Sbjct KKY---nqKTVVAMD-LAGDETIEG-SSLFpGHVEAYEGAVKNGIHRTVHAgEVGSpeVV  221
DSSP  HHL---llLLEEEEE-EELLLLLLL-HHHLhHHHHHHHHHHHHLLEEEEEElLLLLhhHH


DSSP  HHHHHHHHhllllhhHEEELLLLllLLHH---HHHHHHHLLLEEEeLLLL--LLLL-LLH
Query LEQLALLQahgvdlsRVTVGHCDlkDNLD---NILKMIDLGAYVQfDTIG--KNSY-YPD  218
ident  |    |           |||                                       
Sbjct REAVDILK-------TERVGHGY--HTIEdeaLYNRLLKENMHFE-VCPWssYLTGaWDP  271
DSSP  HHHHHLLL-------LLEEEELH--HHHHlhhHHHHHHHLLLEEE-ELHHhhHHLLlLLL


DSSP  HHhHHHHHHHHHLLLhhHEEELLLLlLHHHlhhhlLLLLLHHHhLHHHHHhhLLLLHHHH
Query EKrIAMLHALRDRGLlnRVMLSMDItRRSHlkangGYGYDYLLtTFIPQLrqSGFSQADV  278
ident                     |  |               |             ||     
Sbjct KT-THAVVRFKNDKA--NYSLNTDD-PLIF-----KSTLDTDY-QMTKKD--MGFTEEEF  319
DSSP  LL-LLHHHHHHHLLL--LEEELLLL-LLLL-----LLLHHHHH-HHHHHL--LLLLHHHH


DSSP  HHHHlHHHHHHLL------------------
Query DVMLrENPSQFFQ------------------  291
ident       |                        
Sbjct KRLN-INAAKSSFlpeeekkellerlyreyq  349
DSSP  HHHH-HHHHHLLLllhhhhhhhhhhhhhhll


No 33: Query=1bf6A Sbjct=1j6pA Z-score=15.1

back to top
DSSP  ----------------------------------------------llllLLEEEEEELL
Query ----------------------------------------------sfdpTGYTLAHEHL   14
ident                                                         | | 
Sbjct hhxiignclilkdfssepfwgaveiengtikrvlqgevkvdldlsgklvxPALFNTHTHA   60
DSSP  leeeeeeeeelllllllleeeeeeeelleeeeeeelllllleellleeeeELEEEEEELH


DSSP  LE------------------eLHHHHLLhhheeLLHHHHHHHHHHHHHLLEEEEEELLlh
Query HI------------------dLSGFKNNvdcrlDQYAFICQEMNDLMTRGVRNVIEMTnr   56
ident                                    |             |          
Sbjct PXtllrgvaedlsfeewlfskVLPIEDR-ltekXAYYGTILAQXEXARHGIAGFVDXY--  117
DSSP  HHhhhllllllllhhhhhhllHHHHHLL-llhhHHHHHHHHHHHHHHLLLEEEEEEEE--


DSSP  hhlLLHHHHHHHHHHHLLEEEEEELLLlhhhLLLHHhhllhhhhHHHHHHHHhlllllLL
Query ymgRNAQFMLDVMRETGINVVACTGYYqdafFPEHVatrsvqelAQEMVDEIeqgidgTE  116
ident              |  |       |                     |            |
Sbjct ---FHEEWIAKAVRDFGXRALLTRGLV----DSNGD----dggrLEENLKLY------NE  160
DSSP  ---LLHHHHHHHHHHHLLEEEEEEEEL----LLLLL----lllhHHHHHHHH------HH


DSSP  LL------EEEEEEEELLlllllhhHHHHHHHHHHHHHHHLLLEEEELHH----hLLHHH
Query LK------AGIIAEIGTSegkitplEEKVFIAAALAHNQTGRPISTHTSF----sTMGLE  166
ident                           |               |   |             
Sbjct WNgfegriFVGFGPHSPY-----lcSEEYLKRVFDTAKSLNAPVTIHLYEtskeeYDLED  215
DSSP  HLlhhhleEEEEEELLLL-----llLHHHHHHHHHHHHHHLLLEEEEELLlllllLLLHH


DSSP  HHHHHHhlllLHHHEEELLLLlLLLHHHHHHHHHLLLEEEELLLLLL-LLLLHhhhhhHH
Query QLALLQahgvDLSRVTVGHCDlKDNLDNILKMIDLGAYVQFDTIGKN-SYYPDekriaML  225
ident  |                ||             |    |                     
Sbjct ILNIGL----KEVKTIAAHCV-HLPERYFGVLKDIPFFVSHNPASNLkLGNGI----aPV  266
DSSP  HHLLLL----LLLLEEEEELL-LLLHHHHHHHLLLLEEEEELHHHHHhLLLLL----lLH


DSSP  HHHHHLLLhhHEEELLLLLLhhhlhhhllLLLLhHHHLHHHHHH------HLLLLHHHHH
Query HALRDRGLlnRVMLSMDITRrshlkanggYGYDyLLTTFIPQLR------QSGFSQADVD  279
ident       |    | |  |                 |                         
Sbjct QRXIEHGX--KVTLGTDGAA-------snNSLN-LFFEXRLASLlqkaqnPRNLDVNTCL  316
DSSP  HHHHHLLL--EEEELLLLLL-------llLLLL-HHHHHHHHHHhhhlllLLLLLHHHHH


DSSP  HHHLHHHHHHLL------------------------------------------------
Query VMLRENPSQFFQ------------------------------------------------  291
ident         |                                                   
Sbjct KXVTYDGAQAXGfksgkieegwnadlvvidldlpexfpvqniknhlvhafsgevfatxva  376
DSSP  HHHLHHHHHHHLllllllllllllleeeeelllhhhllhhhhhhhhhhllllllleeeel


DSSP  -------------------------------
Query -------------------------------  291
ident                                
Sbjct gkwiyfdgeyptidseevkrelariekelys  407
DSSP  leeeeellllllllhhhhhhhhhhhhhhhhl


No 34: Query=1bf6A Sbjct=4rdvB Z-score=15.0

back to top
DSSP  --------------------------------------------llllLLEEEEEELLLE
Query --------------------------------------------sfdpTGYTLAHEHLHI   16
ident                                                  |    | |   
Sbjct saifaerallpegwarnvrfeisadgvlaeirpdanadgaerlggavlPGMPNLHSHAFQ   60
DSSP  leeeeeeeeelleeeeeeeeeellllleeeeelllllllleelllleeELEEEEEELHHH


DSSP  ----------------elhHHHL-LHHHE----eLLHHHHHHHHHHHHHLLEEEEEELLL
Query ----------------dlsGFKN-NVDCR----lDQYAFICQEMNDLMTRGVRNVIEMTN   55
ident                                         ||        |   | |   
Sbjct ramaglaevagnpndsfwtWRELmYRMVArlspeQIEVIACQLYIEMLKAGYTAVAEFHY  120
DSSP  hhhlllllllllllllhhhHHHHhHHHHLlllhhHHHHHHHHHHHHHHHHLEEEEEEEEL


DSSP  HH----------hllLHHHHHHHHHHHLLEEEEEELLLLHHH--LLLH-hhhllhhhHHH
Query RY----------mgrNAQFMLDVMRETGINVVACTGYYQDAF--FPEH-vatrsvqeLAQ  102
ident                            ||        |  |                   
Sbjct VHhdldgrsyadpaeLSLRISRAASAAGIGLTLLPVLYSHAGfgGQPAsegqrrfinGSE  180
DSSP  LLllllllllllllhHHHHHHHHHHHHLLEEEEEELLLLEEEllLEELlhhhlllllLHH


DSSP  HHHHHHHLLllLLLL----leEEEEEEELLlllllhHHHHHHHHHHHhhHHHL-LLEEEE
Query EMVDEIEQGidGTEL----kaGIIAEIGTSegkitpLEEKVFIAAALahNQTG-RPISTH  157
ident               |                                        |   |
Sbjct AYLELLQRL--RAPLeaaghsLGLCFHSLR-----aVTPQQIATVLA--AGHDdLPVHIH  231
DSSP  HHHHHHHHH--HHHHhhhlleELEEELLLL-----lLLHHHHHHHHL--LLLLlLLEEEE


DSSP  LHH-------------hLLHHHHHHHHHhlllLHHHEEELLLLlLLLHHHHHHHHHLLLE
Query TSF-------------sTMGLEQLALLQahgvDLSRVTVGHCDlKDNLDNILKMIDLGAY  204
ident                                    |    |            |   || 
Sbjct IAEqqkevddcqawsgrRPLQWLYENVA----VDQRWCLVHAT-HADPAEVAAMARSGAV  286
DSSP  ELLlhhhhhhhhhhhllLHHHHHHHHLL----LLLLEEEEELL-LLLHHHHHHHHHHLLE


DSSP  EEELLLL-LLLLLLHhhhhhHHHHHHhLLLHhHEEELLLLllhhhlhhhlllLLLHHHhL
Query VQFDTIG-KNSYYPDekriaMLHALRdRGLLnRVMLSMDItrrshlkanggyGYDYLLtT  263
ident          |                      |     |                     
Sbjct AGLCLSTeANLGDGI----fPATDFL-AQGG-RLGIGSDS-----------hVSLSVV-E  328
DSSP  EEELHHHhHHLLLLL----lLHHHHH-HLLL-EEEELLLL-----------lLLLLHH-H


DSSP  HHHHHHH---------LLLL-------HHHHHHHHLHHHHHHLL----------------
Query FIPQLRQ---------SGFS-------QADVDVMLRENPSQFFQ----------------  291
ident     |                                   |                   
Sbjct ELRWLEYgqrlrdrkrNRLYrddqpmiGRTLYDAALAGGAQALGqpigslavgrradllv  388
DSSP  HHHHHHHhhhhhhlllLLLLllllllhHHHHHHHHHHHHHHHHLllllllllllllleee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  291
ident                                                             
Sbjct ldgndpylasaegdallnrwlfaggdrqvrdvmvagrwvvrdgrhageersarafvqvlg  448
DSSP  ellllhhhhllllhhhhhhhhhhllhhheeeeeelleeeelllllllhhhhhhhhhhhhh


DSSP  ---
Query ---  291
ident    
Sbjct ell  451
DSSP  hhl


No 35: Query=1bf6A Sbjct=4qrnA Z-score=15.0

back to top
DSSP  ---------llllLLEEEEEELlLEEL--HHHHL--------------------------
Query ---------sfdpTGYTLAHEHlHIDL--SGFKN--------------------------   23
ident                     |                                       
Sbjct smtqdlktggeqgYLRIATEEA-FATReiIDVYLrmirdgtadkgmvslwgfyaqspser   59
DSSP  lllllllllllllLLLEEEEEE-ELLHhhHHHHHhhhhhllllhhhhhhhhhhhhlllhh


DSSP  lHHHE---ELLHHHHHHHHHHHHhllEEEEEELL----------------lHHHL--LLH
Query nVDCR---LDQYAFICQEMNDLMtrgVRNVIEMT----------------nRYMG--RNA   62
ident         ||        |           |                            |
Sbjct aTQILerlLDLGERRIADMDATG---IDKAILALtspgvqplhdldeartlATRAndTLA  116
DSSP  hHHHHhhhHLLLHHHHHHHHHLL---LLEEEEEEllllllllllhhhhhhhHHHHhhHHH


DSSP  HHHHHHHhhhlLEEEEEELLllhhhlllhhhhLLHHHHHHHHHHHHHLLllllllLEEEE
Query QFMLDVMretgINVVACTGYyqdaffpehvatRSVQELAQEMVDEIEQGidgtelKAGII  122
ident                                       | |                  |
Sbjct DACQKYP----DRFIGMGTV----------apQDPEWSAREIHRGAREL------GFKGI  156
DSSP  HHHHHLL----LLEEELLLL----------llLLHHHHHHHHHHHHHLL------LLLLE


DSSP  EeEELLllllLHHHH--hhhHHHHHHHHHHLLLEEEELH---------------------
Query AeIGTSegkiTPLEE--kvfIAAALAHNQTGRPISTHTS---------------------  159
ident   |                      |      |   |                       
Sbjct Q-INSH---tQGRYLdeeffDPIFRALVEVDQPLYIHPAtspdsmidpmleagldgaifg  212
DSSP  E-ELLL---lLLLLLllhhhHHHHHHHHHHLLLEEELLLlllllllhhhhhhlllllllh


DSSP  HHLL----HHHHHH-HHHHLLLLHhHEEELLLLLLlLHHH--------------------
Query FSTM----GLEQLA-LLQAHGVDLsRVTVGHCDLKdNLDN--------------------  194
ident |        |             |    |||                             
Sbjct FGVEtgmhLLRLITiGIFDKYPSL-QIMVGHMGEAlPYWLyrldymhqagvrsqryermk  271
DSSP  HHHHhhhhHHHHHHhLHHHHLLLL-LEEELHHHHLhHHHHhhhhhhhhhhhhllllllll


DSSP  -----hHHHHHLLLEEEELLLLllllllhhhHHHHHHHHHHLLLHHHEEELLLLLlhhhl
Query -----iLKMIDLGAYVQFDTIGknsyypdekRIAMLHALRDRGLLNRVMLSMDITrrshl  249
ident                |                              |||  ||       
Sbjct plkktiEGYLKSNVLVTNSGVA---------WEPAIKFCQQVMGEDRVMYAMDYP-----  317
DSSP  lllllhHHHHHHLEEEELLLLL---------LHHHHHHHHHHHLHHHEELLLLLL-----


