Results: dupa

Query: 1a5kC

MOLECULE: UREASE (GAMMA SUBUNIT);

Select neighbours (check boxes) for viewing as multiple structural alignment or 3D superimposition. The list of neighbours is sorted by Z-score. Similarities with a Z-score lower than 2 are spurious. Each neighbour has links to pairwise structural alignment with the query structure, and to the PDB format coordinate file where the neighbour is superimposed onto the query structure.

Expand gaps

Summary

    No:  Chain   Z    rmsd lali nres  %id PDB  Description
   1:  1a5k-C 79.0  0.0  566   566  100 PDB  MOLECULE: UREASE (GAMMA SUBUNIT);                                    
   2:  1gkp-A 23.8  2.5  340   458   22 PDB  MOLECULE: HYDANTOINASE;                                              
   3:  3e74-A 23.6  2.7  338   429   20 PDB  MOLECULE: ALLANTOINASE;                                              
   4:  1yrr-B 22.3  2.7  293   334   15 PDB  MOLECULE: N-ACETYLGLUCOSAMINE-6-PHOSPHATE DEACETYLASE;               
   5:  4b3z-D 22.2  2.8  343   477   19 PDB  MOLECULE: DIHYDROPYRIMIDINASE-RELATED PROTEIN 1;                     
   6:  3giq-A 21.5  3.0  331   475   22 PDB  MOLECULE: N-ACYL-D-GLUTAMATE DEACYLASE;                              
   7:  2vun-A 21.2  2.8  313   385   19 PDB  MOLECULE: ENAMIDASE;                                                 
   8:  3nqb-A 21.2  3.1  302   587   19 PDB  MOLECULE: ADENINE DEAMINASE 2;                                       
   9:  1onx-A 21.1  3.1  313   390   17 PDB  MOLECULE: ISOASPARTYL DIPEPTIDASE;                                   
  10:  3gri-A 21.1  2.9  322   422   15 PDB  MOLECULE: DIHYDROOROTASE;                                            
  11:  3mtw-A 19.5  3.3  312   404   19 PDB  MOLECULE: L-ARGININE CARBOXYPEPTIDASE CC2672;                        
  12:  4cqb-A 19.3  3.3  303   402   19 PDB  MOLECULE: N-ISOPROPYLAMMELIDE ISOPROPYL AMIDOHYDROLASE;              
  13:  2paj-A 18.9  3.1  300   421   17 PDB  MOLECULE: PUTATIVE CYTOSINE/GUANINE DEAMINASE;                       
  14:  2oof-A 18.6  3.3  293   403   18 PDB  MOLECULE: 4-IMIDAZOLONE-5-PROPANOATE AMIDOHYDROLASE;                 
  15:  2ogj-A 18.4  3.3  297   379   18 PDB  MOLECULE: DIHYDROOROTASE;                                            
  16:  3mkv-A 18.3  3.0  307   414   20 PDB  MOLECULE: PUTATIVE AMIDOHYDROLASE;                                   
  17:  1j6p-A 18.1  3.7  302   407   16 PDB  MOLECULE: METAL-DEPENDENT HYDROLASE OF                               
  18:  3ls9-A 17.8  3.7  316   453   16 PDB  MOLECULE: TRIAZINE HYDROLASE;                                        
  19:  4c5y-A 17.4  3.2  316   436   17 PDB  MOLECULE: OCHRATOXINASE;                                             
  20:  3icj-A 17.2  3.4  279   468   16 PDB  MOLECULE: UNCHARACTERIZED METAL-DEPENDENT HYDROLASE;                 
  21:  3pnu-A 17.0  3.4  259   338   11 PDB  MOLECULE: DIHYDROOROTASE;                                            
  22:  1k6w-A 16.9  3.9  303   423   14 PDB  MOLECULE: CYTOSINE DEAMINASE;                                        
  23:  3ooq-A 16.8  3.0  268   384   21 PDB  MOLECULE: AMIDOHYDROLASE;                                            
  24:  2uz9-A 16.4  3.8  308   444   15 PDB  MOLECULE: GUANINE DEAMINASE;                                         
  25:  3cjp-A 15.2  2.7  208   262   12 PDB  MOLECULE: PREDICTED AMIDOHYDROLASE, DIHYDROOROTASE FAMILY;           
  26:  4rdv-B 15.2  3.7  305   451   17 PDB  MOLECULE: N-FORMIMINO-L-GLUTAMATE IMINOHYDROLASE;                    
  27:  2ob3-A 15.1  3.1  217   329   18 PDB  MOLECULE: PARATHION HYDROLASE;                                       
  28:  3k2g-B 14.3  3.1  217   358   11 PDB  MOLECULE: RESINIFERATOXIN-BINDING, PHOSPHOTRIESTERASE-               
  29:  2y1h-B 14.2  3.1  210   265   13 PDB  MOLECULE: PUTATIVE DEOXYRIBONUCLEASE TATDN3;                         
  30:  1bf6-A 13.9  3.0  203   291   11 PDB  MOLECULE: PHOSPHOTRIESTERASE HOMOLOGY PROTEIN;                       
  31:  3irs-A 13.8  3.2  216   281   12 PDB  MOLECULE: UNCHARACTERIZED PROTEIN BB4693;                            
  32:  2qpx-A 13.8  3.2  222   376   11 PDB  MOLECULE: PREDICTED METAL-DEPENDENT HYDROLASE OF THE TIM-BA          
  33:  4mup-B 13.5  3.2  212   286   13 PDB  MOLECULE: AMIDOHYDROLASE;                                            
  34:  2vc5-A 13.5  3.1  205   314   15 PDB  MOLECULE: ARYLDIALKYLPHOSPHATASE;                                    
  35:  4dlf-A 13.3  3.3  217   287   12 PDB  MOLECULE: AMIDOHYDROLASE 2;                                          
  36:  3qy6-A 12.9  3.0  195   247   13 PDB  MOLECULE: TYROSINE-PROTEIN PHOSPHATASE YWQE;                         
  37:  2dvt-A 12.6  3.0  206   325   11 PDB  MOLECULE: THERMOPHILIC REVERSIBLE GAMMA-RESORCYLATE DECARBO          
  38:  4ofc-A 12.5  3.1  206   335   15 PDB  MOLECULE: 2-AMINO-3-CARBOXYMUCONATE-6-SEMIALDEHYDE DECARBOX          
  39:  3gg7-A 12.5  3.4  203   243   13 PDB  MOLECULE: UNCHARACTERIZED METALLOPROTEIN;                            
  40:  1a4m-A 12.4  3.2  213   349   13 PDB  MOLECULE: ADENOSINE DEAMINASE;                                       
  41:  2imr-A 12.3  3.7  244   380   11 PDB  MOLECULE: HYPOTHETICAL PROTEIN DR_0824;                              
  42:  1itq-A 12.3  3.2  218   369   11 PDB  MOLECULE: RENAL DIPEPTIDASE;                                         
  43:  2ffi-A 12.2  3.2  207   273   14 PDB  MOLECULE: 2-PYRONE-4,6-DICARBOXYLIC ACID HYDROLASE, PUTATIV          
  44:  2gwg-A 11.9  3.6  203   329   13 PDB  MOLECULE: 4-OXALOMESACONATE HYDRATASE;                               
  45:  4qrn-A 11.8  3.1  206   352   11 PDB  MOLECULE: 5-CARBOXYVANILLATE DECARBOXYLASE;                          
  46:  4hk5-D 11.6  3.3  211   380   10 PDB  MOLECULE: URACIL-5-CARBOXYLATE DECARBOXYLASE;                        
  47:  4dzi-C 10.6  3.3  195   388   11 PDB  MOLECULE: PUTATIVE TIM-BARREL METAL-DEPENDENT HYDROLASE;             
  48:  1j5s-A 10.4  3.5  221   451   11 PDB  MOLECULE: URONATE ISOMERASE;                                         
  49:  1v77-A 10.1  3.0  172   202    9 PDB  MOLECULE: HYPOTHETICAL PROTEIN PH1877;                               
  50:  3iac-A  9.8  3.6  231   469    9 PDB  MOLECULE: GLUCURONATE ISOMERASE;                                     
  51:  2a3l-A  7.7  3.8  220   616   14 PDB  MOLECULE: AMP DEAMINASE;                                             
  52:  3au2-A  7.5  6.4  196   575    9 PDB  MOLECULE: DNA POLYMERASE BETA FAMILY (X FAMILY);                     
  53:  1m65-A  7.3  3.3  168   234    9 PDB  MOLECULE: HYPOTHETICAL PROTEIN YCDX;                                 
  54:  3f2b-A  6.8 12.2  191   994    7 PDB  MOLECULE: DNA-DIRECTED DNA POLYMERASE III ALPHA CHAIN;               
  55:  3dcp-A  6.3  3.4  155   277   14 PDB  MOLECULE: HISTIDINOL-PHOSPHATASE;                                    
  56:  1bks-A  5.4  3.8  164   255   10 PDB  MOLECULE: TRYPTOPHAN SYNTHASE;                                       
  57:  2anu-A  4.9  3.7  145   224   14 PDB  MOLECULE: HYPOTHETICAL PROTEIN TM0559;                               
  58:  2yb1-A  4.3  4.0  143   284   12 PDB  MOLECULE: AMIDOHYDROLASE;                                            
  59:  3e38-A  4.2  4.2  150   342   12 PDB  MOLECULE: TWO-DOMAIN PROTEIN CONTAINING PREDICTED PHP-LIKE           


Pairwise Structural Alignments

Notation: three-state secondary structure definitions by DSSP (reduced to H=helix, E=sheet, L=coil) are shown above the amino acid sequence. Structurally equivalent residues are in uppercase, structurally non-equivalent residues (e.g. in loops) are in lowercase. Amino acid identities are marked by vertical bars.

No 1: Query=1a5kC Sbjct=1a5kC Z-score=79.0

back to top
DSSP  LEEEHHHHHHHHLLLLLLEEELLLLLLEEELLEELLLLLLLLLLLLLLLLLLLLLLLLLL
Query SNISRQAYADMFGPTVGDKVRLADTELWIEVEDDLTTYGEEVKFGGGKVIRDGMGQGQML   60
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct SNISRQAYADMFGPTVGDKVRLADTELWIEVEDDLTTYGEEVKFGGGKVIRDGMGQGQML   60
DSSP  LEEEHHHHHHHHLLLLLLEEELLLLLLEEELLEELLLLLLLLLLLLLLLLLLLLLLLLLL


DSSP  HHHLLLEEEEEEEEEELLEEEEEEEEEELLEEEEEELEELLLLLLLLLEELLLLLEEEEL
Query AADCVDLVLTNALIVDHWGIVKADIGVKDGRIFAIGKAGNPDIQPNVTIPIGAATEVIAA  120
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct AADCVDLVLTNALIVDHWGIVKADIGVKDGRIFAIGKAGNPDIQPNVTIPIGAATEVIAA  120
DSSP  HHHLLLEEEEEEEEEELLEEEEEEEEEELLEEEEEELEELLLLLLLLLEELLLLLEEEEL


DSSP  LLLEEEELEEEEEEELLLLLHHHHHHHHLEEEEEEELLLLLHHHHHLLLLLHHHHHHHHH
Query EGKIVTAGGIDTHIHWICPQQAEEALVSGVTTMVGGGTGPAAGTHATTCTPGPWYISRML  180
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct EGKIVTAGGIDTHIHWICPQQAEEALVSGVTTMVGGGTGPAAGTHATTCTPGPWYISRML  180
DSSP  LLLEEEELEEEEEEELLLLLHHHHHHHHLEEEEEEELLLLLHHHHHLLLLLHHHHHHHHH