DSSP  hhhlllLLLHHHhLHHHHHHhllLLHHHHHHHHLHHHHHHLL-
Query kanggyGYDYLLtTFIPQLRqsgFSQADVDVMLRENPSQFFQ-  291
ident                         |          |    |  
Sbjct ----yqYVADEV-RAMDAMD---MSAQTKKKFFQTNAEKWFKl  352
DSSP  ----llLLHHHH-HHHHLLL---LLHHHHHHHHLHHHHHHLLl


No 36: Query=1bf6A Sbjct=1itqA Z-score=14.8

back to top
DSSP  ---------llllLLEEEEEELLL-EELHhhhllHHHE-----elLHHH------HHHHH
Query ---------sfdpTGYTLAHEHLH-IDLSgfknnVDCR-----ldQYAF------ICQEM   39
ident                    |  |    |                                
Sbjct dffrdeaerimrdSPVIDGHNDLPwQLLD-----MFNNrlqderaNLTTlagthtNIPKL   55
DSSP  lhhhhhhhhhhllLLEEEEEELHHhHHHH-----HHLLllllhhhLLLLllllllLHHHH


DSSP  HHHhhlLEEEEEELLL-------------HHHLL--LHHHHHHHhHHHL-----------
Query NDLmtrGVRNVIEMTN-------------RYMGR--NAQFMLDVmRETG-----------   73
ident        |                                      ||            
Sbjct RAG---FVGGQFWSVYtpcdtqnkdavrrTLEQMdvVHRMCRMY-PETFlyvtssagirq  111
DSSP  HHL---LEEEEEEEELllhhhllllhhhhHHHHHhhHHHHHHHL-LLLEeelllhhhhhh


DSSP  ------LEEEEEELLLLhhhlllhhhhllhhHHHHHHHHHHHLlllllllLEEEEeEEEL
Query ------INVVACTGYYQdaffpehvatrsvqELAQEMVDEIEQgidgtelKAGIIaEIGT  127
ident                                                             
Sbjct afregkVASLIGVEGGH-----------sidSSLGVLRALYQL-------GMRYL-TLTH  152
DSSP  hhhlllEEEEEEEELHH-----------hllLLHHHHHHHHHL-------LEEEE-ELLL


DSSP  LLlllLHHH-----------------HHHHHHHHHHHHHHLLLEEEELhhhlLHHHHHHH
Query SEgkiTPLE-----------------EKVFIAAALAHNQTGRPISTHTsfstMGLEQLAL  170
ident |    ||                              |  |  |                
Sbjct SC--nTPWAdnwlvdtgdsepqsqglSPFGQRVVKELNRLGVLIDLAH----VSVATMKA  206
DSSP  LL--lLLLLllhhhllllllllllllLHHHHHHHHHHHHHLLEEELLL----LLHHHHHH


DSSP  HHHlLLLHhHEEELLLL--lLLLH--hHHHHHHHLL----LEEEELlLLLL-----LLLL
Query LQAhGVDLsRVTVGHCD--lKDNL--dNILKMIDLG----AYVQFDtIGKN-----SYYP  217
ident           |   |                   |       |       |         
Sbjct TLQ-LSRA-PVIFSHSSaysVCASrrnVPDDVLRLVkqtdSLVMVN-FYNNyisctNKAN  263
DSSP  HHH-HLLL-LLEELLLLlllLLLLlllLLHHHHHHHhhhlLEEEEL-LLHHhhlllLLLL


DSSP  HHHHHHHHHHHHHLLLHHHEEELLLLLlhhhlhhhllLLLLHHHhLHHHHHHHLLLLHHH
Query DEKRIAMLHALRDRGLLNRVMLSMDITrrshlkanggYGYDYLLtTFIPQLRQSGFSQAD  277
ident        |           |    |                      |  |       | 
Sbjct LSQVADHLDHIKEVAGARAVGFGGDFD-gvprvpeglEDVSKYP-DLIAELLRRNWTEAE  321
DSSP  HHHHHHHHHHHHHHLLHHHEEELLLLL-lllllllllLLLLLHH-HHHHHHHHLLLLHHH


DSSP  HHHHHLHHHHHHLL----------------------------------
Query VDVMLRENPSQFFQ----------------------------------  291
ident |   |  |    |                                   
Sbjct VKGALADNLLRVFEaveqasnltqapeeepipldqlggscrthygyss  369
DSSP  HHHHHLHHHHHHHHhhhhllllllllllllllhhhlllllllllllll


No 37: Query=1bf6A Sbjct=2uz9A Z-score=14.8

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct plahifrgtfvhstwtcpmevlrdhllgvsdsgkivfleeasqqeklakewcfkpceire   60
DSSP  llleeeeeeeeellllllleeeeeeeeeellllleeeeeehhhhhhhhhhhlllhhheee


DSSP  ----llllLLEEEEEELLLE-------------------ELHHhhllhhheelLHHHHHH
Query ----sfdpTGYTLAHEHLHI-------------------DLSGfknnvdcrldQYAFICQ   37
ident          |    | |                                           
Sbjct lshheffmPGLVDTHIHASQysfagssidlpllewltkyTFPA-ehrfqnidfAEEVYTR  119
DSSP  llllleeeELEEEEEEEHHHhhhllllllllhhhhhhhlHHHH-hhhhhlhhhHHHHHHH


DSSP  HHHHHHHLLEEEEEELLLHHhllLHHHHHHHHHHHLLEEEEEELLLLHHhlllhhhhlLH
Query EMNDLMTRGVRNVIEMTNRYmgrNAQFMLDVMRETGINVVACTGYYQDAffpehvatrSV   97
ident         |                    |     |                        
Sbjct VVRRTLKNGTTTACYFATIH-tdSSLLLADITDKFGQRAFVGKVCMDLN-dtfpeykeTT  177
DSSP  HHHHHHHLLEEEEEEELLLL-hhHHHHHHHHHHHHLLEEEEELEELLLL-llllllllLH


DSSP  HHHHHHHHHHHHLLLlLLLL--lEEEEEeEELLlllllhHHHHHHHHHHHHHHHHLLLEE
Query QELAQEMVDEIEQGIdGTEL--kAGIIAeIGTSegkitpLEEKVFIAAALAHNQTGRPIS  155
ident  |   |                   |               |                | 
Sbjct EESIKETERFVSEML-QKNYsrvKPIVTpRFSL-----sCSETLMGELGNIAKTRDLHIQ  231
DSSP  HHHHHHHHHHHHHHH-HHLLlleEEEEEeLLHH-----hLLHHHHHHHHHHHHHHLLEEE


DSSP  EELHH---------------hLLHHHHHHHHhhllllHHHEEELLLLlLLLHHHHHHHHH
Query THTSF---------------sTMGLEQLALLqahgvdLSRVTVGHCDlKDNLDNILKMID  200
ident  | |                                        |               
Sbjct SHISEnrdeveavknlypsykNYTSVYDKNN----llTNKTVMAHGC-YLSAEELNVFHE  286
DSSP  EEELLlhhhhhhhhhhlllllLHHHHHHHLL----llLLLEEEEELL-LLLHHHHHHHHH


DSSP  LLLEEEELLLL-LLLLLLHhhhhhHHHHHHhLLLHhHEEELLLLLlhhhlhhhllLLLL-
Query LGAYVQFDTIG-KNSYYPDekriaMLHALRdRGLLnRVMLSMDITrrshlkanggYGYD-  258
ident  ||                                    |  |            | |  
Sbjct RGASIAHCPNSnLSLSSGF----lNVLEVL-KHEV-KIGLGTDVA--------ggYSYSm  332
DSSP  HLLEEEELHHHhHHLLLLL----lLHHHHH-HLLL-EEEELLLLL--------llLLLLh


DSSP  -HHHHlHHHHHHH---------LLLLHHHHHHHHLHHHHHHLL-----------------
Query -YLLTtFIPQLRQ---------SGFSQADVDVMLRENPSQFFQ-----------------  291
ident                              |        ||                    
Sbjct lDAIR-RAVMVSNillinkvneKSLTLKEVFRLATLGGSQALGldgeignfevgkefdai  391
DSSP  hHHHH-HHHHHHHhhhhlllllLLLLHHHHHHHHLHHHHHHLLlllllllllllllllee


DSSP  -----------------------------------------------------
Query -----------------------------------------------------  291
ident                                                      
Sbjct linpkasdspidlfygdffgdiseaviqkflylgddrnieevyvggkqvvpfs  444
DSSP  eelllllllllllllhhhhlllllhhhhhhhhhllhhheeeeeelleeeelll


No 38: Query=1bf6A Sbjct=3pnuA Z-score=14.7

back to top
DSSP  --------llllLLEEEEEELLLeelhhhhllhhheELLH-HHHHHHHHHHhhllEEEEE
Query --------sfdpTGYTLAHEHLHidlsgfknnvdcrLDQY-AFICQEMNDLmtrgVRNVI   51
ident                   | ||                |    |                
Sbjct enlyfqsnamklKNPLDMHLHLR-------------DNQMlELIAPLSARD----FCAAV   43
DSSP  llllllllleeeELLEEEEELLL-------------LHHHhHHHHHHHHLL----LLEEE


DSSP  ELLLhHHLL-----LHHHHHHHHHHH---LLEEEEEELLllhhhlllhhhhllhhHHHHH
Query EMTNrYMGR-----NAQFMLDVMRET---GINVVACTGYyqdaffpehvatrsvqELAQE  103
ident  | |                                                        
Sbjct IMPNlIPPLcnledLKAYKMRILKACkdeNFTPLMTLFF--------------knYDEKF   89
DSSP  ELLLlLLLLllhhhHHHHHHHHHHHHlllLLEEEEEEEL--------------llLLHHH


DSSP  HHHHHHllllllllLEEEEEeEELL-----llllLHHHHH-hHHHHHHHHHHHLLLEEEE
Query MVDEIEqgidgtelKAGIIAeIGTS-----egkiTPLEEK-vFIAAALAHNQTGRPISTH  157
ident                   |                             |      |   |
Sbjct LYSAKD--------EIFGIX-LYPAgittnsnggVSSFDIeyLKPTLEAMSDLNIPLLVH  140
DSSP  HHHHLL--------LLLEEE-ELLLlllllllllLLLLLHhhHHHHHHHHHHLLLLEEEL


DSSP  LH--------HHLLHHHHHHHHHHLLLLhhHEEELLLLlllLHHHHHHHHHLL-LEEEEl
Query TS--------FSTMGLEQLALLQAHGVDlsRVTVGHCDlkdNLDNILKMIDLG-AYVQFd  208
ident            |        |              |              |    |    
Sbjct GEtndfvmdrESNFAKIYEKLAKHFPRL--KIVMEHIT---TKTLCELLKDYEnLYATI-  194
DSSP  LLllllhhhlLHHHHHHHHHHHHHLLLL--LEEELLLL---LHHHHHHHHHLLlEEEEE-


DSSP  LLLL----------------LLLL---lhhhhHHHHHHHhhlLLHHHEEELLLLLLHHhl
Query TIGK----------------NSYY---pdekrIAMLHALrdrGLLNRVMLSMDITRRShl  249
ident |                                  |  |        ||   |       
Sbjct TLHHliitlddviggkmnphLFCKpiakryedKEALCEL-afSGYEKVMFGSDSAPHPkg  253
DSSP  LLHHhlllhhhhhlllllhhHLLLlllllhhhHHHHHHH-hhLLLLLEEELLLLLLLLll


DSSP  hhhllLLLLHHHHLhHHHHHHLLLLHHHHHHHHLHHHHHHLL------------------
Query kanggYGYDYLLTTfIPQLRQSGFSQADVDVMLRENPSQFFQ------------------  291
ident            |      |     |       |  |                        
Sbjct caagvFSAPVILPV-LAELFKQNSSEENLQKFLSDNTCKIYDlkfkedkiltleekewqv  312
DSSP  lllllLLHHHHHHH-HHHHHHHHLLHHHHHHHHLHHHHHHHLllllllleeeeellleel


DSSP  --------------------------
Query --------------------------  291
ident                           
Sbjct pnvyedkynqvvpymageilkfqlkh  338
DSSP  llleelllleellllllleelleell


No 39: Query=1bf6A Sbjct=3qy6A Z-score=14.6

back to top
DSSP  llllllEEEEEELL--LEELhhhhllhhheELLHHHHHHHHHHHHHLLEEEEEELLL---
Query sfdptgYTLAHEHL--HIDLsgfknnvdcrLDQYAFICQEMNDLMTRGVRNVIEMTN---   55
ident           | |     |               |            | |  |       
Sbjct ------MIDIHCHIlpAMDD---------gAGDSADSIEMARAAVRQGIRTIIATPHhnn   45
DSSP  ------LEELLLLLllLLLL---------lLLLHHHHHHHHHHHHHLLLLEEELLLEell


DSSP  --HHHL--lLHHHHHHHHHHH-----LLEEEEEellllhhhlllhhhhllhhhhhhhhhh
Query --RYMG--rNAQFMLDVMRET-----GINVVACtgyyqdaffpehvatrsvqelaqemvd  106
ident                              |                              
Sbjct gvYKNEpaaVREAADQLNKRLikediPLHVLPG---------------------------   78
DSSP  llLLLLhhhHHHHHHHHHHHHhhlllLLEEELL---------------------------


DSSP  hhhllllllllleeeeEEEELllllllhhHHHHHHHHHHH---hhhhLLLEEEELHH---
Query eieqgidgtelkagiiAEIGTsegkitplEEKVFIAAALA---hnqtGRPISTHTSF---  160
ident                  ||             |    |            |     |   
Sbjct ----------------QEIRI--------YGEVEQDLAKRqllslndTKYILIEFPFdhv  114
DSSP  ----------------LEEEL--------LLLHHHHHHLLllllhhhLLEEEEELLLlll