DSSP  HHHLLLLLEEEEEEELLLLLHHHHHHHHHHLLLEEEEEHHHLLLHHHHHHHHHHHHHHLL
Query QAADSLPVNIGLLGKGNVSQPDALREQVAAGVIGLEIHEDWGATPAAIDCALTVADEMDI  240
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct QAADSLPVNIGLLGKGNVSQPDALREQVAAGVIGLEIHEDWGATPAAIDCALTVADEMDI  240
DSSP  HHHLLLLLEEEEEEELLLLLHHHHHHHHHHLLLEEEEEHHHLLLHHHHHHHHHHHHHHLL


DSSP  EEEEELLLLLLLLLHHHHHHHHLLLLEEELLLLLLLLLLLLLHHHHHHLLLEEEEEEHHH
Query QVALHSDTLNESGFVEDTLAAIGGRTIHTFHTEGAGGGHAPDIITACAHPNILPSSTNPT  300
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct QVALHSDTLNESGFVEDTLAAIGGRTIHTFHTEGAGGGHAPDIITACAHPNILPSSTNPT  300
DSSP  EEEEELLLLLLLLLHHHHHHHHLLLLEEELLLLLLLLLLLLLHHHHHHLLLEEEEEEHHH


DSSP  LLLLLLHHHHHHHHHHHHHLLLLLLHHHHHLLLLLLLHHHHHHHHHHHHLLLLLEEELLL
Query LPYTLNTIDEHLDMLMVCHHLDPDIAEDVAFAESRIRRETIAAEDVLHDLGAFSLTSSDS  360
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct LPYTLNTIDEHLDMLMVCHHLDPDIAEDVAFAESRIRRETIAAEDVLHDLGAFSLTSSDS  360
DSSP  LLLLLLHHHHHHHHHHHHHLLLLLLHHHHHLLLLLLLHHHHHHHHHHHHLLLLLEEELLL


DSSP  LLLLLLLLHHHHHHHHHHHHHHHHLLLLLLLLLLLHHHHHHHHHLLLHHHHHHLLLLLLL
Query QAMGRVGEVILRTWQVAHRMKVQRGALAEETGDNDNFRVKRYIAKYTINPALTHGIAHEV  420
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct QAMGRVGEVILRTWQVAHRMKVQRGALAEETGDNDNFRVKRYIAKYTINPALTHGIAHEV  420
DSSP  LLLLLLLLHHHHHHHHHHHHHHHHLLLLLLLLLLLHHHHHHHHHLLLHHHHHHLLLLLLL


DSSP  LLLLLLLLLLEEEELHHHLLLLLLEEEELLEEEEEEELLLLLLLLLLLLLEEEELHHHLH
Query GSIEVGKLADLVVWSPAFFGVKPATVIKGGMIAIAPMGDINASIPTPQPVHYRPMFGALG  480
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct GSIEVGKLADLVVWSPAFFGVKPATVIKGGMIAIAPMGDINASIPTPQPVHYRPMFGALG  480
DSSP  LLLLLLLLLLEEEELHHHLLLLLLEEEELLEEEEEEELLLLLLLLLLLLLEEEELHHHLH


DSSP  HHHHHHLEEEELHHHHHHLHHHHLLLLLEEEELLLLLLLLHHHLLLLLLLLLEEELLLLL
Query SARHHCRLTFLSQAAAANGVAERLNLRSAIAVVKGCRTVQKADMVHNSLQPNITVDAQTY  540
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct SARHHCRLTFLSQAAAANGVAERLNLRSAIAVVKGCRTVQKADMVHNSLQPNITVDAQTY  540
DSSP  HHHHHHLEEEELHHHHHHLHHHHLLLLLEEEELLLLLLLLHHHLLLLLLLLLEEELLLLL


DSSP  LEEELLEELLLLLLLLLLLLLLLLLL
Query EVRVDGELITSEPADVLPMAQRYFLF  566
ident ||||||||||||||||||||||||||
Sbjct EVRVDGELITSEPADVLPMAQRYFLF  566
DSSP  LEEELLEELLLLLLLLLLLLLLLLLL


No 2: Query=1a5kC Sbjct=1gkpA Z-score=23.8

back to top
DSSP  leeehhhhhhhhlllllleeelllllleeelleellllllllllllllllllllllllll
Query snisrqayadmfgptvgdkvrladtelwieveddlttygeevkfgggkvirdgmgqgqml   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhhllLEEEEEEEEEELLEEEEEEEEEELLEEEEEELEelllllllllEELLLLLEEEEL
Query aadcvDLVLTNALIVDHWGIVKADIGVKDGRIFAIGKAgnpdiqpnvtIPIGAATEVIAA  120
ident       |   |  |       ||||      |  ||                  |||| |
Sbjct -----PLLIKNGEIITADSRYKADIYAEGETITRIGQN----------LEAPPGTEVIDA   45
DSSP  -----LEEEELLEEEELLEEEELEEEELLLLLLEEELL----------LLLLLLLEEEEL


DSSP  LLLEEEELEEEEEEEL----------LLLL-HHHHHHHHLEEEEEEelllllhhhhhlLL
Query EGKIVTAGGIDTHIHW----------ICPQ-QAEEALVSGVTTMVGggtgpaagthatTC  169
ident  || |  | || | |                    ||  | ||                |
Sbjct TGKYVFPGFIDPHVHIylpfmatfakDTHEtGSKAALMGGTTTYIE------------MC   93
DSSP  LLLEEEELEEEEEELLlleelleellLLHHhHHHHHHHLLEEEEEE------------EE


DSSP  LL-----HHHHHHHHHHHHL-LLLLEEEEEEELLLL---LHHHHHHHHHHLLLEEEEEHH
Query TP-----GPWYISRMLQAAD-SLPVNIGLLGKGNVS---QPDALREQVAAGVIGLEIHED  220
ident  |                |                        ||| || |     |   
Sbjct CPsrnddALEGYQLWKSKAEgNSYCDYTFHMAVSKFdekTEGQLREIVADGISSFXIFLS  153
DSSP  LLlllllHHHHHHHHHHHHLlLLLLEEEEEEELLLLlllHHHHHHHHHHLLLLEEEEEEL


DSSP  ----HLLLHHHHHHHHHHHHHHLLEEEEELLLLLL-------------------------
Query ----WGATPAAIDCALTVADEMDIQVALHSDTLNE-------------------------  251
ident      |         |  | |    |  |                               
Sbjct yknfFGVDDGEMYQTLRLAKELGVIVTAHCENAELvgrlqqkllsegktgpewhepsrpe  213
DSSP  llllLLLLHHHHHHHHHHHHHHLLEEEEEELLHHHhhhhhhhhhhlllllhhhllllllh


DSSP  ---lLLHHHHHHHHL--LLLEEELLLLLlllllllLHHH-HHHLL----LEEEEEEHHHL
Query ---sGFVEDTLAAIG--GRTIHTFHTEGaggghapDIIT-ACAHP----NILPSSTNPTL  301
ident                  | |    |               | |       |   |  |  
Sbjct aveaEGTARFATFLEttGATGYVVHLSC------kPALDaAMAAKargvPIYIESVIPHF  267
DSSP  hhhhHHHHHHHHHHHhhLLEEEELLLLL------hHHHHhHHHHHhlllLEEEEEEHHHH


DSSP  LLlllHHHHH-------HHHHhhhhllllllhhhhhlllllLLHHHHHHHHHHHHLLLLL
Query PYtlnTIDEH-------LDMLmvchhldpdiaedvafaesrIRRETIAAEDVLHDLGAFS  354
ident                                                         |   
Sbjct LL---DKTYAerggveaMKYI---------------mspplRDKRNQKVLWDALAQGFID  309
DSSP  HL---LHHHHhllhhhhHLLL---------------lllllLLLHHHHHHHHHHHLLLLL


DSSP  EEELLLL-------------------LLLLLLLHHHHHH-HHHHHHHhhhllllllllll
Query LTSSDSQ-------------------AMGRVGEVILRTW-QVAHRMKvqrgalaeetgdn  394
ident     |                                       |               
Sbjct TVGTDHCpfdteqkllgkeaftaipnGIPAIEDRVNLLYtYGVSRGR-------------  356
DSSP  EEELLLLlllhhhhhhhlllhhhlllLLLLLLLHHHHHHhHHLLLLL-------------


DSSP  lhhHHHHHHHLLLHHHHHHLLLLLLLLLLLLLLLLLEEEELHHH----------------
Query dnfRVKRYIAKYTINPALTHGIAHEVGSIEVGKLADLVVWSPAF----------------  438
ident       |         |   |     | | ||  |||||  |                  
Sbjct --lDIHRFVDAASTKAAKLFGLFPRKGTIAVGSDADLVVYDPQYrgtisvktqhvnndyn  414
DSSP  --lLHHHHHHHHLHHHHHHLLLLLLLLLLLLLLLLLEEEEELLLleellhhhllllllll


DSSP  ------llLLLLEEEELLEEEEEEellllllllllllleEEELhHHLHhhhhhHLEEEEl
Query ------fgVKPATVIKGGMIAIAPmgdinasiptpqpvhYRPMfGALGsarhhCRLTFLs  492
ident           |  |   |  |                       |  |            
Sbjct gfegfeidGRPSVVTVRGKVAVRD---------------GQFV-GEKG-----WGKLLR-  452
DSSP  llllleelLEEEEEEELLEEEEEL---------------LEEL-LLLL-----LLLLLL-


DSSP  hhhhhhlhhhhllllleeeeLLLLLLllhhhllllllllleeelllllleeelleellll
Query qaaaangvaerlnlrsaiavVKGCRTvqkadmvhnslqpnitvdaqtyevrvdgelitse  552
ident                                                             
Sbjct --------------------REPMYF----------------------------------  458
DSSP  --------------------LLLLLL----------------------------------


DSSP  llllllllllllll
Query padvlpmaqryflf  566
ident               
Sbjct --------------  458
DSSP  --------------


No 3: Query=1a5kC Sbjct=3e74A Z-score=23.6

back to top
DSSP  leeehhhhhhhhlllllleeelllllleeelleellllllllllllllllllllllllll
Query snisrqayadmfgptvgdkvrladtelwieveddlttygeevkfgggkvirdgmgqgqml   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhhLLLEEEEEEEEEELLEEEEEEEEEELLEEEEEELeellllllllLEELlllLEEEEL
Query aadCVDLVLTNALIVDHWGIVKADIGVKDGRIFAIGKagnpdiqpnvTIPIgaaTEVIAA  120
ident      ||   |            || || | | |||                   ||  |
Sbjct ---SFDLIIKNGTVILENEARVVDIAVKGGKIAAIGQ----------DLGD--aKEVXDA   45
DSSP  ---LEEEEEELLEEELLLLEEELEEEEELLEEEEEEL----------LLLL--eEEEEEL


DSSP  LLLEEEELEEEEEEeLLLL-LHHHHHHHHLEEEEEEELllllHHHHhlllLLHHHHHHHH
Query EGKIVTAGGIDTHIhWICP-QQAEEALVSGVTTMVGGGtgpaAGTHattcTPGPWYISRM  179
ident  |  |  |  | |   |        |   | ||                 |     |   
Sbjct SGLVVSPGXVDAHT-HIGYeTGTRAAAKGGITTXIEXP----LNQL--paTVDRASIELK   98
DSSP  LLLEEEELEEEEEE-LLLHhHHHHHHHHLLEEEEEELL----LLLL--llLLLHHHHHHH


DSSP  HHHHL-LLLLEEEEEEELLLLLHHHHHHHHHHLLLEEEEEHhHLLLHHHHHHHHHHHHHH
Query LQAAD-SLPVNIGLLGKGNVSQPDALREQVAAGVIGLEIHEdWGATPAAIDCALTVADEM  238
ident   ||   |      ||       | | |    || |                      | 
Sbjct FDAAKgKLTIDAAQLGGLVSYNIDRLHELDEVGVVGFXCFV-RDVNDWQFFKGAQKLGEL  157
DSSP  HHHHLlLLLLEEEELEELLLLLLLLHHHHHHHLLLLEEEEL-LLLLHHHHHHHHHHHHHH


DSSP  LLEEEEELLLLLL----------------------------lLLHHHHHHHHLL--LLEE
Query DIQVALHSDTLNE----------------------------sGFVEDTLAAIGG--RTIH  268
ident    |  |                                         |          |
Sbjct GQPVLVHCENALIcdelgeeakregrvtahdyvasrpvftevEAIRRVLYLAKVagCRLH  217
DSSP  LLLEEEELLLHHHhhhhhhhhhhhllllhhhhhhlllhhhhhHHHHHHHHHHHHhlLLEE


DSSP  ELLLLLlllllllLHHH-HHHLL----LEEEEEEHHHLLLlllHHHHH----HHHHhhhh
Query TFHTEGaggghapDIIT-ACAHP----NILPSSTNPTLPYtlnTIDEH----LDMLmvch  319
ident   |                         |   |            |              
Sbjct VCHVSS------pEGVEeVTRARqegqDITCESCPHYFVL---DTDQFeeigTLAK----  264
DSSP  ELLLLL------hHHHHhHHHHHhlllLEEEEELLHHHHL---LHHHHhhhlHHHL----


DSSP  llllllhhhhhllllLLLH-HHHHHHHHHHHLLLLLEEELLLL----------------L
Query hldpdiaedvafaesRIRR-ETIAAEDVLHDLGAFSLTSSDSQ----------------A  362
ident                 ||  |           |      ||                   
Sbjct ------------cspPIRDlENQKGXWEKLFNGEIDCLVSDHSpcppexkagnixkawgG  312
DSSP  ------------lllLLLLhHHHHHHHHHHHLLLLLEELLLLLllllllllllllllllL


DSSP  LLLLLLHHHHHH-HHHHHHHhhhlllllllllllhHHHHHHHHLLLHHHHHHLLLlLLLL
Query MGRVGEVILRTW-QVAHRMKvqrgalaeetgdndnFRVKRYIAKYTINPALTHGIaHEVG  421
ident                                                | |   |     |
Sbjct IAGLQSCXDVXFdEAVQKRG---------------XSLPXFGKLXATNAADIFGL-QQKG  356
DSSP  LLLHHHHHHHHHhHHLLLLL---------------LLHHHHHHHHLHHHHHHLLL-LLLL


DSSP  LLLLLLLLLEEEELHHH----------------------llLLLLEEEELLEEEEEEEll
Query SIEVGKLADLVVWSPAF----------------------fgVKPATVIKGGMIAIAPMgd  459
ident  |  || || |   |                                |  |         
Sbjct RIAPGKDADFVFIQPNSsyvltnddleyrhkvspyvgrtigARITKTILRGDVIYDIE--  414
DSSP  LLLLLLLLLEEEEELLLleellhhhllllllllllllleelLEEEEEEELLEEEEELL--


DSSP  llllllllllleEEELHHHlhhhhhhHLEEEELHhhhhhlhhhhllllleeeelllllll
Query inasiptpqpvhYRPMFGAlgsarhhCRLTFLSQaaaangvaerlnlrsaiavvkgcrtv  519
ident                                |                            
Sbjct ------------QGFPVAP-------KGQFILKH--------------------------  429
DSSP  ------------LLLLLLL-------LLLEELLL--------------------------


DSSP  lhhhllllllllleeelllllleeelleellllllllllllllllll
Query qkadmvhnslqpnitvdaqtyevrvdgelitsepadvlpmaqryflf  566
ident                                                
Sbjct -----------------------------------------------  429
DSSP  -----------------------------------------------


No 4: Query=1a5kC Sbjct=1yrrB Z-score=22.3

back to top
DSSP  leeehhhhhhhhlllllleeelllllleeelleellllllllllllllllllllllllll
Query snisrqayadmfgptvgdkvrladtelwieveddlttygeevkfgggkvirdgmgqgqml   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhhlllEEEEEEEEEELLEEEE-EEEEEELLEEEEEELEelllllllLLEELLllLEEEE
Query aadcvdLVLTNALIVDHWGIVK-ADIGVKDGRIFAIGKAgnpdiqpnVTIPIGaaTEVIA  119
ident         ||   |               || |                 |     |   
Sbjct ------YALTQGRIFTGHEFLDdHAVVIADGLIKSVCPV--------AELPPE--IEQRS   44
DSSP  ------LEEELLEEELLLLEELlEEEEEELLEEEEEEEH--------HHLLLL--LLEEE


DSSP  LLLLEEEELEEEEEEEL----------------LLLLHHHHHHHHLEEEEEEELllllhh
Query AEGKIVTAGGIDTHIHW----------------ICPQQAEEALVSGVTTMVGGGtgpaag  163
ident   | |   | ||                                || |            
Sbjct LNGAILSPGFIDVQLNGcggvqfndtaeavsveTLEIMQKANEKSGCTNYLPTL------   98
DSSP  LLLLEEEELEEEEEELEelleelllllllllhhHHHHHHHHHHLLLEEEEEEEE------


DSSP  hhhllllLHHHHHHHHHHHHLLLLLE-EEEEEELLLllHHHHHHHHHH--LLLEEEEehh
Query thattctPGPWYISRMLQAADSLPVN-IGLLGKGNVsqPDALREQVAA--GVIGLEIhed  220
ident                |       |    ||   |                          
Sbjct -ittsdeLMKQGVRVMREYLAKHPNQaLGLHLEGPWlnAALVDFLCENadVITKVTL---  154
DSSP  -llllhhHHHHHHHHHHHHHHHLLLLlLLEEEELLLllLHHHHHHHHLhhHEEEEEE---


DSSP  hlLLHHHHHHHHHHHHHHLLEEEEELLLlllllLHHHHHHHHLLLLEEELLLLLllLLLL
Query wgATPAAIDCALTVADEMDIQVALHSDTlnesgFVEDTLAAIGGRTIHTFHTEGagGGHA  280
ident   |                | |                 |          |         
Sbjct --APEMVPAEVISKLANAGIVVSAGHSN----aTLKEAKAGFRAGITFATHLYN--AMPY  206
DSSP  --LHHHLLHHHHHHHHHHLLEEEELLLL----lLHHHHHHHHHHLEEEELLLLL--LLLL


DSSP  L-----LHHH-HHHLLLEEEEEEHH--HLLLlllhhhhhhhhhhhhhllllllhhhhhll
Query P-----DIIT-ACAHPNILPSSTNP--TLPYtlntidehldmlmvchhldpdiaedvafa  332
ident                  |            |                             
Sbjct ItgrepGLAGaILDEADIYCGIIADglHVDY-----------------------------  237
DSSP  LlllllHHHHhHHHLLLLEEEEELLllLLLH-----------------------------


DSSP  lllllhhhhHHHHHHHhLLLL--LEEELLLLlLLLLlLHHHHHHHHHHHHHhhhllllll
Query esrirretiAAEDVLHdLGAF--SLTSSDSQaMGRVgEVILRTWQVAHRMKvqrgalaee  390
ident          |                  |          |                    
Sbjct ---------ANIRNAK-RLKGdkLCLVTDATsGSSL-TMIEGVRNLVEHCG---------  277
DSSP  ---------HHHHHHH-HHHHhhEEEELLLLlLLLL-LHHHHHHHHHHHHL---------


DSSP  lllllhhHHHHHHHLLLHHHHHHLLLLLLLLLLLLLLLLLEEEELHHhllLLLLEEEELL
Query tgdndnfRVKRYIAKYTINPALTHGIAHEVGSIEVGKLADLVVWSPAffgVKPATVIKGG  450
ident                 |  ||   |     |    || | |    |     |    |  |
Sbjct ------iALDEVLRMATLYPARAIGVEKRLGTLAAGKVANLTAFTPD---FKITKTIVNG  328
DSSP  ------lLHHHHHHHHLHHHHHHLLLLLLLLLLLLLLLLLEEEELLL---LLEEEEEELL


DSSP  EEEEEEellllllllllllleeeelhhhlhhhhhhhleeeelhhhhhhlhhhhlllllee
Query MIAIAPmgdinasiptpqpvhyrpmfgalgsarhhcrltflsqaaaangvaerlnlrsai  510
ident                                                             
Sbjct NEVVTQ------------------------------------------------------  334
DSSP  EEEEEL------------------------------------------------------


DSSP  eellllllllhhhllllllllleeelllllleeelleellllllllllllllllll
Query avvkgcrtvqkadmvhnslqpnitvdaqtyevrvdgelitsepadvlpmaqryflf  566
ident                                                         
Sbjct --------------------------------------------------------  334
DSSP  --------------------------------------------------------


No 5: Query=1a5kC Sbjct=4b3zD Z-score=22.2

back to top
DSSP  leeehhhhhhhhlllllleeelllllleeelleellllllllllllllllllllllllll
Query snisrqayadmfgptvgdkvrladtelwieveddlttygeevkfgggkvirdgmgqgqml   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhhllLEEEEEEEEEELLEEEEEEEEEELLEEEEEELeellllllllLEELLLLLEEEEL
Query aadcvDLVLTNALIVDHWGIVKADIGVKDGRIFAIGKagnpdiqpnvTIPIGAATEVIAA  120
ident       |      |        ||    || |  ||                     | |
Sbjct ----dRLLIKGGRIINDDQSLYADVYLEDGLIKQIGE----------NLIVPGGVKTIEA   46
DSSP  ----lEEEEEEEEEELLLLEEEEEEEEELLEEEEEEL----------LLLLLLLLEEEEL


DSSP  LLLEEEELEEEEEEELL------LLLHHHHHHHHLEEEEEEelllllhhhhhlLLLL---
Query EGKIVTAGGIDTHIHWI------CPQQAEEALVSGVTTMVGggtgpaagthatTCTP---  171
ident  |  |  ||||              |    ||| | |                   |   
Sbjct NGRMVIPGGIDVNTYLQktaaddFFQGTRAALVGGTTMIID------------HVVPepg   94
DSSP  LLLEEEELEEEEEELLLllllllHHHHHHHHHHLLEEEEEE------------EELLlll


DSSP  --HHHHHHHHHHHHL-LLLLEEEEEEELLLL---LHHHHHHHHH-HLLLEEEEEHH----
Query --GPWYISRMLQAAD-SLPVNIGLLGKGNVS---QPDALREQVA-AGVIGLEIHED----  220
ident             |||        |              |   |   ||            
Sbjct ssLLTSFEKWHEAADtKSCCDYSLHVDITSWydgVREELEVLVQdKGVNSFQVYMAykdv  154
DSSP  llHHHHHHHHHHHHHlLLLLEEEEEEELLLLlllHHHHHHHHHHlLLLLEEEEELLllll


DSSP  HLLLHHHHHHHHHHHHHHLLEEEEELLLLLL----------------------------l
Query WGATPAAIDCALTVADEMDIQVALHSDTLNE----------------------------s  252
ident           | |           |                                   
Sbjct YQMSDSQLYEAFTFLKGLGAVILVHAENGDLiaqeqkrilemgitgpeghalsrpeelea  214
DSSP  LLLLHHHHHHHHHHHHHHLLEEEEELLLHHHhhhhhhhhhhllllllhhhhhhllhhhhh


DSSP  lLHHHHHHHHL--LLLEEELLLLLllllllLLHH-HHHHLL----LEEEEEEHHHLLLll
Query gFVEDTLAAIG--GRTIHTFHTEGaggghaPDII-TACAHP----NILPSSTNPTLPYtl  305
ident   |       |                                            |    
Sbjct eAVFRAITIAGriNCPVYITKVMS------KSAAdIIALARkkgpLVFGEPIAASLGT--  266
DSSP  hHHHHHHHHHHhhLLLEEEEEELL------HHHHhHHHHHHhhllLEEEEELHHHHHL--