DSSP  hlLHHHHHHHHHHLLLlhhHEEELLLL-LLLL---HHHHHHHHHLLLEEEElLLLL----
Query stMGLEQLALLQAHGVdlsRVTVGHCD-LKDN---LDNILKMIDLGAYVQFdTIGK----  212
ident           ||  |         |                    ||  |  | |     
Sbjct prYAEQLFYDLQLKGY---IPVIAHPErNREIrenPSLLYHLVEKGAASQI-TSGSlagi  170
DSSP  llLHHHHHHHHHHLLL---EEEEELHHhLHHHhhlLHHHHHHHHLLLEEEE-EHHHhlll


DSSP  LLLLLHHHHHHHHHHHhhlllhhhEEELLLLLLHHhlhhhlLLLLlHHHHlHHHHHHHLl
Query NSYYPDEKRIAMLHALrdrgllnrVMLSMDITRRShlkangGYGYdYLLTtFIPQLRQSg  272
ident               |              |                         |    
Sbjct FGKQLKAFSLRLVEAN------liHFVASDAHNVK------TRNF-HTQE-ALYVLEKE-  215
DSSP  LLHHHHHHHHHHHHLL------llLEEELLLLLLL------LLLL-LHHH-HHHHHHHH-


DSSP  LLHHHHHHHHlHHHHHHLL--------------
Query FSQADVDVMLrENPSQFFQ--------------  291
ident |          ||                    
Sbjct FGSELPYMLT-ENAELLLRnqtifrqppqpvkr  247
DSSP  HLLHHHHHHH-HHHHHHHLllllllllllllll


No 40: Query=1bf6A Sbjct=4ofcA Z-score=14.3

back to top
DSSP  llllllEEEEEELlLEEL-------------------------HHHH----LLHH-heEL
Query sfdptgYTLAHEHlHIDL-------------------------SGFK----NNVD-crLD   30
ident           | |                                 |      |      
Sbjct -----mKIDIHSH-ILPKewpdlkkrfgyggwvqlqhhskgeaKLLKdgkvFRVVrenCW   54
DSSP  -----lLEEEEEE-LLLLllllhhhhhllllleeeeeeelleeEEEElleeEEEEehhHL


DSSP  LHHHHHHHHHHHHhllEEEEEELL----------------lHHHL--LLHHHHHHHHhhh
Query QYAFICQEMNDLMtrgVRNVIEMT----------------nRYMG--RNAQFMLDVMret   72
ident        ||       |      |                         |          
Sbjct DPEVRIREMDQKG---VTVQALSTvpvmfsywakpedtlnlCQLLnnDLASTVVSYP---  108
DSSP  LHHHHHHHHHHHL---LLEEEEELlhhhhlllllhhhhhhhHHHHhhHHHHHHHHLL---


DSSP  lLEEEEEELLllhhhlllhhhhLLHHHHHHHHHHHHHLLllllllLEEEEEeEELLlllL
Query gINVVACTGYyqdaffpehvatRSVQELAQEMVDEIEQGidgtelKAGIIAeIGTSegkI  132
ident     |                         ||                    |||     
Sbjct -RRFVGLGTL----------pmQAPELAVKEMERCVKEL------GFPGVQ-IGTH---V  147
DSSP  -LLEEEEELL----------llLLHHHHHHHHHHHHHLL------LLLEEE-EELE---E


DSSP  LHH---HHHHhHHHHHHHHHHLLLEEEEL-------------------HHHL--LHHHHH
Query TPL---EEKVfIAAALAHNQTGRPISTHT-------------------SFST--MGLEQL  168
ident                 |          |                                
Sbjct NEWdlnAQEL-FPVYAAAERLKCSLFVHPwdmqmdgrmakywlpwlvgMPAEttIAICSM  206
DSSP  LLEellLHHH-HHHHHHHHHHLLEEEEELllllllhhhhlllhhhhlhHHHHhhHHHHHH


DSSP  H--HHHHLLLLHhHEEELLLLLLlLHHH--------------------hhhhhHLLLEEE
Query A--LLQAHGVDLsRVTVGHCDLKdNLDN--------------------ilkmiDLGAYVQ  206
ident            |  |   |                                      |  
Sbjct ImgGVFEKFPKL-KVCFAHGGGAfPFTVgrishgfsmrpdlcaqdnpmnpkkyLGSFYTD  265
DSSP  HllLHHHHLLLL-LEEELHHHLLhHHHHhhhhhhhhhlhhhhlllllllhhhhLLLLEEE


DSSP  ELlllllllllhhhHHHHHHHHHHLlLHHHEEELLLLLLhhhlhhhllllLLHHHhLHHH
Query FDtigknsyypdekRIAMLHALRDRgLLNRVMLSMDITRrshlkanggygYDYLLtTFIP  266
ident                   |  | |      | |  |                      | 
Sbjct AL----------vhDPLSLKLLTDViGKDKVILGTDYPF--------plgELEPG-KLIE  306
DSSP  LL----------llLHHHHHHHHHHhLLLLEELLLLLLL--------lllLLLLL-HHHH


DSSP  HHhhLLLLHHHHHHHHLHHHHHHLL------
Query QLrqSGFSQADVDVMLRENPSQFFQ------  291
ident       |           |   |        
Sbjct SM--EEFDEETKNKLKAGNALAFLGlerkqf  335
DSSP  HL--LLLLHHHHHHHHLHHHHHHHLllhhhl


No 41: Query=1bf6A Sbjct=3icjA Z-score=14.3

back to top
DSSP  -------------------------------------------------------llllL
Query -------------------------------------------------------sfdpT    5
ident                                                             
Sbjct cmkalingtiytsfspvkkvsglvisnervlyagdsstalriaelaggeiidlkgkfvmP   60
DSSP  leeeeelleeeeeelleeeeleeeeelleeeeeelhhhhhhhhhhhlleeeelllleeeE


DSSP  LEEEEEELLLE-------------------------------------------------
Query GYTLAHEHLHI-------------------------------------------------   16
ident      | ||                                                   
Sbjct AFFDSHLHLDElgmslemvdlrgvksmeelvervkkgrgriifgfgwdqdelgrwptred  120
DSSP  LEEEEEELHHHhhhhhhleellllllhhhhhhhhhlllllleeeeeelhhhhlllllhhh


DSSP  --------------------------------------------elhHHHL-LHHH----
Query --------------------------------------------dlsGFKN-NVDC----   27
ident                                                             
Sbjct ldvidrpvflyrrcfhvavmnskmidllnlkpskdfdestgivreraLEESrKIINekil  180
DSSP  hlllllleeeeelllleeeelhhhhhhhllllllleelllleeehhhHHHHhHHHHhlll


DSSP  -eelLHHHHHHHHHHHHHLLEEEEEELLLHhhLLLHHHHHHHH--HHHLLEEEEEELLll
Query -rldQYAFICQEMNDLMTRGVRNVIEMTNRymGRNAQFMLDVM--RETGINVVACTGYyq   84
ident         |      |   ||  |  |                       || |      
Sbjct tvkdYKHYIESAQEHLLSLGVHSVGFMSVG--EKALKALFELEreGRLKMNVFAYLSP--  236
DSSP  lhhhHHHHHHHHHHHHHHLLEEEEEEEEEL--HHHHHHHHHHHhlLLLLLEEEEEELH--


DSSP  hhhlllhhhhllhhhhhhHHHHHHHL----llllllllEEEEEeEELLL-----------
Query daffpehvatrsvqelaqEMVDEIEQ----gidgtelkAGIIAeIGTSE-----------  129
ident                   |  |  |                                   
Sbjct ------------------ELLDKLEElnlgkfegrrlrIWGVX-LFVDGslgartallse  277
DSSP  ------------------HHHHHHHHhlllleellleeEEEEE-EELLLlllllllllll


DSSP  ----------LLLLhhHHHHHHHHHHHHHHHLLLEEEELHHHLLHHHHHHHHHHlLLLHh
Query ----------GKITplEEKVFIAAALAHNQTGRPISTHTSFSTMGLEQLALLQAhGVDLs  179
ident                                |     |          |           
Sbjct pytdnpttsgELVM--NKDEIVEVIERAKPLGLDVAVHAIGDKAVDVALDAFEE-AEFS-  333
DSSP  llllllllllLLLL--LHHHHHHHHHHHLLLLLEEEEEELLHHHHHHHHHHHHH-HLLL-


DSSP  hEEELLLLllLLHH-HHHHHHHLLLEEEElLLLL---LLLL------lhhhhhhHHHHHH
Query rVTVGHCDlkDNLD-NILKMIDLGAYVQFdTIGK---NSYY------pdekriaMLHALR  229
ident      |       |        |                                |  | 
Sbjct -GRIEHAS--LVRDdQLERIKELKVRISA-QPHFivsDWWIvnrvgeerakwayRLKTLS  389
DSSP  -LEEEELL--LLLHhHHHHHHHHLLEEEE-LLLHhhhLLLHhhhhhhhhhhhllLHHHHH


DSSP  hllLHHHEEELLLLLlhhhlhhhllllLLHHHhLHHHHHHHL-------LLLHHHHHHHH
Query drgLLNRVMLSMDITrrshlkanggygYDYLLtTFIPQLRQS-------GFSQADVDVML  282
ident           | |                      |               |        
Sbjct ---SITKLGFSTDSP----------iePADPW-VSIDAAVNRyvvdpgeRVSREEALHLY  435
DSSP  ---HHLLEEELLLLL----------llLLLHH-HHHHHHHHLllllhhhLLLHHHHHHHL


DSSP  LHHHHHHLL------------------------
Query RENPSQFFQ------------------------  291
ident      |                           
Sbjct THGSAQVTLaedlgklergfraeyiildrdplk  468
DSSP  LHHHHHHLLlllllllllllllleeeellllll


No 42: Query=1bf6A Sbjct=2gwgA Z-score=14.3

back to top
DSSP  lllllLEEEEEELLL---eeLHHHHL-----------------lhhheelLHHHHHHH-H
Query sfdptGYTLAHEHLH---idLSGFKN-----------------nvdcrldQYAFICQE-M   39
ident           | |       |    |                          | |     
Sbjct -----XIIDIHGHYTtapkaLEDWRNrqiagikdpsvxpkvselkisddeLQASIIENqL   55
DSSP  -----LLEEEEEELLlllhhHHHHHHhhhhhhhlhhhlllhhhllllhhhHHHHHHLLhH


DSSP  HHHHHLLEEEEEELL----------lHHHLL--LHHHHHHHHhhhlLEEEEEELLllhhh
Query NDLMTRGVRNVIEMT----------nRYMGR--NAQFMLDVMretgINVVACTGYyqdaf   87
ident      ||                                        |            
Sbjct KKXQERGSDLTVFSPragdfnvsstwAAICNelCYRVSQLFP----DNFIGAAXL-----  106
DSSP  HHHHHHLLLEEEEELllllhhhhhhhHHHHHhhHHHHHHHLL----LLEEEEEEL-----


DSSP  lllhHHHLLHHHHHHHHHHHHHLLllllllLEEEEEeEELL--LLLLLHHHH--hhHHHH
Query fpehVATRSVQELAQEMVDEIEQGidgtelKAGIIAeIGTS--EGKITPLEE--kvFIAA  143
ident                |                  |         |  |            
Sbjct --pqSPGVDPKTCIPELEKCVKEY------GFVAIN-LNPDpsGGHWTSPPLtdriWYPI  157
DSSP  --llLLLLLHHHHHHHHHHHHHLL------LLLEEE-ELLLllLLLLLLLLLllhhHHHH


DSSP  HHHHHHHLLLEEEEL----HHHLLHHHHHHH-----hHHLLLLHhHEEELLLLLLlLHHH
Query ALAHNQTGRPISTHT----SFSTMGLEQLAL-----lQAHGVDLsRVTVGHCDLKdNLDN  194
ident          |   |                             |      |         
Sbjct YEKXVELEIPAXIHVstgaHYLNADTTAFXQcvagdlFKDFPEL-KFVIPHGGGAvPYHW  216
DSSP  HHHHHHHLLLEEELLllllHHHHHHHHHHHHhhhllhHHHLLLL-LEEELHHHLLlHHHH


DSSP  ---------------hhHHHHlLLEEEELLLllllllLHHHHHHHHHHHhhllLHHHEEE
Query ---------------ilKMIDlGAYVQFDTIgknsyyPDEKRIAMLHALrdrgLLNRVML  239
ident                                                          |  
Sbjct grfrglaqexkkplledHVLN-NIFFDTCVY------HQPGIDLLNTVI----PVDNVLF  265
DSSP  hhhhhhhhhlllllhhhHLLL-LEEEELLLL------LHHHHHHHHHHL----LHHHEEL


DSSP  LLLLLLhhHLHH---hlllllLHHHhlHHHHHhhLLLLHHHHHHHHLHHHHHHLL-----
Query SMDITRrsHLKA---nggygyDYLLttFIPQLrqSGFSQADVDVMLRENPSQFFQ-----  291
ident                      |      |                   |           
Sbjct ASEXIG-aVRGIdprtgfyydDTKR--YIEAS--TILTPEEKQQIYEGNARRVYPrldaa  320
DSSP  LLLLLL-lLLLEelllleellLLHH--HHHHL--LLLLHHHHHHHHLHHHHHHLHhhhhh


DSSP  ---------
Query ---------  291
ident          
Sbjct lkakgkleh  329
DSSP  hhhhhhhll


No 43: Query=1bf6A Sbjct=4hk5D Z-score=14.1

back to top
DSSP  llllLLEEEEEELLLE--ELHHHHL-----------------------------------
Query sfdpTGYTLAHEHLHI--DLSGFKN-----------------------------------   23
ident           | |                                               
Sbjct ---tPVVVDIHTHMYPpsYIAMLEKrqtiplvrtfpqadeprlillsselaaldaaladp   57
DSSP  ---lLLLEEEEEEELLhhHHHHHHLllllleeeeelleeeeeeellhhhhhhhhhhhhll


DSSP  ------LHHH-eELLHHHHHHHHHHHHhllEEEEEELL---------------lHHHL--
Query ------NVDC-rLDQYAFICQEMNDLMtrgVRNVIEMT---------------nRYMG--   59
ident                 |     |        |                            
Sbjct aaklpgRPLSthFASLAQKMHFMDTNG---IRVSVISLanpwfdflapdeapgiADAVna  114
DSSP  llllllEELLhhHLLHHHHHHHHHHLL---LLEEEEEEllllllllllllhhhhHHHHhh


DSSP  LLHHHHHHHHhhhlLEEEEEELLllhhhlllhHHHLlHHHHHHHHHHHHHLllllllLLE
Query RNAQFMLDVMretgINVVACTGYyqdaffpehVATRsVQELAQEMVDEIEQgidgteLKA  119
ident                                      |                      
Sbjct EFSDMCAQHV----GRLFFFAAL--------pLSAP-VDAVKASIERVKNL------KYC  155
DSSP  HHHHHHHLLL----LLEEEEEEL--------lLLLL-HHHHHHHHHHHHLL------LLE


DSSP  EEEEeEELL--llLLLHhhHHHHHHHHHHHHhHLLLEEEEL-------------------
Query GIIAeIGTS--egKITPleEKVFIAAALAHNqTGRPISTHT-------------------  158
ident   |   |||                              |                    
Sbjct RGII-LGTSglgkGLDD--PHLLPVFEAVAD-AKLLVFLHPhyglpnevygprseeyghv  211
DSSP  EEEE-ELLLllllLLLL--HHHHHHHHHHHH-LLLEEEELLlllllhhhhlllhhhlllh


DSSP  ---------HHHLLHHHHH--HHHHHLLLLhhHEEELLLLLLlLHHH-------------
Query ---------SFSTMGLEQL--ALLQAHGVDlsRVTVGHCDLKdNLDN-------------  194
ident                                      |                      
Sbjct lplalgfpmETTIAVARMYmaGVFDHVRNL--QMLLAHSGGTlPFLAgriescivhdghl  269
DSSP  hhhhlhhhhHHHHHHHHHHhlLHHHHLLLL--LEEEHHHHLLhHHHHhhhhhhhhllhhh


DSSP  ------------hHHHHHLLLEEEELlllllllllhhhHHHHHHHHHHllLHHHEEELLL
Query ------------iLKMIDLGAYVQFDtigknsyypdekRIAMLHALRDrgLLNRVMLSMD  242
ident                      |                    | |        | |   |
Sbjct vktgkvpkdrrtiWTVLKEQIYLDAV----------iySEVGLQAAIAssGADRLMFGTD  319
DSSP  hhllllllllllhHHHHHHLEEEELL----------llLHHHHHHHHHhhLHHHEELLLL


DSSP  LLLhhHLHH---HLLLLlLHHHhLHHHHHHhLLLL--HHHHHHHHLHHHHHHLL------
Query ITRrsHLKA---NGGYGyDYLLtTFIPQLRqSGFS--QADVDVMLRENPSQFFQ------  291
ident               |   |                    |       |            
Sbjct HPF--FPPIeedVQGPW-DSSR-LNAQAVI-KAVGegSSDAAAVMGLNAVRVLSlkaele  374
DSSP  LLL--LLLLlllLLLLL-HHHH-HHHHHHH-HHHLllLHHHHHHHLHHHHHHLLlhhhhh


DSSP  ------
Query ------  291
ident       
Sbjct hhhhhh  380
DSSP  hhhhhl


No 44: Query=1bf6A Sbjct=1j5sA Z-score=14.0

back to top
DSSP  --------------------llllLLEEEEEELLLeelhhhhllhhheeLLHHH------
Query --------------------sfdpTGYTLAHEHLHidlsgfknnvdcrlDQYAF------   34
ident                               | ||               |          
Sbjct hmflgedylltnraavrlfnevkdLPIVDPHNHLD------------akDIVENkpwndi   48
DSSP  llllllllllllhhhhhhhhhhllLLEEELLLLLL------------hhHHHHLlllllh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------   34
ident                                                             
Sbjct wevegatdhyvwelmrrcgvseeyitgsrsnkekwlalakvfprfvgnptyewihldlwr  108
DSSP  hhhhllllhhhhhhhhhllllhhhllllllhhhhhhhhhhhhhhhlllhhhhhhhhhhhh


DSSP  ----------------------------HHHHHHHHHhllEEEEEELLLHHhlLLHHHHH
Query ----------------------------ICQEMNDLMtrgVRNVIEMTNRYmgRNAQFML   66
ident                                   |     |                   
Sbjct rfnikkviseetaeeiweetkkklpemtPQKLLRDMK---VEILCTTDDPV--STLEHHR  163
DSSP  hllllllllhhhhhhhhhhhhhhlllllHHHHHHHLL---EEEEELLLLLL--LLLHHHH


DSSP  HHHH-HHLLEEEEEELLL--LHHH---lLLHH-------------HHLLHHHHHHHHHHH
Query DVMR-ETGINVVACTGYY--QDAF---fPEHV-------------ATRSVQELAQEMVDE  107
ident        |                     | |                    |       
Sbjct KAKEaVEGVTILPTWRPDraMNVDkegwREYVekmgerygedtstLDGFLNALWKSHEHF  223
DSSP  HHHHhLLLLEEELLLLLHhhHLLLlllhHHHHhhhhhhhllllllHHHHHHHHHHHHHHH


DSSP  HHlllllllLLEEEEeEEELlLLLL---------------------------LHHHHHHH
Query IEqgidgteLKAGIIaEIGTsEGKI---------------------------TPLEEKVF  140
ident  |                                                          
Sbjct KE-------HGCVAS-DHAL-LEPSvyyvdenraravhekafsgekltqdeiNDYKAFMM  274
DSSP  HL-------LLLLEE-EEEE-LLLLlllllhhhhhhhhhhhlllllllhhhhHHHHHHHH


DSSP  HHHHHHHHHHLLLEEEELHH-----------------------hLLHHHhHHHHHHLLLL
Query IAAALAHNQTGRPISTHTSF-----------------------sTMGLEqLALLQAHGVD  177
ident          |      |                               | |         
Sbjct VQFGKMNQETNWVTQLHIGAlrdyrdslfktlgpdsggdistnfLRIAEgLRYFLNEFDG  334
DSSP  HHHHHHHHHHLLEEEEEELEellllhhhhhhlllllllleelllLLHHHhHHHHHHHLLL


DSSP  hhHEEElLLLLLLLHHH-HHHHHHLL-LEEEELLlllllLLLH-HHHHHHHHHHHHLLLH
Query lsRVTVgHCDLKDNLDN-ILKMIDLG-AYVQFDTigknsYYPD-EKRIAMLHALRDRGLL  234
ident               |             ||                    |  |    ||
Sbjct klKIVL-YVLDPTHLPTiSTIARAFPnVYVGAPW----wFNDSpFGMEMHLKYLASVDLL  389
DSSP  llLEEE-EELLHHHHHHhHHHHHHLLlEEELLLL----lLLLLhHHHHHHHHHHHLLLLH


DSSP  HHE-EELLLLLLhhhlhhhllLLLLHHHHLHHHHHHhLLLL-------------HHHHHH
Query NRV-MLSMDITRrshlkanggYGYDYLLTTFIPQLRqSGFS-------------QADVDV  280
ident         |                     |   |                      |  
Sbjct YNLaGMVTDSRK--------lLSFGSRTEMFRRVLS-NVVGemvekgqipikeaRELVKH  440
DSSP  HHLlLLLLLLLL--------lLHHHHHHHHHHHHHH-HHHHhhhhlllllhhhhHHHHHH


DSSP  HHLHHHHHHLL
Query MLRENPSQFFQ  291
ident      |   | 
Sbjct VSYDGPKALFF  451
DSSP  HHLHHHHHHHL


No 45: Query=1bf6A Sbjct=1a5kC Z-score=13.9

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct snisrqayadmfgptvgdkvrladtelwieveddlttygeevkfgggkvirdgmgqgqml   60
DSSP  leeehhhhhhhhlllllleeelllllleeelleellllllllllllllllllllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct aadcvdlvltnalivdhwgivkadigvkdgrifaigkagnpdiqpnvtipigaateviaa  120
DSSP  hhhllleeeeeeeeeelleeeeeeeeeelleeeeeeleellllllllleellllleeeel


DSSP  --llllLLEEEEEELLLeelhhhhllhhheellhhhHHHHHHHHHHLLEEEEEE------
Query --sfdpTGYTLAHEHLHidlsgfknnvdcrldqyafICQEMNDLMTRGVRNVIE------   52
ident        |    | |                       |        ||           
Sbjct egkivtAGGIDTHIHWI-------------------CPQQAEEALVSGVTTMVGggtgpa  161
DSSP  llleeeELEEEEEEELL-------------------LLLHHHHHHHHLEEEEEEelllll


DSSP  ------LLLHHhlLLHHHHHHhHHHHLLEEEEEELLLlhhhlllhhhhllhhhHHHHHHH
Query ------MTNRYmgRNAQFMLDvMRETGINVVACTGYYqdaffpehvatrsvqeLAQEMVD  106
ident                             |                               
Sbjct agthatTCTPGpwYISRMLQA-ADSLPVNIGLLGKGN--------------vsQPDALRE  206
DSSP  hhhhhlLLLLHhhHHHHHHHH-HLLLLLEEEEEEELL--------------llLHHHHHH


DSSP  HHHLlllllllLEEEEEeEELLlllllhhHHHHHHHHHHHHHHHLLLEEEELHH---hlL
Query EIEQgidgtelKAGIIAeIGTSegkitplEEKVFIAAALAHNQTGRPISTHTSF---stM  163
ident                   |                 |             |         
Sbjct QVAA-------GVIGLE-IHED----wgaTPAAIDCALTVADEMDIQVALHSDTlnesgF  254
DSSP  HHHH-------LLLEEE-EEHH----hllLHHHHHHHHHHHHHHLLEEEEELLLlllllL


DSSP  HHHHHHHHhhlLLLHhhEEELLLLLL---llHHHHhHHHHLL-LEEEElLLLL-------
Query GLEQLALLqahGVDLsrVTVGHCDLK---dnLDNIlKMIDLG-AYVQFdTIGK-------  212
ident     ||     |         |          | |              |          
Sbjct VEDTLAAI---GGRT--IHTFHTEGAggghaPDII-TACAHPnILPSS-TNPTlpytlnt  307
DSSP  HHHHHHHH---LLLL--EEELLLLLLlllllLLHH-HHHHLLlEEEEE-EHHHllllllh


DSSP  --------------------------lLLLL--HHHHHHHHHHHhhlllhhHEEELLLLL
Query --------------------------nSYYP--DEKRIAMLHALrdrgllnRVMLSMDIT  244
ident                                                        | |  
Sbjct idehldmlmvchhldpdiaedvafaesRIRRetIAAEDVLHDLG------aFSLTSSDSQ  361
DSSP  hhhhhhhhhhhhllllllhhhhhllllLLLHhhHHHHHHHHHLL------lLLEEELLLL


DSSP  LhhhlhhhlllLLLHHHhLHHHHHHHLL----------------lLHHHHHHHHLHHHHH
Query RrshlkanggyGYDYLLtTFIPQLRQSG----------------fSQADVDVMLRENPSQ  288
ident                       |                                 ||  
Sbjct A--------mgRVGEVI-LRTWQVAHRMkvqrgalaeetgdndnfRVKRYIAKYTINPAL  412
DSSP  L--------llLLLLHH-HHHHHHHHHHhhhhlllllllllllhhHHHHHHHLLLHHHHH


DSSP  HLL---------------------------------------------------------
Query FFQ---------------------------------------------------------  291
ident                                                             
Sbjct THGiahevgsievgkladlvvwspaffgvkpatvikggmiaiapmgdinasiptpqpvhy  472
DSSP  HLLllllllllllllllleeeelhhhlllllleeeelleeeeeeelllllllllllllee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  291
ident                                                             
Sbjct rpmfgalgsarhhcrltflsqaaaangvaerlnlrsaiavvkgcrtvqkadmvhnslqpn  532
DSSP  eelhhhlhhhhhhhleeeelhhhhhhlhhhhllllleeeellllllllhhhlllllllll


DSSP  ----------------------------------
Query ----------------------------------  291
ident                                   
Sbjct itvdaqtyevrvdgelitsepadvlpmaqryflf  566
DSSP  eeelllllleeelleellllllllllllllllll


No 46: Query=1bf6A Sbjct=1yrrB Z-score=13.9

back to top
DSSP  -----------------------------------------------llllLLEEEEEEL
Query -----------------------------------------------sfdpTGYTLAHEH   13
ident                                                     |       
Sbjct yaltqgriftgheflddhavviadgliksvcpvaelppeieqrslngailsPGFIDVQLN   60
DSSP  leeelleeelllleelleeeeeelleeeeeeehhhlllllleeelllleeeELEEEEEEL