DSSP  lHHHHH--------HHHHhhhhllllllhhhhhllllLLLHHHHHHHHHHHHLLLLLEEE
Query nTIDEH--------LDMLmvchhldpdiaedvafaesRIRRETIAAEDVLHDLGAFSLTS  357
ident                                           |      |   |    | 
Sbjct -DGTHYwsknwakaAAFV--------------tspplSPDPTTPDYLTSLLACGDLQVTG  311
DSSP  -LLHHHhlllhhhhHHLL--------------lllllLLLLLHHHHHHHHHHHLLLLLLL


DSSP  LLLL-------------------LLLLLLLHHHHHHHHH-HHHHhhhlllllllllllhh
Query SDSQ-------------------AMGRVGEVILRTWQVA-HRMKvqrgalaeetgdndnf  397
ident |                            |     |  |    |                
Sbjct SGHCpystaqkavgkdnftlipeGVNGIEERMTVVWDKAvATGK---------------m  356
DSSP  LLLLlllhhhhhhhlllhhhlllLLLLLLLHHHHHHHHHlLLLL---------------l


DSSP  HHHHHHHLLLHHHHHHLLLLLLLLLLLLLLLLLEEEELHHH-------------------
Query RVKRYIAKYTINPALTHGIAHEVGSIEVGKLADLVVWSPAF-------------------  438
ident       |    | |         | | ||  || | | |                     
Sbjct DENQFVAVTSTNAAKIFNLYPRKGRIAVGSDADVVIWDPDKlktitakshksaveynife  416
DSSP  LHHHHHHHHLHHHHHHHLLLLLLLLLLLLLLLLEEEEEEEEeeellllllllllllllll


DSSP  ---llLLLLEEEELLEEEEEEellllllllllllleEEELhhHLHHHhhhhLEEEElhhh
Query ---fgVKPATVIKGGMIAIAPmgdinasiptpqpvhYRPMfgALGSArhhcRLTFLsqaa  495
ident        |  ||  | |                                           
Sbjct gmechGSPLVVISQGKIVFED---------------GNIN--VNKGM----GRFIP----  451
DSSP  lleeeEEEEEEEELLEEEEEL---------------LEEL--LLLLL----LLLLL----


DSSP  hhhlhhhhllllleeeeLLLLLLLLhhhllllllllleeelllllleeelleelllllll
Query aangvaerlnlrsaiavVKGCRTVQkadmvhnslqpnitvdaqtyevrvdgelitsepad  555
ident                   |                                         
Sbjct -----------------RKAFPEHL----------------------------yqrvkir  466
DSSP  -----------------LLLLLHHH----------------------------hhhhhhh


DSSP  lllllllllll
Query vlpmaqryflf  566
ident            
Sbjct nkvfglqgvsr  477
DSSP  hhhllllllll


No 6: Query=1a5kC Sbjct=3giqA Z-score=21.5

back to top
DSSP  leeehhhhhhhhlllllleeelllllleeelleellllllllllllllllllllllllll
Query snisrqayadmfgptvgdkvrladtelwieveddlttygeevkfgggkvirdgmgqgqml   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhHLLLEEEEEEEEEE--LLEEEEEEEEEELLEEEEEELEEllllllllLEELlllLEEE
Query aaDCVDLVLTNALIVD--HWGIVKADIGVKDGRIFAIGKAGnpdiqpnvTIPIgaaTEVI  118
ident      |   |   | |        || || |||| |||  |          |        
Sbjct --EKLDFKITGGWIIDgtGAPRRRADLGVRDGRIAAIGELG--------AHPA---RHAW   47
DSSP  --LLEEEEEELLEELLllLLLLEELEEEEELLEEEEEELLL--------LLLE---EEEE


DSSP  ELLLLEEEELEEEEEEE-LLLL---LHHHHHHHHLEEEEEEElllllhhhhhLLLLLHH-
Query AAEGKIVTAGGIDTHIH-WICP---QQAEEALVSGVTTMVGGgtgpaagthaTTCTPGP-  173
ident  | ||||  | || | |                 | || | |                  
Sbjct DASGKIVAPGFIDVHGHdDLMFvekPDLRWKTSQGITTVVVG--------ncGVSAAPAp   99
DSSP  ELLLLEEEELEEELLLLlLLHHhhlLLLHHHHLLLEEEEEEL--------llLLLLLLLl


DSSP  ------------------HHHHHHHHHHL--LLLLEEEEEEELL----------------
Query ------------------WYISRMLQAAD--SLPVNIGLLGKGN----------------  197
ident                           | |      |   |                    
Sbjct lpgntaaalallgetplfADVPAYFAALDaqRPMINVAALVGHAnlrlaamrdpqaapta  159
DSSP  llllllhhhhhhllllllLLHHHHHHHHHhlLLLLEEEEEEEHHhhhhhhlllllllllh


DSSP  ---llLHHHHHHHHHHLLLEEEEEH-HHLL---LHHHHHHHHHHHHHHLLEEEEELLL--
Query ---vsQPDALREQVAAGVIGLEIHE-DWGA---TPAAIDCALTVADEMDIQVALHSDT--  248
ident        | |     ||  |               |       || |       |     
Sbjct aeqqaMQDMLQAALEAGAVGFSTGLaYQPGavaQAAELEGLARVAAERRRLHTSHIRNea  219
DSSP  hhhhhHHHHHHHHHHHLLLEEEEELlLLLHhhlLHHHHHHHHHHHHHLLLEEEEELLLll


DSSP  llllLLHHHHHHHHL--LLLEEELLLLLL---llllllLHHH-HHHLL----LEEEEEEH
Query lnesGFVEDTLAAIG--GRTIHTFHTEGA---ggghapDIIT-ACAHP----NILPSSTN  298
ident       ||  ||     |      |                                   
Sbjct dgveAAVEEVLAIGRgtGCATVVSHHKCMmpqnwgrsrATLAnIDRAReqgvEVALDIYP  279
DSSP  llhhHHHHHHHHHHHhhLLEEEELLLLLLlhhhlllhhHHHHhHHHHHhlllLEEEEELL


DSSP  HHllllllhhhhhhhhhhhHHLLLlllhHHHHLLL-------------------------
Query PTlpytlntidehldmlmvCHHLDpdiaEDVAFAE-------------------------  333
ident                             |                               
Sbjct YP--------------gssTILIP----ERAETIDdiritwstphpecsgeyladiaarw  321
DSSP  LL--------------eeeEELLH----HHLLLLLlleeeeelllhhhllllhhhhhhhh


DSSP  ----------------lLLLHhHHHHHHHHHHlLLLLEEELLLL-----lllLLLLHHHH
Query ----------------sRIRReTIAAEDVLHDlGAFSLTSSDSQ-----amgRVGEVILR  372
ident                                         ||          |      |
Sbjct gcdkttaarrlapagaiYFAM-DEDEVKRIFQ-HPCCMVGSDGLpndarphpRLWGSFTR  379
DSSP  lllhhhhhhhhlleeeeEELL-LHHHHHHHHH-LLLEEELLLLLllllllllHHHHHHHH


DSSP  HH-HHHHHHHhhhlllllllllllhHHHHHHHHLLLHHHHHHLLLlLLLLLLLLLLLLLE
Query TW-QVAHRMKvqrgalaeetgdndnFRVKRYIAKYTINPALTHGIaHEVGSIEVGKLADL  431
ident                                 |  |  ||   |   | |    |  || 
Sbjct VLgRYVREAR--------------lMTLEQAVARMTALPARVFGF-AERGVLQPGAWADV  424
DSSP  HHhHHHHHLL--------------lLLHHHHHHHHLHHHHHHHLL-LLLLLLLLLLLLLE


DSSP  EEELHHHLL------------LLLLEEEELLEEEEEeellllllllllllleeeelHHHL
Query VVWSPAFFG------------VKPATVIKGGMIAIApmgdinasiptpqpvhyrpmFGAL  479
ident ||  |                |  | |   |                             
Sbjct VVFDPDTVAdratwdeptlasVGIAGVLVNGAEVFP--------------------QPPA  464
DSSP  EEELLLLLLllllllllllllLLEEEEEELLEEEEL--------------------LLLL


DSSP  HHhhhHHLEEEELhhhhhhlhhhhllllleeeellllllllhhhllllllllleeellll
Query GSarhHCRLTFLSqaaaangvaerlnlrsaiavvkgcrtvqkadmvhnslqpnitvdaqt  539
ident                                                             
Sbjct DG---RPGQVLRA-----------------------------------------------  474
DSSP  LL---LLLLLLLL-----------------------------------------------


DSSP  lleeelleellllllllllllllllll
Query yevrvdgelitsepadvlpmaqryflf  566
ident                            
Sbjct --------------------------x  475
DSSP  --------------------------l


No 7: Query=1a5kC Sbjct=2vunA Z-score=21.2

back to top
DSSP  leeehhhhhhhhlllllleeelllllleeelleellllllllllllllllllllllllll
Query snisrqayadmfgptvgdkvrladtelwieveddlttygeevkfgggkvirdgmgqgqml   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhhllLEEEEEE-EEEEL----LEEEEEEEEEELLEEEEEELEElllllllllEELL-LL
Query aadcvDLVLTNA-LIVDH----WGIVKADIGVKDGRIFAIGKAGnpdiqpnvtIPIG-AA  114
ident           |   ||             | | || | |||                   
Sbjct ----sKTIIKNIgKIVSGdiksPVLQADTIVVEDGLIAAIGGEE---------LMKDaGD   47
DSSP  ----lEEEEELLlEEELLllllLEELLLEEEEELLEEEEEELHH---------HHLLlLL


DSSP  LEEEELLLLEEEELEEEEEEELLLLL---------HHHHHHHHLEEEEEE-ELLLLLHHh
Query TEVIAAEGKIVTAGGIDTHIHWICPQ---------QAEEALVSGVTTMVG-GGTGPAAGt  164
ident    | | |  || |  ||| |                  ||  |||||   |        
Sbjct ATIIDAAGSTVTPGLLDTHVHVSGGDyaprqktmdFISSALHGGVTTMISaGSPHFPGR-  106
DSSP  LEEEELLLLEEEELEEEEEELLLLLLeehhhleelHHHHHHLLLEEEEEElLLLLLLLL-


DSSP  hhllllLHHHHHHHHHHHHLLL--LLEEE-EEEELLL-LLHHHHHHHHHHLLLEEE-EEH
Query hattctPGPWYISRMLQAADSL--PVNIG-LLGKGNV-SQPDALREQVAAGVIGLE-IHE  219
ident            |             |                   |    ||        
Sbjct pkdaagTKALAITLSKSYYNARpaGVKVHgGAVILEKgLTEEDFIEMKKEGVWIVGeVGL  166
DSSP  lllhhhHHHHHHHHHHHHHHLLhhHLEEElLEELLLLlLLHHHHHHHHHLLLLEEEeELL


DSSP  HHLLLHHHHHHHHHHHHHHLLEEEEEL-lLLLL-LLLHH-HHHHHHllLLEEELLLLLLL
Query DWGATPAAIDCALTVADEMDIQVALHS-dTLNE-SGFVE-DTLAAIggRTIHTFHTEGAG  276
ident      |         |      |  |   |    |  |  |             |  |  
Sbjct GTIKNPEDAAPMVEWAHKHGFKVQMHTggTSIPgSSTVTaDDVIKT--KPDVVSHINGGP  224
DSSP  LLLLLHHHHHHHHHHHHHLLLEEEEELllLLLLlLLLLLhHHHHHH--LLLEEELLLLLL