DSSP  L-----LEELhhhhllhhHEELLHHHHHHHHHHHHHLLEEEEEELLLHH----hllLHHH
Query L-----HIDLsgfknnvdCRLDQYAFICQEMNDLMTRGVRNVIEMTNRY----mgrNAQF   64
ident         |                            |  |                   
Sbjct GcggvqFNDT--------AEAVSVETLEIMQKANEKSGCTNYLPTLITTsdelmkqGVRV  112
DSSP  EelleeLLLL--------LLLLLHHHHHHHHHHHHLLLEEEEEEEELLLlhhhhhhHHHH


DSSP  HHHHHHHHL-LEEEEEE-LLLLHhhlllhhhhllhHHHHHHHHHHHhllllllllLEEEE
Query MLDVMRETG-INVVACT-GYYQDaffpehvatrsvQELAQEMVDEIeqgidgtelKAGII  122
ident |                 |                  |                      
Sbjct MREYLAKHPnQALGLHLeGPWLN------------AALVDFLCENA--------dVITKV  152
DSSP  HHHHHHHLLlLLLLEEEeLLLLL------------LHHHHHHHHLH--------hHEEEE


DSSP  eEEELllllllhhHHHHhHHHHHHHHhHLLLEEEELH--hhlLHHHHHHHHhhllllhhh
Query aEIGTsegkitplEEKVfIAAALAHNqTGRPISTHTS--fstMGLEQLALLqahgvdlsr  180
ident                          |  |   |   |                       
Sbjct -TLAP-------eMVPA-EVISKLAN-AGIVVSAGHSnatlkEAKAGFRAG--------i  194
DSSP  -EELH-------hHLLH-HHHHHHHH-HLLEEEELLLlllhhHHHHHHHHL--------e


DSSP  EEELLLLL---------lllHHHHHHHHhlLLEEEElLLLLllllLHHHhHHHHHHHHHL
Query VTVGHCDL---------kdnLDNILKMIdlGAYVQFdTIGKnsyyPDEKrIAMLHALRDR  231
ident     |                  ||       |                  |        
Sbjct TFATHLYNampyitgrepglAGAILDEA--DIYCGI-IADG----LHVD-YANIRNAKRL  246
DSSP  EEELLLLLllllllllllhhHHHHHHLL--LLEEEE-ELLL----LLLL-HHHHHHHHHH


DSSP  lLHHHEEELLLLLlhhhlhhhlllllLHHHhLHHHHHHHL-LLLHHHHHHHHLHHHHHHL
Query gLLNRVMLSMDITrrshlkanggygyDYLLtTFIPQLRQS-GFSQADVDVMLRENPSQFF  290
ident        |  | |                       |    |     |  |    |    
Sbjct -KGDKLCLVTDAT---------sgssLTMI-EGVRNLVEHcGIALDEVLRMATLYPARAI  295
DSSP  -HHHHEEEELLLL---------llllLLHH-HHHHHHHHHhLLLHHHHHHHHLHHHHHHL


DSSP  L--------------------------------------
Query Q--------------------------------------  291
ident                                        
Sbjct Gvekrlgtlaagkvanltaftpdfkitktivngnevvtq  334
DSSP  Lllllllllllllllleeeellllleeeeeelleeeeel


No 47: Query=1bf6A Sbjct=3iacA Z-score=13.7

back to top
DSSP  ---------------------llllLLEEEEEELLLeelhhhhllhhheeLLHHH-----
Query ---------------------sfdpTGYTLAHEHLHidlsgfknnvdcrlDQYAF-----   34
ident                                | ||                         
Sbjct atfxtedfllkndiartlyhkyaapXPIYDFHCHLS------------pqEIADDrrfdn   48
DSSP  llllllllllllhhhhhhhhhllllLLEEELLLLLL------------hhHHHHLlllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------   34
ident                                                             
Sbjct lgqiwlegdhykwralrsagvdeslitgketsdyekyxawantvpktlgnplyhwthlel  108
DSSP  hhhhhhllllhhhhhhhhllllhhhlllllllhhhhhhhhhhhhhhllllhhhhhhhhhh


DSSP  ------------------------------hhHHHHHHHHLLEEEEEELLLHHhlLLHHH
Query ------------------------------icQEMNDLMTRGVRNVIEMTNRYmgRNAQF   64
ident                                           || |              
Sbjct rrpfgitgtlfgpdtaesiwtqcneklatpafSARGIXQQXNVRXVGTTDDPI--DSLEY  166
DSSP  hlllllllllllhhhhhhhhhhhhhhhllhhhLHHHHHHHLLEEEEELLLLLL--LLLHH


DSSP  HHHHHHH--HLLEEEEEELLL--LHHH------LLLH----------hHHLLHHHHHHHH
Query MLDVMRE--TGINVVACTGYY--QDAF------FPEH----------vATRSVQELAQEM  104
ident            | |                                       | |    
Sbjct HRQIAADdsIDIEVAPSWRPDkvFKIEldgfvdYLRKleaaadvsitrFDDLRQALTRRL  226
DSSP  HHHHHHLllLLLEEELLLLLHhhHLLLlllhhhHHHHhhhhhllllllHHHHHHHHHHHH


DSSP  HHHHHlllllllLLEEEEeEEELlLLLL----------------------------LHHH
Query VDEIEqgidgteLKAGIIaEIGTsEGKI----------------------------TPLE  136
ident                      |  |                                   
Sbjct DHFAA-------CGCRAS-DHGI-ETLRfapvpddaqldailgkrlagetlseleiAQFT  277
DSSP  HHHHH-------LLLLEE-EEEE-LLLLllllllhhhhhhhhhhhhllllllhhhhHHHH


DSSP  HHHHHHHHHHHHHHLLLEEEELHH-----------------------hlLHHHHHHHHHH
Query EKVFIAAALAHNQTGRPISTHTSF-----------------------stMGLEQLALLQA  173
ident   |           |     |                                   ||  
Sbjct TAVLVWLGRQYAARGWVXQLHIGAirnnntrxfrllgpdtgfdsigdnnISWALSRLLDS  337
DSSP  HHHHHHHHHHHHHHLLEEEEEELEellllhhhhhhhllllllleellllLHHHHHHHHHH


DSSP  L---LLLHhHEEEllLLLLL-LHHHHHHHHHLL--------LEEEELLlllllLLLH-HH
Query H---GVDLsRVTVghCDLKD-NLDNILKMIDLG--------AYVQFDTigknsYYPD-EK  220
ident                  |           |                              
Sbjct XdvtNELP-KTIL--YCLNPrDNEVLATXIGNFqgpgiagkVQFGSGW----wFNDQkDG  390
DSSP  HhllLLLL-EEEE--EELLHhHHHHHHHHHHHLllllllllEEELLLL----hHHLLhHH


DSSP  HHHHHHHHHHLLLH-HHEEELLLLLLhhhlhhhlllLLLHHHHLHHHHHHHLL-------
Query RIAMLHALRDRGLL-NRVMLSMDITRrshlkanggyGYDYLLTTFIPQLRQSG-------  272
ident     |  |   |||   |    |                     |   |           
Sbjct XLRQLEQLSQXGLLsQFVGXLTDSRS---------fLSYTRHEYFRRILCNLLgqwaqdg  441
DSSP  HHHHHHHHHHHLLHhHLLLLLLLLLL---------lLLLHHHHHHHHHHHHHHhhhhhll


DSSP  -------lLHHHHHHHHLHHHHHHLL--
Query -------fSQADVDVMLRENPSQFFQ--  291
ident             |      |    |   
Sbjct eipddeaxLSRXVQDICFNNAQRYFTik  469
DSSP  lllllhhhHHHHHHHHHLHHHHHHLLll


No 48: Query=1bf6A Sbjct=3ooqA Z-score=13.4

back to top
DSSP  -----------------------------------------------llllLLEEEEEEL
Query -----------------------------------------------sfdpTGYTLAHEH   13
ident                                                     |   || |
Sbjct kilfknatvfpitsrpfkgdvlvsngkvekvgeniedpdaeivdltgkflfPGFVDAHSH   60
DSSP  leeeeeeeellllllleeeeeeeelleeeeeelllllllleeeelllleeeELEEEEEEL


DSSP  LLEElhhhhLLHHHE----------------ELLHHHhhHHHHHHHHLLEEEEEELLL--
Query LHIDlsgfkNNVDCR----------------LDQYAFicQEMNDLMTRGVRNVIEMTN--   55
ident                                                 ||  |       
Sbjct IGLF-eegvGYYYSDgneatdpvtphvkaldGFNPQD--PAIERALAGGVTSVXIVPGsa  117
DSSP  LLLL-llllLHHHLLlllllllllllllhhhHLLLLL--HHHHHHHLLLEEEEEELLLll


DSSP  -------hhhlllhhHHHHHHhhhlleeeeeellllhhhlllhhhhllhhhhhhhhhhhh
Query -------rymgrnaqFMLDVMretginvvactgyyqdaffpehvatrsvqelaqemvdei  108
ident                                                             
Sbjct npvggqgsvikfrsiIVEECI---------------------------------------  138
DSSP  lleeeeeeeeellllLHHHHE---------------------------------------


DSSP  hllllllllLEEEEEeEELLL------------lllLHHHHHHHHH--------------
Query eqgidgtelKAGIIAeIGTSE------------gkiTPLEEKVFIA--------------  142
ident                     |                     |                 
Sbjct -------vkDPAGLK-XAFGEnpkrvygerkqtpstRXGTAGVIRDyftkvknyxkkkel  190
DSSP  -------eeEEEEEE-EELLHhhhhhhhhlllllllHHHHHHHHHHhhhhhhhhhhhhhh


DSSP  ----------------hhHHHHHHLLLEEEELHHHLLHHHHHHHHHHLLLlhhHEEELLL
Query ----------------aaLAHNQTGRPISTHTSFSTMGLEQLALLQAHGVdlsRVTVGHC  186
ident                           |   |       |         |         | 
Sbjct aqkegkeftetdlkxevgEXVLRKKIPARXHAHRADDILTAIRIAEEFGF---NLVIEHG  247
DSSP  hhhlllllllllhhhhhhHHHHLLLLLEEEEELLHHHHHHHHHHHHHHLL---LEEEEEL


DSSP  LlllLHHHHHHHHHLLLEEEELLLLLLLL--llhhHHHHHHHHHHHLLLhhHEEELLLLL
Query DlkdNLDNILKMIDLGAYVQFDTIGKNSY--ypdeKRIAMLHALRDRGLlnRVMLSMDIT  244
ident                   |                        |   |      |  |  
Sbjct T--eAYKISKVLAEKKIPVVVGPLLTFRTklelkdLTXETIAKLLKDGV--LIALXCDHP  303
DSSP  L--lHHHHHHHHHHHLLLEEELLLLLLLLlhhhllLLLLHHHHHHHLLL--LEEELLLLL


DSSP  lhhhlhhhlllLLLHHHhLHHHHHHHLLLLHHHHHHHHLHHHHHHLL-------------
Query rrshlkanggyGYDYLLtTFIPQLRQSGFSQADVDVMLRENPSQFFQ-------------  291
ident                            |    |    |  ||                  
Sbjct ---------viPLEFAT-VQAATAXRYGAKEEDLLKILTVNPAKILGledrigsiepgkd  353
DSSP  ---------llLHHHHH-HHHHHHHHHLLLHHHHHHLLLHHHHHHLLlllllllllllll


DSSP  -------------------------------
Query -------------------------------  291
ident                                
Sbjct adlvvwsghpfdxksvvervyidgvevfrre  384
DSSP  lleeeelllllllllleeeeeelleeeeell


No 49: Query=1bf6A Sbjct=4dziC Z-score=12.6

back to top
DSSP  llllLLEEEEEELlLEELHH-----------------------------------HHLLH
Query sfdpTGYTLAHEHlHIDLSG-----------------------------------FKNNV   25
ident             |                                            |  
Sbjct -alnYRVIDVDNH-YYEPLDsftrhldkkfkrrgvqmlsdgkrtwavigdrvnhfIPNPT   58
DSSP  -lllLLEEEEEEE-LLLLLLlllllllhhhlllleeeeelllleeeeelleelllLLLLL


DSSP  H-----------------------------------heELLHHHHHHHHHHHHhllEEEE
Query D-----------------------------------crLDQYAFICQEMNDLMtrgVRNV   50
ident                                                 |           
Sbjct FdpiivpgcldllfrgeipdgvdpaslmkverladhpeYQNRDARIAVMDEQD---IETA  115
DSSP  LlleelllllhhhhhllllllllhhhllleelhhhlhhHLLHHHHHHHHHHHL---EEEE


DSSP  EELL---------------------lhhhlLLHHHHHhhhhhhLLEEEEEELLllhhhll
Query IEMT---------------------nrymgRNAQFMLdvmretGINVVACTGYyqdaffp   89
ident                                                 |           
Sbjct FMLPtfgcgveealkhdieatmasvhafnlWLDEDWG--fdrpDHRIIAAPIV-------  166
DSSP  EEELlhhhhhhhhllllhhhhhhhhhhhhhHHHHHLL--llllLLLEEELLLL-------


DSSP  lhhhhLLHHHHHHHHHHHHHLlllllllLEEEEeEEELlllLLLH-----HHHH--hhHH
Query ehvatRSVQELAQEMVDEIEQgidgtelKAGIIaEIGTsegKITP-----LEEK--vfIA  142
ident              |               |              |               
Sbjct ---slADPTRAVEEVDFVLAR-------GAKLV-LVRP---APVPglvkpRSLGdrshDP  212
DSSP  ---llLLHHHHHHHHHHHHHL-------LLLLE-ELLL---LLLLlllllLLLLlhhhHH


DSSP  HHHHHHHHLLLEEEELH-----------------------HHLLHHHHHHHH-----HHL
Query AALAHNQTGRPISTHTS-----------------------FSTMGLEQLALL-----QAH  174
ident         | |   | |                                |          
Sbjct VWARLAEAGVPVGFHLSdsgylhiaaawggakdpldqvllDDRAIHDTMASMivhgvFTR  272
DSSP  HHHHHHHHLLLEEEELLllllhhhhhhllllllhhhhhhhLLHHHHHHHHHHhhllhHHH


DSSP  LLLhhHEEELLLLllllhHHHHH----------------------hHHLLLEEEElllll
Query GVDlsRVTVGHCDlkdnlDNILK----------------------mIDLGAYVQFdtigk  212
ident                                                             
Sbjct HPK-lKAVSIENG----sYFVHRlikrlkkaantqpqyfpedpveqLRNNVWIAP-----  322
DSSP  LLL-lLEEEELLL----lLHHHHhhhhhhhhhhhlhhhllllhhhhHHHHEEELL-----


DSSP  lllllhhhHHHHHHHHHHLLLHHHEEELLLLLlhhhlhhhllllLLHHHhLHHHHHHhlL
Query nsyypdekRIAMLHALRDRGLLNRVMLSMDITrrshlkanggygYDYLLtTFIPQLRqsG  272
ident             |  |             |                     |   |   |
Sbjct -------yYEDDLPELARVIGVDKILFGSDWP--------hgegLASPV-SFTAELK--G  364
DSSP  -------lLLLLHHHHHHHHLHHHLLLLLLLL--------llllLLLHH-HHHHHHL--L


DSSP  LLHHHHHHHHLHHHHHHLL-----
Query FSQADVDVMLRENPSQFFQ-----  291
ident ||  |     | |           
Sbjct FSESDIRKIMRDNALDLLGvqvgs  388
DSSP  LLHHHHHHHHLHHHHHHHLlllll


No 50: Query=1bf6A Sbjct=1v77A Z-score=11.8

back to top
DSSP  llllLLEEEEEELLLeelhhhhllhhheellhhhhhhHHHHHhhllEEEEEELLLhhhll
Query sfdpTGYTLAHEHLHidlsgfknnvdcrldqyaficqEMNDLmtrgVRNVIEMTNrymgr   60
ident                                                  |          
Sbjct ----VKFIEMDIRDK------------------eayeLAKEW----FDEVVVSIK-----   29
DSSP  ----LLLEEEEELLH------------------hhhhHHHHH----LLEEEEEEE-----


DSSP  lhhhhhhhhhhhlleeeeeellLLHHhlllhhhhllhhhhhhhHHHHHHLlllllLLLEE
Query naqfmldvmretginvvactgyYQDAffpehvatrsvqelaqeMVDEIEQgidgtELKAG  120
ident                                                             
Sbjct ----------------------FNEE----------------vDKEKLRE---arKEYGK   48
DSSP  ----------------------ELLL----------------lLHHHHHH---hhHHHLL


DSSP  EEEEEELLlllllhhHHHHHHHHHHHHHhhLLLEEEELHhhLLHHHHHHHHhhllllhhh
Query IIAEIGTSegkitplEEKVFIAAALAHNqtGRPISTHTSfsTMGLEQLALLqahgvdlsr  180
ident                                  |                          
Sbjct VAILLSNP-------KPSLVRDTVQKFK--SYLIYVESNdlRVIRYSIEKG--------v   91
DSSP  EEEEEELL-------LHHHHHHHHHHLL--LLEEEEELLlhHHHHHHHHLL--------l


DSSP  EEELLLLL---LLLHH--HHHHHHHLLLEEEELlLLLL-------LLLLHHHHHHHHHHH
Query VTVGHCDL---KDNLD--NILKMIDLGAYVQFDtIGKN-------SYYPDEKRIAMLHAL  228
ident                |      |        |                            
Sbjct DAIISPWVnrkDPGIDhvLAKLMVKKNVALGFS-LRPLlysnpyeRANLLRFMMKAWKLV  150
DSSP  LEEELLLLlllLLLLLhhHHHHHHHHLLEEEEE-LHHHhhllhhhHHHHHHHHHHHHHHH


DSSP  HHLLLhhHEEELLLLLLHhhlhhhllLLLL---HHHHlHHHHHHhllLLHHHHHHHHLHH
Query RDRGLlnRVMLSMDITRRshlkanggYGYD---YLLTtFIPQLRqsgFSQADVDVMLREN  285
ident        |  |                       |                         
Sbjct EKYKV--RRFLTSSAQEK--------WDVRyprDLIS-LGVVIG---MEIPQAKASISMY  196
DSSP  HHHLL--LEEEELLLLLH--------HHLLlhhHHHH-HHHHLL---LLHHHHHHLLLHH


DSSP  HHHHLL
Query PSQFFQ  291
ident |     
Sbjct PEIILK  202
DSSP  HHHHHL


No 51: Query=1bf6A Sbjct=2a3lA Z-score=11.7

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct qpdpiaadilrkepeqetfvrlnvplevptsdeveaykclqeclelrkryvfqetvapwe   60
DSSP  llllllllllllllllllllllllllllllllllllhhhhhhhhhhhhllllllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct keepfahypqgksdhcfemqdgvvhvfankdakedlfpvadatafftdlhhvlkviaagn  120
DSSP  lllllllllllllllllllllllllllllllllllllllllhhhhhhhhhhhhhhlllhh


DSSP  -------------------------------------llllLLEEEEEELLL--------
Query -------------------------------------sfdpTGYTLAHEHLH--------   15
ident                                                | |          
Sbjct irtlchrrlvlleqkfnlhlmlnadkeflaqksaphrdfynVRKVDTHVHHSacmnqkhl  180
DSSP  hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhllllllllLLEEEEEEELLllllhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------   15
ident                                                             
Sbjct lrfiksklrkepdevvifrdgtyltlrevfesldltgydlnvdlldvhadkstfhrfdkf  240
DSSP  hhhhhhhhhllllllleeelleeelhhhhhhhhlllllllllllllllllllllllllll


DSSP  --eeLHHHHL---LHHHE--------eLLHHHHHHHHHHHHHLLEeEEEELLLHH-----
Query --idLSGFKN---NVDCR--------lDQYAFICQEMNDLMTRGVrNVIEMTNRY-----   57
ident                                                       |     
Sbjct nlkyNPCGQSrlrEIFLKqdnliqgrfLGEITKQVFSDLEASKYQ-MAEYRISIYgrkms  299
DSSP  hhhhLLLLLLhhhHHHLLlllllllllHHHHHHHHHHHHLLLLLE-EEEEEEELLlllll


DSSP  -hllLHHHH--HHHHhhhLLEEEEEELLLLhhHLLLH----hHHLLhHHHHHHHHHHHHL
Query -mgrNAQFM--LDVMretGINVVACTGYYQdaFFPEH----vATRSvQELAQEMVDEIEQ  110
ident      |      |       |||                    |   |            
Sbjct ewdqLASWIvnNDLY---SENVVWLIQLPR--LYNIYkdmgiVTSF-QNILDNIFIPLFE  353
DSSP  hhhhHHHHHhlLLLL---LLLEEEEEEEEL--LHHHHlllllLLLL-HHHHHHHLLHHHH


DSSP  L-------llLLLLL--EEEEEeEELLLLL------------------llHHHHHHHHHH
Query G-------idGTELK--AGIIAeIGTSEGK------------------itPLEEKVFIAA  143
ident                            | |                    |         
Sbjct AtvdpdshpqLHVFLkqVVGFD-LVDDESKperrptkhmptpaqwtnafnPAFSYYVYYC  412
DSSP  HhhlhhhlllLHHHHllEEEEE-EELLLLLllllllllllllllllllllLLHHHHHHHH


DSSP  HHHHHHHL----------LLEEEELHHHL---LHHHHHHHhhhllllhhHEEELLLLllL
Query ALAHNQTG----------RPISTHTSFST---MGLEQLALlqahgvdlsRVTVGHCDlkD  190
ident                        |                              |     
Sbjct YANLYVLNklreskgmttITLRPHSGEAGdidHLAATFLT---------CHSIAHGI--N  461
DSSP  HHHHHHHHhhhlllllllLEELLLLLLLLllhHHHHHHHH---------LLLLLLLH--H


DSSP  LHH---HHHHHHHLLLEEEElLLLL--LLLLLHHHHhhHHHHHHHLLLhhHEEELLLLll
Query NLD---NILKMIDLGAYVQFdTIGK--NSYYPDEKRiaMLHALRDRGLlnRVMLSMDItr  245
ident                                              |||   | || |   
Sbjct LRKspvLQYLYYLAQIGLAM-SPLSnnSLFLDYHRN--PFPVFFLRGL--NVSLSTDD--  514
DSSP  HHHlhhHHHHHHHHLLLEEE-LHHHhlLLLLLLLLL--LHHHHHHLLL--LEEELLLL--


DSSP  hhhlhhhLLLL--lLHHHhLHHHHHHHL-LLLHHHHHHHHlHHHHHHLL-----------
Query rshlkanGGYG--yDYLLtTFIPQLRQS-GFSQADVDVMLrENPSQFFQ-----------  291
ident                 |              |  |       |                 
Sbjct ------pLQIHltkEPLV-EEYSIAASVwKLSACDLCEIA-RNSVYQSGfshalkshwig  566
DSSP  ------hHHHLlllLHHH-HHHHHHHHHhLLLHHHHHHHH-HHHHHHLLllhhhhhhhll


DSSP  --------------------------------------------------
Query --------------------------------------------------  291
ident                                                   
Sbjct kdyykrgpdgndihktnvphirvefrdtiwkeemqqvylgkavisdevvp  616
DSSP  lllllllhhhllhhhhlllhhhhhhhhhhhhhhhhhhlllllllllllll


No 52: Query=1bf6A Sbjct=1m65A Z-score=9.4

back to top
DSSP  llllllEEEEEELlLEELHhhhllhhHEELLHHHHHHHHHHHHhllEEEEEELLL----H
Query sfdptgYTLAHEHlHIDLSgfknnvdCRLDQYAFICQEMNDLMtrgVRNVIEMTN----R   56
ident           | |                                               
Sbjct -----yPVDLHMH-TVAST-------HAYSTLSDYIAQAKQKG---IKLFAITDHgpdmE   44
DSSP  -----lLEELLLL-LLLLL-------LLLLLHHHHHHHHHHHL---LLEEEEEEEllllL


DSSP  HHL----llhhhhHHHHhHHLLEEEEEellllhhhlllhhhhllhhhhhhhhhhhhhlll
Query YMG----rnaqfmLDVMrETGINVVACtgyyqdaffpehvatrsvqelaqemvdeieqgi  112
ident                     |                                       
Sbjct DAPhhwhfinmriWPRV-VDGVGILRG---------------------------------   70
DSSP  LLLllhhhhhhhhLLLE-ELLEEEEEE---------------------------------


DSSP  lllllleeeeEEEELLLLLLlhhhhhHHHHhhHHHHhhlLLEEEELH-----------hh
Query dgtelkagiiAEIGTSEGKItpleekVFIAaaLAHNqtgRPISTHTS-----------fs  161
ident            |                             |                  
Sbjct ----------IEANIKNVDG----eiDCSG--KMFD-slDLIIAGFHepvfaphdkatnt  113
DSSP  ----------EEEELLLLLL----llLLLH--HHHH-hlLEEEEELLllllllllhhhhh


DSSP  lLHHHHHHHHhhllllhhhEEELLLLLL----LLHHHHHHHHHLLLEEEElLLLLlllll
Query tMGLEQLALLqahgvdlsrVTVGHCDLK----DNLDNILKMIDLGAYVQFdTIGKnsyyp  217
ident        |               |        |                           
Sbjct qAMIATIASG-------nvHIISHPGNPkyeiDVKAVAEAAAKHQVALEI-NNSS-----  160
DSSP  hHHHHHHHLL-------llLEELLLLLLllllLHHHHHHHHHHHLLEEEE-ELLL-----


DSSP  hhHHHHHHHHHHHLLLhhHEEELLLLLLhhhlhhhlllLLLHHHhLHHHHHHHLLLlhhH
Query deKRIAMLHALRDRGLlnRVMLSMDITRrshlkanggyGYDYLLtTFIPQLRQSGFsqaD  277
ident          | || |    | |  |                         |    |    
Sbjct --NCREVAAAVRDAGG--WVALGSDSHT--------afTMGEFE-ECLKILDAVDF---P  204
DSSP  --LHHHHHHHHHHHLL--LEEEELLLLL--------hhHLLLLH-HHHHHHHHLLL---L


DSSP  HHH-HHLH--HHHHHLL-------------
Query VDV-MLRE--NPSQFFQ-------------  291
ident               |               
Sbjct PERiLNVSprRLLNFLEsrgmapiaefadl  234
DSSP  HHHlHHHLhhHHHHHHHhllllllhhhlll


No 53: Query=1bf6A Sbjct=3au2A Z-score=9.3

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct mrnqelarifeeiglmseflgdnpfrvrayhqaartlydldtpieeiaekgkealmelpg   60
DSSP  llhhhhhhhhhhhhhhhhhllllhhhhhhhhhhhhhhhhllllhhhhhlllhhhhlllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct vgpdlaekileflrtgkvrkheelsrkvprgvlevmevpgvgpktarllyeglgidslek  120
DSSP  llhhhhhhhhhhhhhlllhhhhhhhhhllhhhhhhhllllllhhhhhhhhhhhllllhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct lkaaldrgdltrlkgfgpkraerireglalaqaagkrrplgavlslarslleairalpgv  180
DSSP  hhhhhhhlhhhhlllllhhhhhhhhhhhhhhhhlllleehhhhhhhhhhhhhhhhlllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct eraelcgsarrykdtvgdldflvasregeravegfvrlpqvkevyakgkeratvflkngl  240
DSSP  leeeelhhhhlllleelleeeeeelllhhhhhhhhhlllleeeeeeellleeeeeellll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct qvdlrvvppesygaglqyltgskahsirlralaqekglklseygvfrgekriageteeev  300
DSSP  eeeeeeelhhhhhhhhhhhhllhhhhhhhhhhhhhllleeelleeeelleeeelllhhhh