DSSP  LLLLLLHHH-HHHLLLEEEEEEHHHllllllhhhhhhhhhhhhhllllllhhhhhlllll
Query GGHAPDIIT-ACAHPNILPSSTNPTlpytlntidehldmlmvchhldpdiaedvafaesr  335
ident                                                             
Sbjct TAISVQEVDrIMDETDFAMEIVQCG-----------------------------------  249
DSSP  LLLLHHHHHhHHHHLLLEEEEELLL-----------------------------------


DSSP  llhhHHHHHHHHHHLLL------LLEEELLLLL--LLLLLLHHHHHHHHHHHHHhhhlll
Query irreTIAAEDVLHDLGA------FSLTSSDSQA--MGRVGEVILRTWQVAHRMKvqrgal  387
ident          |      |            |                 | |          
Sbjct ----NPKIADYVARRAAekgqlgRVIFGNDAPSgtGLIPLGILRNMCQIASMSD------  299
DSSP  ----LHHHHHHHHHHHHhhllhhHEEEELLLLLllLLLLLHHHHHHHHHHHHLL------


DSSP  llllllllhhHHHHHHHLLLHHHHHHLLLllLLLLLLLLLLLLEEEELHH----------
Query aeetgdndnfRVKRYIAKYTINPALTHGIahEVGSIEVGKLADLVVWSPA----------  437
ident                    | |     |     | |  || |||                
Sbjct ---------iDPEVAVCMATGNSTAVYGL--NTGVIAPGKEADLIIMDTPlgsvaedamg  348
DSSP  ---------lLHHHHHHHHLHHHHHHHLL--LLLLLLLLLLLLEEEEELLlllllllhhh


DSSP  ----hlLLLLLEEEELLEEEEEEellllllllllllleeeelhhhlhhhhhhhleeeelh
Query ----ffGVKPATVIKGGMIAIAPmgdinasiptpqpvhyrpmfgalgsarhhcrltflsq  493
ident             |   |                                           
Sbjct aiaagdIPGISVVLIDGEAVVTK-------------------------------------  371
DSSP  hhhhllLLEEEEEEELLEEEELL-------------------------------------


DSSP  hhhhhlhhhhllllleeeellllllllhhhllllllllleeelllllleeelleelllll
Query aaaangvaerlnlrsaiavvkgcrtvqkadmvhnslqpnitvdaqtyevrvdgelitsep  553
ident                                                             
Sbjct -----------------------------------------------------------s  372
DSSP  -----------------------------------------------------------l


DSSP  lllllllllllll
Query advlpmaqryflf  566
ident              
Sbjct rntppakraakil  385
DSSP  lllllllllleel


No 8: Query=1a5kC Sbjct=3nqbA Z-score=21.2

back to top
DSSP  leeehhhhhhhhlllllleeelllllleeelleellllllllllllllllllllllllll
Query snisrqayadmfgptvgdkvrladtelwieveddlttygeevkfgggkvirdgmgqgqml   60
ident                                                             
Sbjct -----------------------------------------epadlnddtlraravaaar   19
DSSP  -----------------------------------------llhhhllhhhhhhhhhhhh


DSSP  HHHLLLEEEEEEEEEELL--EEEEEEEEEELLEEEEEELEEllllllllLEELlllLEEE
Query AADCVDLVLTNALIVDHW--GIVKADIGVKDGRIFAIGKAGnpdiqpnvTIPIgaaTEVI  118
ident      |   |    ||        ||||     |                        ||
Sbjct GDQRFDVLITGGTLVDVVtgELRPADIGIVGALIASVHEPA--------SRRD--aAQVI   69
DSSP  LLLLEEEEEELLEEELLLllLEEELEEEEELLEEEEEELLL--------LLLL--eEEEE


DSSP  ELLLLEEEELEEEEEEELL-----LLLHHHHHHHHLEEEEEEELLLllhhhhhlllllHH
Query AAEGKIVTAGGIDTHIHWI-----CPQQAEEALVSGVTTMVGGGTGpaagthattctpGP  173
ident  | |  |  | |||| |           |      |||| |                 | 
Sbjct DAGGAYVSPGLIDTHXHIEssxitPAAYAAAVVARGVTTIVWDPHE-------fgnvhGV  122
DSSP  ELLLLEEEELEEEEEELHHhhlllHHHHHHHHHLLLEEEEEELLHH-------hhhhhLH


DSSP  HHHHHHHHHHLLLLLEEEEEEELL------------llLHHHHHHHHHH-LLLE-EEEEh
Query WYISRMLQAADSLPVNIGLLGKGN------------vsQPDALREQVAA-GVIG-LEIHe  219
ident         |   ||    ||                      |          |  ||  
Sbjct DGVRWAAKAIENLPLRAILLAPSCvpsapglerggadfDAAILADLLSWpEIGGiAEIX-  181
DSSP  HHHHHHHHHHLLLLLEEEEEELLLllllllllllllllLHHHHHHHHLLlLEEEeEEEL-


DSSP  hhLLLHH-----hHHHHHHHHHHHLLEEEEELLLllllllHHHHHHHHLL-LLEEELlLL
Query dwGATPA-----aIDCALTVADEMDIQVALHSDTlnesgfVEDTLAAIGG-RTIHTFhTE  273
ident                            |  |             | |             
Sbjct --NXRGVierdprXSGIVQAGLAAEKLVCGHARG-----lKNADLNAFXAaGVSSDH-EL  233
DSSP  --LHHHHhlllhhHHHHHHHHHHHLLEEEELLLL-----lLHHHHHHHHHlLLLEEL-LL


DSSP  LLlllllLLHH-HHHHLLlEEEEEEHHHLLLlllhhhhhhhhhhhhhllllllhhhhhll
Query GAggghaPDII-TACAHPnILPSSTNPTLPYtlntidehldmlmvchhldpdiaedvafa  332
ident                                                             
Sbjct VS-----GEDLxAKLRAG-LTIELRGSHDHL-----------------------------  258
DSSP  LL-----HHHHhHHHHLL-LEEEEELLLHHH-----------------------------


DSSP  lllllhhhHHHHHHHH---HLLL-LLEEELLLLL---llllLLHHHHHHHHHHHHhhhhl
Query esrirretIAAEDVLH---DLGA-FSLTSSDSQA---mgrvGEVILRTWQVAHRMkvqrg  385
ident                               |          |                  
Sbjct --------LPEFVAALntlGHLPqTVTLCTDDVFpddllqgGGLDDVVRRLVRYG-----  305
DSSP  --------HHHHHHHHhhhLLLLlLEEEELLLLLhhhhhhlLLHHHHHHHHHHLL-----


DSSP  llllllllllhhHHHHHHHLLLHHHHHHLLLlLLLLLLLLLLLLLEEEELHHHLLlLLLE
Query alaeetgdndnfRVKRYIAKYTINPALTHGIaHEVGSIEVGKLADLVVWSPAFFGvKPAT  445
ident                      | | |   |     | |  |  || ||            
Sbjct -----------lKPEWALRAATLNAAQRLGR-SDLGLIAAGRRADIVVFEDLNGF-SARH  352
DSSP  -----------lLHHHHHHHHLHHHHHHHLL-LLLLLLLLLLLLLEEEELLLLLL-LEEE


DSSP  EEELLEEEEEEellllllllllllleEEELhhHLHH------------------------
Query VIKGGMIAIAPmgdinasiptpqpvhYRPMfgALGS------------------------  481
ident |   |                      |                                
Sbjct VLASGRAVAEG---------------GRXL--VDIPtcdttvlkgsxklplrxandflvk  395
DSSP  EEELLEEEEEL---------------LEEL--LLLLllllhhhllllllllllhhhhlll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  481
ident                                                             
Sbjct sqgakvrlatidrprftqwgeteadvkdgfvvppegatxisvthrhgxaepttktgfltg  455
DSSP  lllleeeeeeeellllleeeeeeeeeelleellllleeeeeeellllllllleeeeeeel


DSSP  -----------------------------------------------hhhhhleeeelhh
Query -----------------------------------------------arhhcrltflsqa  494
ident                                                             
Sbjct wgrwngafattvshdshnltvfggnagdxalaanavigtgggxavasegkvtailplpls  515
DSSP  lllllleeeelllllllleeeeellhhhhhhhhhhhhhllleeeeeelleeeeeeellll


DSSP  hhhhlhhhhllllleeeellllllllhhhllllllllleeelllllleeelleellllll
Query aaangvaerlnlrsaiavvkgcrtvqkadmvhnslqpnitvdaqtyevrvdgelitsepa  554
ident                                                             
Sbjct glvsdapleevarafedlreavgkvvewqppylvfkacfgatlacnigphqtdxgiadvl  575
DSSP  lllllllhhhhhhhhhhhhhhhhhhlllllllllhhhhhlllllllllleelllleeell


DSSP  llllllllllll
Query dvlpmaqryflf  566
ident             
Sbjct tgkvxespviev  587
DSSP  lleeellleeel


No 9: Query=1a5kC Sbjct=1onxA Z-score=21.1

back to top
DSSP  leeehhhhhhhhlllllleeelllllleeelleelllllllllllllllllllllllLLL
Query snisrqayadmfgptvgdkvrladtelwieveddlttygeevkfgggkvirdgmgqgQML   60
ident                                                             
Sbjct --------------------------------------------------------mIDY    4
DSSP  --------------------------------------------------------lLLL


DSSP  HHhllLEEEEEEEEEELLEEEEEEEEEELLEEEEE-ELEEllllllllleELLLLLEEEE
Query AAdcvDLVLTNALIVDHWGIVKADIGVKDGRIFAI-GKAGnpdiqpnvtiPIGAATEVIA  119
ident  |      |  |           |  |  | | |                 |     |  
Sbjct TA-agFTLLQGAHLYAPEDRGICDVLVANGKIIAVaSNIP---------sDIVPNCTVVD   54
DSSP  HH-hlLEEEEEEEEELLLEEEEEEEEEELLEEEEEeLLLL---------lLLLLLLEEEE


DSSP  LLLLEEEELEEEEEEELLL------------LLHHHHHHHHLEEEEEEELllllHHHHhl
Query AEGKIVTAGGIDTHIHWIC------------PQQAEEALVSGVTTMVGGGtgpaAGTHat  167
ident   | |   | || | | |                       |||  ||            
Sbjct LSGQILCPGFIDQHVHLIGgggeagpttrtpEVALSRLTEAGVTSVVGLL---gTDSI--  109
DSSP  LLLLEEEELEEEEEELLLLllllllhhhlllLLLHHHHHHLLEEEEEELL---lLLLL--


DSSP  llllhhhHHHHHHHHHLLL---LLEEEEEEE--lLLLL--hHHHHHHHHHL--LLEEEEE
Query tctpgpwYISRMLQAADSL---PVNIGLLGK--gNVSQ--pDALREQVAAG--VIGLEIH  218
ident             |     |         |       |          ||    |||    
Sbjct -----srHPESLLAKTRALneeGISAWMLTGayhVPSRtitGSVEKDVAIIdrVIGVXCA  164
DSSP  -----llLHHHHHHHHHHHhhhLLEEEEEEElllLLLLlllLLHHHHHHHLllEEEEEEE


DSSP  H----HHLLLHHHHHHHHHHHHHHL------LEEEEELLLLLllLLHHHHHHHH----LL
Query E----DWGATPAAIDCALTVADEMD------IQVALHSDTLNesGFVEDTLAAI----GG  264
ident                                     |                       
Sbjct IsdhrSAAPDVYHLANMAAESRVGGllggkpGVTVFHMGDSK--KALQPIYDLLencdVP  222
DSSP  EllllLLLLLHHHHHHHHHHHHHHHhhhlllLEEEEEELLLL--LLLHHHHHHHhlllLL