DSSP  -------------------------------llllllEEEEEELLLEELhhhhllhhheE
Query -------------------------------sfdptgYTLAHEHLHIDLsgfknnvdcrL   29
ident                                            |                
Sbjct yaalglpwippplredqgeveaalegrlpkllelpqvKGDLQVHSTYSD---------gQ  351
DSSP  hhhlllllllhhhlllllhhhhhhlllllllllhhhlLEEEEELLLLLL---------lL


DSSP  LLHHHHHHHHHHHHhllEEEEEELLL-------HHHL-----lLHHHHHHHHHHHL-LEE
Query DQYAFICQEMNDLMtrgVRNVIEMTN-------RYMG-----rNAQFMLDVMRETG-INV   76
ident                   |                                    |    
Sbjct NTLEELWEAAKTMG---YRYLAVTDHspavrvaGGPSpeealkRVGEIRRFNETHGpPYL  408
DSSP  LLHHHHHHHHHHHL---LLEEEEEEElhhhhllLLLLhhhhhhHHHHHHHHHHHHLlLEE


DSSP  EEEellllhhhlllhhhhllhhhhhhhhhhhhhllllllllleeeeEEEELLLLLLlhhh
Query VACtgyyqdaffpehvatrsvqelaqemvdeieqgidgtelkagiiAEIGTSEGKItple  136
ident  |                                            ||            
Sbjct LAG-------------------------------------------AEVDIHPDGT----  421
DSSP  EEE-------------------------------------------EEEELLLLLL----


DSSP  hhHHHHHHHHhhhhlllEEEELHH---------hlLHHHHHHHHhhllllhhHEEELLLL
Query ekVFIAAALAhnqtgrpISTHTSF---------stMGLEQLALLqahgvdlsRVTVGHCD  187
ident                                      |  |                |  
Sbjct ldYPDWVLRE----ldlVLVSVHSrfnlpkadqtkRLLKALENP-------fVHVLAHPT  470
DSSP  llLLHHHHLL----lleEEEELLLlllllhhhhhhHHHHHHLLL-------lLLEELLLL


DSSP  LL----------lLHHHHHHHHHLLLEEEELlLLLLllllHHHHHHHHHHHHHLLLhhHE
Query LK----------dNLDNILKMIDLGAYVQFDtIGKNsyypDEKRIAMLHALRDRGLlnRV  237
ident                    |    |  |  |                       ||    
Sbjct ARllgrrapieadWEAVFQKAKEKGVAVEID-GYYD---rMDLPDDLARMAYGMGL--WI  524
DSSP  LLlllllllllllHHHHHHHHHHHLLEEEEE-LLLL---lLLLLHHHHHHHHHLLL--LE


DSSP  EELLLLLLhhhlhhhllLLLLHHHhLHHHHHHHLLLlhhHHHH-HHLH---hHHHHLL--
Query MLSMDITRrshlkanggYGYDYLLtTFIPQLRQSGFsqaDVDV-MLRE---nPSQFFQ--  291
ident  || |                                                       
Sbjct SLSTDAHQ--------tDHLRFME-LAVGTAQRAWI---GPERvLNTLdyedLLSWLKar  572
DSSP  EEELLLLL--------hHHHHHHH-HHHHHHHHLLL---LLLLlHHHLlhhhHHHHHHll


DSSP  ---
Query ---  291
ident    
Sbjct rgv  575
DSSP  lll


No 54: Query=1bf6A Sbjct=3dcpA Z-score=9.2

back to top
DSSP  lllllLEEEEEELLLEELHhhhllhhHEELLHhHHHHHHHHHHhllEEEEEELLL-----
Query sfdptGYTLAHEHLHIDLSgfknnvdCRLDQYaFICQEMNDLMtrgVRNVIEMTN-----   55
ident           | |                |           |                  
Sbjct -----XKRDGHTHTEFCPH------gTHDDVE-EXVLKAIELD---FDEYSIVEHaplss   45
DSSP  -----LLEEEEELLLLLLL------lLLLLHH-HHHHHHHHLL---LLEEEEEEEllllh


DSSP  --------------HHHL----------lLHHHHHHHHHhhLLEEEEEellllhhhlllh
Query --------------RYMG----------rNAQFMLDVMRetGINVVACtgyyqdaffpeh   91
ident                                                             
Sbjct efxkntagdkeavtTASXaxsdlpyyfkkXNHIKKKYAS--DLLIHIG------------   91
DSSP  hhhhllllllhhhhLLLLlhhhhhhhhhhHHHHHHHLLL--LLEEEEE------------


DSSP  hhhllhhhhhhhhhhhhhllllllllleeeeEEEELllllLLHHhHHHHHHHHHHHhhHL
Query vatrsvqelaqemvdeieqgidgtelkagiiAEIGTsegkITPLeEKVFIAAALAHnqTG  151
ident                                 |            |              
Sbjct -------------------------------FEVDY----LIGY-EDFTRDFLNEY-gPQ  114
DSSP  -------------------------------EEEEL----LLLL-HHHHHHHHHHH-hHH


DSSP  LL-eEEELH-----------------------------------hhLLHHHHH-HHHHHl
Query RP-iSTHTS-----------------------------------fsTMGLEQL-ALLQAh  174
ident                                                       | |   
Sbjct TDdgVLSLHflegqggfrsidfsaedynegivqfyggfeqaqlaylEGVKQSIeADLGL-  173
DSSP  LLeeEEELLeeeelleeeellllhhhhhhhlhhhhllhhhhhhhhhHHHHHHHhLLLLL-


DSSP  lllhhhEEELLLLLL--------------------lLHHHHHHHHHLLLEEEELlLLLL-
Query gvdlsrVTVGHCDLK--------------------dNLDNILKMIDLGAYVQFDtIGKN-  213
ident          ||  |                                      |       
Sbjct ---fkpRRXGHISLCqkfqqffgedtsdfseevxekFRVILALVKKRDYELDFN-TAGLf  229
DSSP  ---lllLEELLLLHHhllhhhhlllhhhllhhhhhhHHHHHHHHHHHLLEEEEE-LHHHh


DSSP  --LLLLHhhHHHHHHHHHhLLLHhHEEELLLLLLHHhlhhhlllLLLHHHhLHHHHHHHl
Query --SYYPDekRIAMLHALRdRGLLnRVMLSMDITRRShlkanggyGYDYLLtTFIPQLRQs  271
ident                               |                        |    
Sbjct kpLCGETypPKKIVTLAS-ELQI-PFVYGSDSHGVQ--------DIGRGY-STYCQKLE-  277
DSSP  llLLLLLllLHHHHHHHH-HLLL-LEEEELLLLLHH--------HLLLLH-HHHHHHLL-


DSSP  lllhhhhhhhhlhhhhhhll
Query gfsqadvdvmlrenpsqffq  291
ident                     
Sbjct --------------------  277
DSSP  --------------------


No 55: Query=1bf6A Sbjct=3f2bA Z-score=8.7

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct vrrletiveeerrvvvqgyvfdaevselksgrtlltmkitdytnsilvkmfsrdkedael   60
DSSP  lllhhhlllleeeeeeeeeeeeeeeeellllleeeeeeeelllleeeeeeelllhhhhhh


DSSP  -------------------------------------------llllLLEEEEEELLLEE
Query -------------------------------------------sfdpTGYTLAHEHLHID   17
ident                                                      | |    
Sbjct msgvkkgmwvkvrgsvqndtfvrdlviiandlneiaanerqdtapegEKRVELHLHTPMS  120
DSSP  hhlllllleeeeeeeeeeelllleeeeeeeeeeeellllllllllllLLLLLLLLLLLLL


DSSP  LHhhhllhhHEELLHHHHHHHHHHHHhllEEEEEELLLhhHLLLHHHHHHHHHHHLLEEE
Query LSgfknnvdCRLDQYAFICQEMNDLMtrgVRNVIEMTNryMGRNAQFMLDVMRETGINVV   77
ident                                                        |  | 
Sbjct QM-------DAVTSVTKLIEQAKKWG---HPAIAVTDH-aVVQSFPEAYSAAKKHGMKVI  169
DSSP  LL-------LLLLLHHHHHHHHHHLL---LLLEEELLL-lLLLLHHHHHHHHHHHLLLEE


DSSP  EEellllhhhlllhhhhllhhhhhhhhhhhhhllllllllleeeeEEEELL---------
Query ACtgyyqdaffpehvatrsvqelaqemvdeieqgidgtelkagiiAEIGTS---------  128
ident                                               |             
Sbjct YG-------------------------------------------LEANIVddpfhvtll  186
DSSP  EE-------------------------------------------EEEEEEllleeeeee


DSSP  -----------------llLLLH--HHHHhHHHHHHHHhhHLLLEEeelhhhllhhhhhh
Query -----------------egKITP--LEEKvFIAAALAHnqTGRPISthtsfstmgleqla  169
ident                                          |                  
Sbjct aqnetglknlfklvslshiQYFHrvPRIP-RSVLVKHR--DGLLVG--------------  229
DSSP  ellhhhhhhhhhhhhhhhlLLLLllLLEE-HHHHHHLL--LLEEEE--------------


DSSP  hhhhllllhhheeELLL-llllLHHHhhHHHHLlLEEEEL-llLLLLL--llHHHHHHHH
Query llqahgvdlsrvtVGHC-dlkdNLDNilKMIDLgAYVQFD-tiGKNSY--ypDEKRIAML  225
ident               |                                      |      
Sbjct -------------SGCDkgelfDNVE--DIARFyDFLEVHppdVYKPLyvkdEEMIKNII  274
DSSP  -------------LLLLlllllLLLL--LLHHHlLLEEELlhhHHLLLllllHHHHHHHH


DSSP  HHHHHLLL--hHHEEELLLLLLhhHLHHHL----------------------llLLLHhH
Query HALRDRGL--lNRVMLSMDITRrsHLKANG----------------------gyGYDYlL  261
ident       |      |                                              
Sbjct RSIVALGEkldIPVVATGNVHY--LNPEDKiyrkilihsqgganplnrhelpdvYFRT-T  331
DSSP  HHHHHHHHhllLLEEELLLLLL--LLHHHHhhhhhhhhllhhhlllllllllllLLLL-H


DSSP  HLHHHHHHhlLLLHHHHHHHHLHHHHHHLL------------------------------
Query TTFIPQLRqsGFSQADVDVMLRENPSQFFQ------------------------------  291
ident                        |                                    
Sbjct NEMLDCFS--FLGPEKAKEIVVDNTQKIASligdvkpikdelytpriegadeeiremsyr  389
DSSP  HHHHHHHH--HHHHHHHHHHHLHHHHHHHHlllllllllllllllllllhhhhhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  291
ident                                                             
Sbjct rakeiygdplpklveerlekelksiighgfaviylishklvkkslddgylvgsrgsvgss  449
DSSP  hhhhhhlllllhhhhhhhhhhhhhhhhlllhhhhhhhhhhhhhhhhllllleelhhhhhl


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  291
ident                                                             
Sbjct fvatmteitevnplpphyvcpnckhseffndgsvgsgfdlpdkncprcgtkykkdghdip  509
DSSP  hhhhhllllllllllleeelllllleeellllllllhhhllllllllllllleeelllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  291
ident                                                             
Sbjct fetflgfkgdkvpdidlnfsgeyqprahnytkvlfgednvyragtigtvadktaygfvka  569
DSSP  lhhhhllllllllleeeeeelllhhhhhhhhhhhhlllleeeeeeeeellhhhhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  291
ident                                                             
Sbjct yasdhnlelrgaeidrlaagctgvkrttgqhpggiivvpdymeiydftpiqypaddtsse  629
DSSP  hhhhllllllhhhhhhhhhhhllleeeeeeeeeeeeellllllhhhllleelhhhlllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  291
ident                                                             
Sbjct wrtthfdfhsihdnllkldilghddptvirmlqdlsgidpktiptddpdvmgifsstepl  689
DSSP  lleeeeehhhhllllleeeeeeehhhhhhhhhhhhhlllhhhlllllhhhhhlllllhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  291
ident                                                             
Sbjct gvtpeqimcnvgtigipefgtrfvrqmleetrpktfselvqisglshgtdvwlgnaqeli  749
DSSP  lllhhhhllllllllllllllhhhhhhhhhhllllhhhhhhhhhhllllllllllhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  291
ident                                                             
Sbjct qngtctlsevigcrddimvyliyrglepslafkimesvrkgkgltpefeaemrkhdvpew  809
DSSP  hlllllhhhllllhhhhhhhhhhllllhhhhhhhhhhhlllllllhhhhhhhhhllllhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  291
ident                                                             
Sbjct yidsckkikymfpkahaaayvlmavriayfkvhhpllyyasyftvraedfdldamikgsa  869
DSSP  hhhhhhhllllllhhhhhhhhhhhhhhhhhhhhlhhhhhhhhhhhllllllhhhhhhlhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  291
ident                                                             
Sbjct airkrieeinakgiqatakekslltvlevalemcergfsfknidlyrsqatefvidgnsl  929
DSSP  hhhhhhhhhhhlhhhllhhhhhhhhhhhhhhhhhhllleellllllllllllleeellee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  291
ident                                                             
Sbjct ippfnaipglgtnvaqaivrareegeflskedlqqrgklsktlleylesrgcldslpdhn  989
DSSP  ellhhhlllllhhhhhhhhhhhhllllllhhhhhhhhlllhhhhhhhhhlllllllllll