DSSP  LL-EEELLLLLLlllllLLHH-HHHHL--LLEEEEEEHHHLlllllhhhhhhhhhhhhhl
Query RT-IHTFHTEGAggghaPDII-TACAH--PNILPSSTNPTLpytlntidehldmlmvchh  320
ident        |               |            |                       
Sbjct ISkLLPTHVNRN-----VPLFeQALEFarKGGTIDITSSID-------------------  258
DSSP  HHhEEEELHHHL-----HHHHhHHHHHhhLLLLEEEELLLL-------------------


DSSP  lllllhhhhhlllllllhhhHHHH-HHHHHLLL-------lLEEELLLLLL---------
Query ldpdiaedvafaesrirretIAAE-DVLHDLGA-------fSLTSSDSQAM---------  363
ident                                             |||             
Sbjct --------------------EPVApAEGIARAVqagiplarVTLSSDGNGSqpffddegn  298
DSSP  --------------------LLLLhHHHHHHHHhllllhhhEEEELLLLLEeeeelllll


DSSP  ------LLLLLHHHHHHHHHHHHHhhhlllllllllllhHHHHHHHHLLLHHHHHHLLLl
Query ------GRVGEVILRTWQVAHRMKvqrgalaeetgdndnFRVKRYIAKYTINPALTHGIa  417
ident                                        |         |   |      
Sbjct lthigvAGFETLLETVQVLVKDYD---------------FSISDALRPLTSSVAGFLNL-  342
DSSP  eeeeeeLLLHHHHHHHHHHHHHHL---------------LLHHHHHHHHLHHHHHHLLL-


DSSP  LLLLLLLLLLLLLEEEELHHHLlllLLEEEELLEEEEEEellllllllllllleEEELhh
Query HEVGSIEVGKLADLVVWSPAFFgvkPATVIKGGMIAIAPmgdinasiptpqpvhYRPMfg  477
ident    | |  |  ||| |  |         |   |                           
Sbjct TGKGEILPGNDADLLVMTPELR---IEQVYARGKLMVKD--------------gKACV--  383
DSSP  LLLLLLLLLLLLLEEEELLLLL---EEEEEELLEEEEEL--------------lEELL--


DSSP  HLHHhhhhhleeeelhhhhhhlhhhhllllleeeellllllllhhhllllllllleeell
Query ALGSarhhcrltflsqaaaangvaerlnlrsaiavvkgcrtvqkadmvhnslqpnitvda  537
ident                                                             
Sbjct KGTF--------------------------------------------------------  387
DSSP  LLLL--------------------------------------------------------


DSSP  lllleeelleellllllllllllllllll
Query qtyevrvdgelitsepadvlpmaqryflf  566
ident                              
Sbjct --------------------------etd  390
DSSP  --------------------------lll


No 10: Query=1a5kC Sbjct=3griA Z-score=21.1

back to top
DSSP  leeehhhhhhhhlllllleeelllllleeelleellllllllllllllllllllllllll
Query snisrqayadmfgptvgdkvrladtelwieveddlttygeevkfgggkvirdgmgqgqml   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhhllLEEEEEEEEEelLEEEEEEEEEELLEEEEEELEelllllllllEELLLLLEEEEL
Query aadcvDLVLTNALIVdhWGIVKADIGVKDGRIFAIGKAgnpdiqpnvtIPIGAATEVIAA  120
ident           |           |||      |  |  |          |        | |
Sbjct -----XKLIKNGKVLqnGELQQADILIDGKVIKQIAPA----------IEPSNGVDIIDA   45
DSSP  -----LEEEELLEEEelLEEEELEEEEELLEEEEEELL----------LLLLLLLEEEEL


DSSP  LLLEEEELEEEEEEELLL---------LLHHHHHHHHLEEEEEEELLLLLhhhhhlllLL
Query EGKIVTAGGIDTHIHWIC---------PQQAEEALVSGVTTMVGGGTGPAagthattcTP  171
ident  |  |  |  | | |                  |   | ||                   
Sbjct KGHFVSPGFVDVHVHLREpggeyketiETGTKAAARGGFTTVCPXPNTRP-------vPD   98
DSSP  LLLEEEELEEEEEELLLLllllllllhHHHHHHHHHLLEEEEEELLLLLL-------lLL


DSSP  HHHHHHHHHHHHL-LLLLEEEEEEELL----LLLHHHHHHHHHHLLLEEEEEHHHLLLHH
Query GPWYISRMLQAAD-SLPVNIGLLGKGN----VSQPDALREQVAAGVIGLEIHEDWGATPA  226
ident             |    |                       |  |            |  
Sbjct SVEHFEALQKLIDdNAQVRVLPYASITtrqlGKELVDFPALVKEGAFAFTDDGVGVQTAS  158
DSSP  LHHHHHHHHHHHHhHLLLEELLLEELLhhhlLLLLLLHHHHHLLLLLLEEELLLLLLLHH


DSSP  HHHHHHHHHHHHLLEEEEELLLLLL-------------------------lLLHHHHHHH
Query AIDCALTVADEMDIQVALHSDTLNE-------------------------sGFVEDTLAA  261
ident         |         |                                         
Sbjct XXYEGXIEAAKVNKAIVAHCEDNSLiyggaxhegkrskelgipgipnicesVQIARDVLL  218
DSSP  HHHHHHHHHHHHLLLEEELLLLHHHllllleellhhhhhhllleellhhhhHHHHHHHHH


DSSP  HL--LLLEEELLLLLlllllllLHHH-HHHLL----LEEEEEEHHHLLLlllHHHHH---
Query IG--GRTIHTFHTEGaggghapDIIT-ACAHP----NILPSSTNPTLPYtlnTIDEH---  311
ident     |   |  |                              |   |     | |     
Sbjct AEaaGCHYHVCHVST------kESVRvIRDAKragiHVTAEVTPHHLLL---TEDDIpgn  269
DSSP  HHhhLLLEEELLLLL------hHHHHhHHHHHhlllLEEEEELHHHHHL---LHHHLlll


DSSP  -HHHHhhhhllllllhhhhhlllllLLHHHHHHHHHHHHLLLLLEEELLLL---------
Query -LDMLmvchhldpdiaedvafaesrIRRETIAAEDVLHDLGAFSLTSSDSQ---------  361
ident                             |   |       |       |           
Sbjct nAIYK---------------xnpplRSTEDREALLEGLLDGTIDCIATDHAphardekaq  314
DSSP  lHHHL---------------lllllLLHHHHHHHHHHHHLLLLLEELLLLLlllhhhhll


DSSP  -------LLLLLLLHHHHHHHHH-HHHHhhhlllllllllllhHHHHHHHHLLLHHHHHH
Query -------AMGRVGEVILRTWQVA-HRMKvqrgalaeetgdndnFRVKRYIAKYTINPALT  413
ident                                                      || |  |
Sbjct pxekapfGIVGSETAFPLLYTHFvKNGD---------------WTLQQLVDYLTIKPCET  359
DSSP  lllllllLLLLLLLHHHHHHHHHlLLLL---------------LLHHHHHHHHLHHHHHH


DSSP  LLLLllLLLLLLLLLLLEEEELHHH----------------------lLLLLLEEEELLE
Query HGIAheVGSIEVGKLADLVVWSPAF----------------------fGVKPATVIKGGM  451
ident        |       |||                                 |      | 
Sbjct FNLE--YGTLKENGYADLTIIDLDSeqeikgedflskadntpfigykvYGNPILTXVEGE  417
DSSP  LLLL--LLLLLLLLLLLEEEEELLLleellhhhllllllllllllleeLLEEEEEEELLE


DSSP  EEEEEellllllllllllleeeelhhhlhhhhhhhleeeelhhhhhhlhhhhllllleee
Query IAIAPmgdinasiptpqpvhyrpmfgalgsarhhcrltflsqaaaangvaerlnlrsaia  511
ident                                                             
Sbjct VKFEG-------------------------------------------------------  422
DSSP  EEEEL-------------------------------------------------------


DSSP  ellllllllhhhllllllllleeelllllleeelleellllllllllllllllll
Query vvkgcrtvqkadmvhnslqpnitvdaqtyevrvdgelitsepadvlpmaqryflf  566
ident                                                        
Sbjct -------------------------------------------------------  422
DSSP  -------------------------------------------------------


No 11: Query=1a5kC Sbjct=3mtwA Z-score=19.5

back to top
DSSP  leeehhhhhhhhlllllleeelllllleeelleellllllllllllllllllllllllll
Query snisrqayadmfgptvgdkvrladtelwieveddlttygeevkfgggkvirdgmgqgqml   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhhllLEEEEEEEEE-ELLE-EEEE-EEEEELLEEEEEELEElllllllllEELLLLLEE
Query aadcvDLVLTNALIV-DHWG-IVKA-DIGVKDGRIFAIGKAGnpdiqpnvtIPIGAATEV  117
ident            |       |  |      | ||||  ||| |             |    
Sbjct ---aeIKAVSAARLLdVASGkYVDNpLVIVTDGRITSIGKKG---------DAVPAGATA   48
DSSP  ---llEEEEEEEEEEeLLLLeEEELeEEEEELLEEEEEEELL---------LLLLLLLEE


DSSP  EELLLLEEEELEEEEEEELL---------------------LLLHHHHHHHHLEEEEEE-
Query IAAEGKIVTAGGIDTHIHWI---------------------CPQQAEEALVSGVTTMVG-  155
ident     |     | || | |                           |   |  | ||    
Sbjct VDLPGVTLLPGLIDMHVHLDslaevggynsleysdrfwsvvQTANAKKTLEAGFTTVRNv  108
DSSP  EEEEEEEEEELEEEEEELLLllllllhhhhhhllhhhhhhhHHHHHHHHHHLLEEEEEEl


DSSP  ELLLllhhhhhlllllhhhhhHHHHHHHLLL------LLEEEEE-EELL-----------
Query GGTGpaagthattctpgpwyiSRMLQAADSL------PVNIGLL-GKGN-----------  197
ident |                                       |                   
Sbjct GAAD-----------------YDDVGLREAIdagyvpGPRIVTAaISFGatgghcdstff  151
DSSP  LLLL-----------------LHHHHHHHHHhlllllLLEEEELlLLEElllllllllll


DSSP  -------------LLLH--HHHHHHHHHLLLEEEEEH------------hhLLLHHHHHH
Query -------------VSQP--DALREQVAAGVIGLEIHE------------dwGATPAAIDC  230
ident                     | |     |     |                  |      
Sbjct ppsmdqknpfnsdSPDEarKAVRTLKKYGAQVIXICAtggvfsrgnepgqqQLTYEEMKA  211
DSSP  lhhhlllllllllLHHHhhHHHHHHHHLLLLEEEEELllllllllllllllLLLHHHHHH


DSSP  HHHHHHHHLLEEEEELllllllllHHHHHHHH-LLLLEEELLLLllllllllLHHH-HHH
Query ALTVADEMDIQVALHSdtlnesgfVEDTLAAI-GGRTIHTFHTEgaggghapDIIT-ACA  288
ident     |    | || |                          |                  
Sbjct VVDEAHMAGIKVAAHA-------hGASGIREAvRAGVDTIEHAS--------LVDDeGIK  256
DSSP  HHHHHHHLLLEEEEEE-------lLHHHHHHHhHLLLLEEEELL--------LLLHhHHH


DSSP  L---LLEEEEEEHHHllllllhhhHHHHHHHHhHLLLlllhhhHHLLLLLLLH-HHHHH-
Query H---PNILPSSTNPTlpytlntidEHLDMLMVcHHLDpdiaedVAFAESRIRR-ETIAA-  343
ident          |                                            |     
Sbjct LavqKGAYFSMDIYN-------tdYTQAEGKK-NGVL------EDNLRKDRDIgELQREn  302
DSSP  HhhhHLLEEELLLLL-------hhHHHHHHHH-HLLL------HHHHHHHHHHhHHHHHh


DSSP  HHHHHHLLLLLEEELLLLLlLLLLLHHHHHHHHHHHHhhhhlllllllllllhhHHHHHH
Query EDVLHDLGAFSLTSSDSQAmGRVGEVILRTWQVAHRMkvqrgalaeetgdndnfRVKRYI  403
ident        |       |       |                                   |
Sbjct FRKALKAGVKMVYGTDAGI-YPHGDNAKQFAVMVRYG----------------aTPLQAI  345
DSSP  HHHHHHHLLEEELLLLLLL-LLLLLHHHHHHHHHHLL----------------lLHHHHH


DSSP  HLLLHHHHHHLLLLLLLLLLLLLLLLLEEEELHH-----hLLLLLLEEEELLEEEEEEel
Query AKYTINPALTHGIAHEVGSIEVGKLADLVVWSPA-----fFGVKPATVIKGGMIAIAPmg  458
ident    |   |   |    ||   ||   |                ||  | |||    ||  
Sbjct QSATLTAAEALGRSKDVGQVAVGRYGDMIAVAGDpladvtTLEKPVFVMKGGAVVKAP--  403
DSSP  HHLLHHHHHHHLLLLLLLLLLLLLLLLEEEELLLllllhhHHHLLLEEEELLEEEELL--


DSSP  lllllllllllleeeelhhhlhhhhhhhleeeelhhhhhhlhhhhllllleeeellllll
Query dinasiptpqpvhyrpmfgalgsarhhcrltflsqaaaangvaerlnlrsaiavvkgcrt  518
ident                                                             
Sbjct ------------------------------------------------------------  403
DSSP  ------------------------------------------------------------


DSSP  llhhhllllllllleeelllllleeelleellllllllllllllllll
Query vqkadmvhnslqpnitvdaqtyevrvdgelitsepadvlpmaqryflf  566
ident                                                 
Sbjct -----------------------------------------------x  404
DSSP  -----------------------------------------------l


No 12: Query=1a5kC Sbjct=4cqbA Z-score=19.3

back to top
DSSP  leeehhhhhhhhlllllleeelllllleeelleellllllllllllllllllllllllll
Query snisrqayadmfgptvgdkvrladtelwieveddlttygeevkfgggkvirdgmgqgqml   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hHHLLLEEEEEEEEEelLEEEEEEEEEELLEEEEE-ELEEllllllllleelLLLLEEEE
Query aADCVDLVLTNALIVdhWGIVKADIGVKDGRIFAI-GKAGnpdiqpnvtipiGAATEVIA  119
ident      ||   ||           |||    ||  |  |              |     | 
Sbjct -SKDFDLIIRNAYLS--EKDSVYDIGIVGDRIIKIeAKIE------------GTVKDEID   45
DSSP  -LLLEEEEEEEEEEL--LLLEEEEEEEELLEEEEEeLLLL------------LLEEEEEE


DSSP  LLLLEEEELEEEEEEELL------------------------------------------
Query AEGKIVTAGGIDTHIHWI------------------------------------------  137
ident | |  |  |  | | |                                            
Sbjct AKGNLVSPGFVDAHTHMDksftstgerlpkfwsrpytrdaaiedglkyyknatheeikrh  105
DSSP  LLLLLEEELEEEEEELHHhllllllllllllllllllhhhhhhhhhhhhhhllhhhhhhh


DSSP  LLLHHHHHHHHLEEEEEEelllllhhhhhlLLLL----HHHHHHHHHHHHLLL--LLEEE
Query CPQQAEEALVSGVTTMVGggtgpaagthatTCTP----GPWYISRMLQAADSL--PVNIG  191
ident     |      |                                  | |   |     | 
Sbjct VIEHAHMQVLHGTLYTRT------------HVDVdsvaKTKAVEAVLEAKEELkdLIDIQ  153
DSSP  HHHHHHHHHHLLEEEEEE------------EEELllllLLHHHHHHHHHHHHLllLLEEE


DSSP  EEEEL--LLLL----HHHHHHHHHHLLLEEEEEH--HHLL-LHHHHHHHHHHHHHHLLEE
Query LLGKG--NVSQ----PDALREQVAAGVIGLEIHE--DWGA-TPAAIDCALTVADEMDIQV  242
ident                    |     |                    |     | | |   
Sbjct VVAFAqsGFFVdlesESLIRKSLDMGCDLVGGVDpaTRENnVEGSLDLCFKLAKEYDVDI  213
DSSP  EEEELllLLLLlllhHHHHHHHHHHLLLEEELLLllLLLLlHHHHHHHHHHHHHHLLLEE


DSSP  EEELLLlllllLHHHH-HHHHLLL-------LEEELLLLL---llllllllhhhhHHLLL
Query ALHSDTlnesgFVEDT-LAAIGGR-------TIHTFHTEG---aggghapdiitaCAHPN  291
ident   |                               | |                       
Sbjct DYHIHD--igtVGVYSiNRLAQKTiengykgRVTTSHAWCfadapsewldeaiplYKDSG  271
DSSP  EEEELL--lhhHHHHHhHHHHHHHhhlllllLEEEEELLHhhhllhhhhhhhhhhHHHHL


DSSP  EEEEEEHHHLlllllhhhhhhhhhhhhhllllllhhhhhlllllllhhhHHHHhhHHHLL
Query ILPSSTNPTLpytlntidehldmlmvchhldpdiaedvafaesrirretIAAEdvLHDLG  351
ident                                                             
Sbjct MKFVTCFSST---------------------------------------PPTM--PVIKL  290
DSSP  LEEEEELLLL---------------------------------------LLLL--LHHHH


DSSP  L----LLEEELLLL----LLLLLLLHHHHHHHHHH-HHHHhhllllllllllLHHHHHHH
Query A----FSLTSSDSQ----AMGRVGEVILRTWQVAH-RMKVqrgalaeetgdnDNFRVKRY  402
ident           ||           |                             |      
Sbjct LeagiNLGCASDNIrdfwVPFGNGDMVQGALIETQrLELK------------TNRDLGLI  338
DSSP  HhlllEEEEELLLLllllLLLLLLLHHHHHHHHHHhHLLL------------LHHHHHHH


DSSP  HHLLLHHHHHHLLLLLLLlLLLLLLLLLEEEELH---HHLL---LLLLEEEELLEEEEEE
Query IAKYTINPALTHGIAHEVgSIEVGKLADLVVWSP---AFFG---VKPATVIKGGMIAIAP  456
ident     |   |   ||      ||||| |||||              |   ||| | |    
Sbjct WKMITSEGARVLGIEKNY-GIEVGKKADLVVLNSlspQWAIidqAKRLCVIKNGRIIVKD  397
DSSP  HHHHLHHHHHHHLLHHHL-LLLLLLLLLEEEELLllhHHHHhhlLLEEEEEELLEEEEEL


DSSP  ellllllllllllleEEELHhhlhhhhhhhleeeelhhhhhhlhhhhllllleeeellll
Query mgdinasiptpqpvhYRPMFgalgsarhhcrltflsqaaaangvaerlnlrsaiavvkgc  516
ident                                                             
Sbjct ---------------EVIVA----------------------------------------  402
DSSP  ---------------LEELL----------------------------------------


DSSP  llllhhhllllllllleeelllllleeelleellllllllllllllllll
Query rtvqkadmvhnslqpnitvdaqtyevrvdgelitsepadvlpmaqryflf  566
ident                                                   
Sbjct --------------------------------------------------  402
DSSP  --------------------------------------------------


No 13: Query=1a5kC Sbjct=2pajA Z-score=18.9

back to top
DSSP  leeehhhhhhhhlllllleeelllllleeelleellllllllllllllllllllllllll
Query snisrqayadmfgptvgdkvrladtelwieveddlttygeevkfgggkvirdgmgqgqml   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhhlLLEEEEEE-EEEEL--------LEEEEEEEEEELLEEEEEELEEllllllllleeL
Query aadcVDLVLTNA-LIVDH--------WGIVKADIGVKDGRIFAIGKAGnpdiqpnvtipI  111
ident           ||  |                 ||      | |||               
Sbjct ----PSTLIRNAaAIMTGgrgtaddpSRVPGPDIRIVGDTIDAIGALA-----------P   45
DSSP  ----LEEEEELLlEELLLllllllllLLLLLLLEEEELLEEEEELLLL-----------L


DSSP  LLLLEEEELLLLEEEELEEEEEEELL---------------------LLLHHHHHHHHLE
Query GAATEVIAAEGKIVTAGGIDTHIHWI---------------------CPQQAEEALVSGV  150
ident         |           || |                             |   || 
Sbjct RPGETIVDATDCVIYPAWVNTHHHLFqsllkgepfralfderrfrlaARIGLIELARSGC  105
DSSP  LLLLEEEELLLLEEEELEELLLLLHHhhhllllllhhhllhhhhhhhHHHHHHHHHLLLE


DSSP  EEEEEElllllhhhhhlLLLL----hhHHHHHHHHHHLLLLLEEEEEEELLL--------
Query TTMVGGgtgpaagthatTCTP----gpWYISRMLQAADSLPVNIGLLGKGNV--------  198
ident  |                                  |  |     ||  |          
Sbjct ATVADH-----------NYVYypgmpfDSSAILFEEAEKLGLRFVLLRGGATqtrqlead  154
DSSP  EEEEEL-----------LLLLllllllLHHHHHHHHHHHLLLEEEEEELLLLllllllll


DSSP  -------lLHHHHHHHHHHL-------------lLEEEEE--HHHLlLHHHHHHHHHHHH
Query -------sQPDALREQVAAG-------------vIGLEIH--EDWGaTPAAIDCALTVAD  236
ident           ||                                    |        || 
Sbjct lptalrpeTLDAYVADIERLaaryhdaspramrrVVMAPTtvLYSI-SPREMRETAAVAR  213
DSSP  llhhhlllLHHHHHHHHHHHhhhllllllllleeEEELLLllLLLL-LHHHHHHHHHHHH


DSSP  HHLLEEEEELLllllLLLH-HHHHHHHLLL-LEEELLLLLlllllLLLHHHHHHLLLEEE
Query EMDIQVALHSDtlneSGFV-EDTLAAIGGR-TIHTFHTEGaggghAPDIITACAHPNILP  294
ident         |                           |          | |   |      
Sbjct RLGLRMHSHLS----GKSPvAFCGEHDWLGsDVWYAHLVK----vDADEIALLAQTGTGV  265
DSSP  HLLLEEEEELL----LLLHhHHHHHLLLLLlLEEEELLLL----lLHHHHHHHHHHLLEE


DSSP  EEEHHHllllllhhhhhhhhhhhhhllllllhhhhhlllllllhhhhhhHHHHHHL-LLL
Query SSTNPTlpytlntidehldmlmvchhldpdiaedvafaesrirretiaaEDVLHDL-GAF  353
ident                                                          |  
Sbjct AHCPQS---------------------------------------ngrlPVREMADaGVP  286
DSSP  EELHHH---------------------------------------hhllLLLLHHHhLLL


DSSP  LEEELLLLLL-LLLL--LHHHHHHHHHHHHHhhhlllllllllllhhHHHHHHHLLLHHH
Query SLTSSDSQAM-GRVG--EVILRTWQVAHRMKvqrgalaeetgdndnfRVKRYIAKYTINP  410
ident      |  |             ||                            |   |   
Sbjct VSIGVDGAASnEAADmiSEVHMTWLAQRARL---------------aSIAEVIHWGTAGG  331
DSSP  EEELLLHHHHlLLLLhhHHHHHHHHHHHHLL---------------lLHHHHHHHHLHHH


DSSP  HHHLLLLlLLLLLLLLLLLLEEEELH------------HHLL----LLLL-EEEELLEEE
Query ALTHGIAhEVGSIEVGKLADLVVWSP------------AFFG----VKPA-TVIKGGMIA  453
ident |   |   |||   ||  ||  |                                 |   
Sbjct ARVMGLD-EVGKVAVGYAADIAVYRLddpryfglhdpaIGPVasggRPSVmALFSAGKRV  390
DSSP  HHHHLLL-LLLLLLLLLLLLEEEEELllhhhlllllhhHHHHhlllLLEEeEEEELLEEE