DSSP  -----
Query -----  291
ident      
Sbjct qlslf  994
DSSP  lllll


No 56: Query=1bf6A Sbjct=1bksA Z-score=6.5

back to top
DSSP  ----------lllllleeeeeELLLeelhhhhllhhheELLHHHHHHHHHHHHHLLEEEE
Query ----------sfdptgytlahEHLHidlsgfknnvdcrLDQYAFICQEMNDLMTRGVRNV   50
ident                                                    |   |    
Sbjct meryenlfaqlndrregafvpFVTL------------gDPGIEQSLKIIDTLIDAGADAL   48
DSSP  lhhhhhhhhhhhhlllleeeeEEEL------------lLLLHHHHHHHHHHHHHLLLLLE


DSSP  EElllHHHL----------------------lLHHHHHHHHHH-hlleEEEEELLllhhh
Query IEmtnRYMG----------------------rNAQFMLDVMRE-tginVVACTGYyqdaf   87
ident                                                             
Sbjct ELgvpFSDPladgptiqnanlrafaagvtpaqCFEMLALIREKhptipIGLLMYA-----  103
DSSP  EEellLLLLllllhhhhhhhhhhhhhlllhhhHHHHHHHHHHHlllllEEEEELH-----


DSSP  lllhhhhllhhhhhhHHHHHHHLlllllLLLEEEEEEEelllllllhhHHHHhHHHHHHH
Query fpehvatrsvqelaqEMVDEIEQgidgtELKAGIIAEIgtsegkitplEEKVfIAAALAH  147
ident                                                  |        | 
Sbjct ---------nlvfnnGIDAFYAR---ceQVGVDSVLVA-------dvpVEES-APFRQAA  143
DSSP  ---------hhhhllLHHHHHHH---hhHHLLLEEEEL-------lllHHHL-HHHHHHH


DSSP  HHHLLLEEEELHHHL---LHHHHHHHhhhllllhhHEEELLLllLLLHHHHHHHHHLLL-
Query NQTGRPISTHTSFST---MGLEQLALlqahgvdlsRVTVGHCdlKDNLDNILKMIDLGA-  203
ident                                    |              | |     | 
Sbjct LRHNIAPIFICPPNAdddLLRQVASY--------gRGYTYLL-aLPLHHLIEKLKEYHAa  194
DSSP  HHLLLEEEEEELLLLlhhHHHHHHHH--------lLLLEEEL-lLLHHHHHHHHHHHLLl


DSSP  EEEELLLLLlllllHHHHHHHHHHHhhlllhhhEEELLLLllhhHLHHHLL---------
Query YVQFDTIGKnsyypDEKRIAMLHALrdrgllnrVMLSMDItrrsHLKANGG---------  254
ident                |   |   |                                    
Sbjct PALQGFGIS----sPEQVSAAVRAG-------aAGAISGS--aiVKIIEKNlaspkqmla  241
DSSP  LEEELLLLL----lHHHHHHHHHHL-------lLEEEELL--hhHHHHHHLlllhhhhhh


DSSP  lllLHHHhLHHHHHHhllllhhhhhhhhlhhhhhhll
Query ygyDYLLtTFIPQLRqsgfsqadvdvmlrenpsqffq  291
ident               |                      
Sbjct elrSFVS-AMKAASR----------------------  255
DSSP  hhhHHHH-HHHHLLL----------------------


No 57: Query=1bf6A Sbjct=2yb1A Z-score=6.5

back to top
DSSP  llllllEEEEEELLLEELhhhhllhhhEELLHhHHHHHHHHHHhllEEEEEELLLhhhlL
Query sfdptgYTLAHEHLHIDLsgfknnvdcRLDQYaFICQEMNDLMtrgVRNVIEMTNrymgR   60
ident           | |               |                               
Sbjct -----aNIDLHFHSRTSD--------gALTPT-EVIDRAAARA---PALLALTDH-dctG   42
DSSP  -----lLEELLLLLLLLL--------lLLLHH-HHHHHHHLLL---LLEEEELLL-lllL


DSSP  LHHHHHHHHHHHLLEEEEEellllhhhlllhhhhllhhhhhhhhhhhhhlllllllllee
Query NAQFMLDVMRETGINVVACtgyyqdaffpehvatrsvqelaqemvdeieqgidgtelkag  120
ident             ||                                              
Sbjct GLAEAAAAAARRGIPFLNG-----------------------------------------   61
DSSP  LHHHHHHHHHHLLLLEEEE-----------------------------------------


DSSP  eeEEEELLLLL--------llhhhhhHHHHHHHH--------------------------
Query iiAEIGTSEGK--------itpleekVFIAAALA--------------------------  146
ident    |   | |                   |                              
Sbjct --VEVSVSWGRhtvhivglgidpaepALAAGLKSiregrlerarqmgasleaagiagcfd  119
DSSP  --EEEEEEELLeeeeeeeellllllhHHHHHHHHhhllhhhhhhhhhhhhhhlllllhhh


DSSP  -----------------------------------hhhhllleeeelhhhllhhHHHHHh
Query -----------------------------------hnqtgrpisthtsfstmglEQLALl  171
ident                                                             
Sbjct gamrwcdnpemisrthfarhlvdsgavkdmrtvfrkyltpgkpgyvshqwasleDAVGW-  178
DSSP  hhhlllllhhhllhhhhhhhhhhllllllhhhhhhhllllllllllllllllhhHHHHH-


DSSP  hhllllhhHEEELLLLLL-----lLHHHHHHHHHLL-LEEE-ELLLllllllLHHHHHHH
Query qahgvdlsRVTVGHCDLK-----dNLDNILKMIDLG-AYVQ-FDTIgknsyyPDEKRIAM  224
ident              |              ||     |                        
Sbjct --ivgaggMAVIAHPGRYdmgrtlIERLILDFQAAGgQGIEvASGS-----hSLDDMHKF  231
DSSP  --hhhlllEEEELLHHHLlllhhhHHHHHHHHHHLLlLEEEeEELL-----lLHHHHHHH


DSSP  HHHHHhLLLHhHEEELLLLLLHhhlhhhlLLLL-LHHHhlhhhhhhhllllhhHHHHHhl
Query LHALRdRGLLnRVMLSMDITRRshlkangGYGY-DYLLttfipqlrqsgfsqaDVDVMlr  283
ident       |  |       |           |                              
Sbjct ALHAD-RHGL-YASSGSDFHAP-------GEDVgHTED-------------lpPICRP--  267
DSSP  HHHHH-HHLL-EEEEELLLLLL-------LLLLlLLLL-------------llLLLLL--


DSSP  hHHHHHLL----------
Query eNPSQFFQ----------  291
ident                   
Sbjct -IWRELEArilrpadaen  284
DSSP  -HHHHLHHhlllllhhhl


No 58: Query=1bf6A Sbjct=2anuA Z-score=5.5

back to top
DSSP  lllLLLEEEEEELLLEELhhhhllhhheELLHHHHHHHHHHHHhllEEEEEELLLHH---
Query sfdPTGYTLAHEHLHIDLsgfknnvdcrLDQYAFICQEMNDLMtrgVRNVIEMTNRY---   57
ident           | |                                 |  |          
Sbjct --tEWLLCDFHVHTNXSD---------gHLPLGEVVDLFGKHG---VDVVSITDHIVdrr   46
DSSP  --lEEEEEEEEELLLLLL---------lLLLHHHHHHHHHHLL---LLEEEEEEEEElhh


DSSP  -------------------hllLHHHHHHHHHHHL----LEEEEEELLLLHHhlllhhhh
Query -------------------mgrNAQFMLDVMRETG----INVVACTGYYQDAffpehvat   94
ident                                                             
Sbjct tleqrkrngeplgaitedkfqdYLKRLWREQKRAWeeygXILIPGVEITNNT--------   98
DSSP  hhhhhhhllllllllllllhhhHHHHHHHHHHHHHhhhlLEEEEEEEEEELL--------


DSSP  llhhhhhhhhHHHHhllllllllleeeeeeeelllllllhhhhHHHHHHHHHHHHHLLLE
Query rsvqelaqemVDEIeqgidgtelkagiiaeigtsegkitpleeKVFIAAALAHNQTGRPI  154
ident                                                             
Sbjct dlyhivavdvKEYV--------------------------dpsLPVEEIVEKLKEQNALV  132
DSSP  lleeeeeellLLLL--------------------------lllLLHHHHHHHHHHLLLEE


DSSP  EEELHH-----hlLHHHhHHHHHHllllhhHEEELLLlllllhhhHHHHHHLLLEEEell
Query STHTSF-----stMGLEqLALLQAhgvdlsRVTVGHCdlkdnldnILKMIDLGAYVQfdt  209
ident                                                             
Sbjct IAAHPDrkklswyLWAN-XERFKD-----tFDAWEIA---nrddlFNSVGVKKYRYV---  180
DSSP  EELLLLllllllhHHHL-LLLLLL-----lLLEEEEE---elleeLHHHHHLLLLEE---


DSSP  llllllllhhhhhhhhhhhhhlllhhheeELLLLLLHhhlhhhllLLLLHHhhlhhhhhh
Query igknsyypdekriamlhalrdrgllnrvmLSMDITRRshlkanggYGYDYLlttfipqlr  269
ident                                 |                           
Sbjct -----------------------------ANSDFHEL--------WHVYSW---------  194
DSSP  -----------------------------EELLLLLH--------HHHLLE---------


DSSP  hllllhhhhhhhHLHH---hhHHLL---------------
Query qsgfsqadvdvmLREN---psQFFQ---------------  291
ident             |                           
Sbjct ----------ktLVKSeknieAIKEairkntdvaiylxrk  224
DSSP  ----------eeEEEElllhhHHHHhhhhllleeeeelll


No 59: Query=1bf6A Sbjct=3e38A Z-score=5.1

back to top
DSSP  ------------lllLLLEEEEEELlLEELhhhhllhhHEELLHhHHHHHHHHHHhllEE
Query ------------sfdPTGYTLAHEHlHIDLsgfknnvdCRLDQYaFICQEMNDLMtrgVR   48
ident                 |     | |                        |          
Sbjct aqrrneiqvpdldgyTTLKCDFHXHsVFSD--------GLVWPT-VRVDEAYRDG---LD   48
DSSP  lllllllllllllllEEEEEELLLLlLLLL--------LLLLHH-HHHHHHHHLL---LL


DSSP  EEEELLLHHH-----------llLHHHHHHHHHHHLLEEEEEELLLLHhhlllhhhhllh
Query NVIEMTNRYM-----------grNAQFMLDVMRETGINVVACTGYYQDaffpehvatrsv   97
ident                                    ||                       
Sbjct AISLTEHIEYrphkqdvvsdhnrSFDLCREQAEKLGILLIKGSEITRA------------   96
DSSP  EELLEEELLLllllllllllllhHHHHHHHHHHHHLLEELLEEEEELL------------


DSSP  hhhhhhhhhhhhllllllllleeeeeeeellllLLLH---------------HHHHHHHH
Query qelaqemvdeieqgidgtelkagiiaeigtsegKITP---------------LEEKVFIA  142
ident                                                          |  
Sbjct --------------------------------xAPGHfnaiflsdsnpleqkDYKDAFRE  124
DSSP  --------------------------------lLLLEeeeelllllhhhlllLHHHHHHH


DSSP  HHHHHhhhlLLEEEELHHH-------llhhHHHHHHHHLLLlhhhEEELLL---LLLLLh
Query AALAHnqtgRPISTHTSFS-------tmglEQLALLQAHGVdlsrVTVGHC---DLKDNl  192
ident |                                  |   |                    
Sbjct AKKQG----AFXFWNHPGWdsqqpdttkwwPEHTALYQEGC---xHGIEVAnghLYXPE-  176
DSSP  HHHLL----LEEEELLLLLlllllllllllHHHHHHHHLLL---lLEEEEEellEELLH-


DSSP  hhHHHHHHLLLEEEellllllllllhhhhhhhhhhhhhlllhhheeELLLLLlHHHLhhh
Query dnILKMIDLGAYVQfdtigknsyypdekriamlhalrdrgllnrvmLSMDITrRSHLkan  252
ident   |    |                                         ||         
Sbjct -aIQWCLDKNLTXI--------------------------------GTSDIH-QPIQ---  199
DSSP  -hHHHHHHHLLEEE--------------------------------EELLLL-LLHH---


DSSP  llllllhhhHLHHhhhhhllllhhhhhhHHLH-------hHHHHL---------------
Query ggygydyllTTFIpqlrqsgfsqadvdvMLRE-------nPSQFF---------------  290
ident                                                             
Sbjct ---tdydfeKGEH------------rtxTFVFakerslqgIREALdnrrtaayfhellig  244
DSSP  ---hhllhhHLLL------------lleEEEEellllhhhHHHHHhllleeeeelleeel


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  290
ident                                                             
Sbjct redllrpffekcvkieevsrneqgvtlsitnvtdlvlklkktahdtllvyfrdxtlkpht  304
DSSP  lhhhhhhhhhhheeeeeeeeelleeeeeeeellllleeeeelllllleellleeeellle


DSSP  -------------------------------------l
Query -------------------------------------q  291
ident                                       
Sbjct rytvrigfkqgikggdvnfevtnfivapdkglkytisl  342
DSSP  eeeeeeeellllllleeeeeeeeeeeelleeeeeeeel