DSSP  EEEellllllllllllleEEELhhhlhhhhhhhleeeelhhhhhhlhhhhllllleeeel
Query IAPmgdinasiptpqpvhYRPMfgalgsarhhcrltflsqaaaangvaerlnlrsaiavv  513
ident                                                             
Sbjct VVD---------------DLIE--------------------------------------  397
DSSP  EEL---------------LLLL--------------------------------------


DSSP  lllllllhhhllllllllleeelllllleeelleellllllllllllllllll
Query kgcrtvqkadmvhnslqpnitvdaqtyevrvdgelitsepadvlpmaqryflf  566
ident                                                      
Sbjct -----------------------------gvdikelggearrvvrellrevvv  421
DSSP  -----------------------------lllhhhhhhhhhhhhhhhhhhhhl


No 14: Query=1a5kC Sbjct=2oofA Z-score=18.6

back to top
DSSP  leeehhhhhhhhlllllleeelllllleeelleellllllllllllllllllllllllll
Query snisrqayadmfgptvgdkvrladtelwieveddlttygeevkfgggkvirdgmgqgqml   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhhLLLEEEEEEEEEEL------LEEE-EEEEEEELLEEEEEELEelllllLLLLeelll
Query aadCVDLVLTNALIVDH------WGIV-KADIGVKDGRIFAIGKAgnpdiqPNVTipiga  113
ident        |  |             |       ||  ||| |                   
Sbjct --lNCERVWLNVTPATLrsdladYGLLePHALGVHEGRIHALVPX------QDLK----y   48
DSSP  --lLLLEEEEEEEELLLllllllLLLLlLEEEEEELLEEEEEEEH------HHLL----l


DSSP  llEEEELLLLEEEELEEEEEEELL------------------------------------
Query atEVIAAEGKIVTAGGIDTHIHWI------------------------------------  137
ident         || || | || | | |                                    
Sbjct paHWQDXKGKLVTPGLIDCHTHLIfagsraeefelrqkgvpyaeiarkgggiistvratr  108
DSSP  llLLEELLLLEEEELEEEEEELLLlllllhhhhhhhhhlllhhhhhhllllhhhhhhhhh


DSSP  ----------LLLHHHHHHHHLEEEEEEelllllhhhhhlLLLL------HHHHHHHHHH
Query ----------CPQQAEEALVSGVTTMVGggtgpaagthatTCTP------GPWYISRMLQ  181
ident                      ||||                                   
Sbjct aasedqlfelALPRVKSLIREGVTTVEI------------KSGYgltledELKXLRVARR  156
DSSP  hllhhhhhhhHHHHHHHHHHHLEEEEEE------------ELLLlllhhhHHHHHHHHHH


DSSP  HHLLLLLEEEEEEELL--------------LLLH--HHHHHHH-HHLLLEEEEEH-hhLL
Query AADSLPVNIGLLGKGN--------------VSQP--DALREQV-AAGVIGLEIHE-dwGA  223
ident     ||                        |             |             | 
Sbjct LGEALPIRVKTTLLAAhavppeyrddpdswVETIcqEIIPAAAeAGLADAVDVFCehiGF  216
DSSP  HHHHLLLEEEEEEEEEllllhhhlllhhhhHHHHhhLHHHHHHhLLLLLEEEEEElllLL


DSSP  LHHHHHHHHHHHHHHLLEEEEELlllllllLHHHHHHHHLLLLE-EELLLLllllllllL
Query TPAAIDCALTVADEMDIQVALHSdtlnesgFVEDTLAAIGGRTI-HTFHTEgaggghapD  282
ident   |        ||     |  |                          | |         
Sbjct SLAQTEQVYLAADQYGLAVKGHX----dqlSNLGGSTLAANFGAlSVDHLE--------Y  264
DSSP  LHHHHHHHHHHHHHLLLEEEEEE----lllLLLLHHHHHHHLLLlEEEELL--------L


DSSP  HHH-HHHL---LLEEEEEEHHHllllllhhhhhhhhhhhhhllllllhhhhhllllLLLH
Query IIT-ACAH---PNILPSSTNPTlpytlntidehldmlmvchhldpdiaedvafaesRIRR  338
ident                                                             
Sbjct LDPeGIQAlahRGVVATLLPTA-------------------------------fyfLKET  293
DSSP  LLHhHHHHhhhHLLEEEELHHH-------------------------------hhhLLLL


DSSP  HHhhhHHHHHHL-LLLLEEELLLLL--LLLLlLHHHHHHHHHHHhhhhhlllllllllll
Query ETiaaEDVLHDL-GAFSLTSSDSQA--MGRVgEVILRTWQVAHRmkvqrgalaeetgdnd  395
ident        |     |     |||        |                             
Sbjct KL--pPVVALRKaGVPXAVSSDINPgtAPIV-SLRXAXNXACTL---------------f  335
DSSP  LL--lLHHHHHHlLLLEEELLLLLLllLLLL-LHHHHHHHHHHH---------------h


DSSP  hhHHHHHHHLLLHHHHHHLLLLLLLLLLLLLLLLLEEEELHHHL--------lLLLLEEE
Query nfRVKRYIAKYTINPALTHGIAHEVGSIEVGKLADLVVWSPAFF--------gVKPATVI  447
ident         |  |   |   |     |   || |||  ||                     
Sbjct glTPVEAXAGVTRHAARALGEQEQLGQLRVGXLADFLVWNCGHPaelsyligvDQLVSRV  395
DSSP  llLHHHHHHHLLHHHHHHLLLLLLLLLLLLLLLLLEEEELLLLLlhhhhllllLLEEEEE


DSSP  ELLEEEEEeellllllllllllleeeelhhhlhhhhhhhleeeelhhhhhhlhhhhllll
Query KGGMIAIApmgdinasiptpqpvhyrpmfgalgsarhhcrltflsqaaaangvaerlnlr  507
ident   |                                                         
Sbjct VNGEETLH----------------------------------------------------  403
DSSP  ELLEELLL----------------------------------------------------


DSSP  leeeellllllllhhhllllllllleeelllllleeelleellllllllllllllllll
Query saiavvkgcrtvqkadmvhnslqpnitvdaqtyevrvdgelitsepadvlpmaqryflf  566
ident                                                            
Sbjct -----------------------------------------------------------  403
DSSP  -----------------------------------------------------------


No 15: Query=1a5kC Sbjct=2ogjA Z-score=18.4

back to top
DSSP  leeehhhhhhhhlllllleeelllllleeelleellllllllllllllllllllllllll
Query snisrqayadmfgptvgdkvrladtelwieveddlttygeevkfgggkvirdgmgqgqml   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhhllLEEEEEEEEEELL---EEEEEEEEEE-LLEEEEEELEelllllllllEELLlLLE
Query aadcvDLVLTNALIVDHW---GIVKADIGVK-DGRIFAIGKAgnpdiqpnvtIPIGaATE  116
ident         |||   |           ||    || | | | |               |  
Sbjct ---qaPILLTNVKPVGFGkgaSQSSTDILIGgDGKIAAVGSA----------LQAP-ADT   46
DSSP  ---llLEEEEEEEELLLLlllLLLLEEEEELlLLLEEEEELL----------LLLL-LLE


DSSP  EEELlLLEEEELEEEEEEEL------LLLLhHHHH-HHHLEEEEEEElllllhhhhhlLL
Query VIAAeGKIVTAGGIDTHIHW------ICPQqAEEA-LVSGVTTMVGGgtgpaagthatTC  169
ident            |  | | |       |      |     |||| |               
Sbjct QRID-AAFISPGWVDLHVHIwhggtdISIR-PSECgAERGVTTLVDA-----------GS   93
DSSP  EELL-LLEEEELEEEEEELLllllllLLLL-HHHLlHHHLEEEEEEE-----------LL


DSSP  LLHHhHHHHHHHH-HLLLLLEEEEEEELL-----------------lLLHHHHHHHHHHL
Query TPGPwYISRMLQA-ADSLPVNIGLLGKGN-----------------vSQPDALREQVAAG  211
ident                      |                            |   |  |  
Sbjct AGEA-NFHGFREYiIEPSRERIKAFLNLGsiglvacnrvpelrdikdIDLDRILECYAEN  152
DSSP  LLLL-LHHHHHHHlLLLLLLEEEEEEELLlllllllllllllllhhhLLHHHHHHHHHLL


DSSP  ---LLEEEEE--HHHL--lLHHHHHHHHHHHHHHLLEEEEELLLLLlllLHHHHHHHHlL
Query ---VIGLEIH--EDWG--aTPAAIDCALTVADEMDIQVALHSDTLNesgFVEDTLAAIgG  264
ident      ||                       |         |             |    |
Sbjct sehIVGLXVRasHVITgswGVTPVKLGKKIAKILKVPXXVHVGEPP--aLYDEVLEIL-G  209
DSSP  lllEEEEEEEelHHHHlllLLHHHHHHHHHHHHHLLLEEEEELLLL--lLHHHHHHHL-L


DSSP  LLEEELLLLLLllllLLLHH--------HHHHLLLEEEEEEHHhllllllhhhhhhhhhh
Query RTIHTFHTEGAggghAPDII--------TACAHPNILPSSTNPtlpytlntidehldmlm  316
ident       |            |         |     |                        
Sbjct PGDVVTHCFNG---kSGSSIxededlfnLAERCEGIRLDIGHG-----------------  249
DSSP  LLLEEELLLLL---lLLLLLlllhhhhhHHHHLLLLEEELLLL-----------------


DSSP  hhhllllllhhhhhlllllllhhHHHHHHHHH-hLLLLLEEELLLLLLLL---lLLHHHH
Query vchhldpdiaedvafaesrirreTIAAEDVLH-dLGAFSLTSSDSQAMGR---vGEVILR  372
ident                                          | |                
Sbjct -------------------gasfSFKVAEAAIarGLLPFSISTDLHGHSXnfpvWDLATT  290
DSSP  -------------------llllLHHHHHHHHhlLLLLLLLLLLLLLLLLllllLLHHHH


DSSP  HHHHHHHHhhhhlllllllllllhhHHHHHHHLLLHHHHHHLLLLLlllLLLLLLLLLEE
Query TWQVAHRMkvqrgalaeetgdndnfRVKRYIAKYTINPALTHGIAHevgSIEVGKLADLV  432
ident                                   | |||             ||  ||  
Sbjct XSKLLSVD----------------xPFENVVEAVTRNPASVIRLDX-enRLDVGQRADFT  333
DSSP  HHHHHHLL----------------lLHHHHHHLLLHHHHHHLLLLL-llLLLLLLLLEEE


DSSP  EELHH-----------------HLLLlLLEEEELLEEEEEEellllllllllllleeeel
Query VWSPA-----------------FFGVkPATVIKGGMIAIAPmgdinasiptpqpvhyrpm  475
ident |                          |     |     |                    
Sbjct VFDLVdadleatdsngdvsrlkRLFE-PRYAVIGAEAIAAS-------------------  373
DSSP  EEEEEeeeeeeellllleeeeeEEEE-EEEEEELLEEEELL-------------------


DSSP  hhhlhhhhhhhleeeelhhhhhhlhhhhllllleeeellllllllhhhllllllllleee
Query fgalgsarhhcrltflsqaaaangvaerlnlrsaiavvkgcrtvqkadmvhnslqpnitv  535
ident                                                             
Sbjct ------------------------------------------------------------  373
DSSP  ------------------------------------------------------------


DSSP  lllllleeelleellllllllllllllLLLL
Query daqtyevrvdgelitsepadvlpmaqrYFLF  566
ident                                
Sbjct -------------------------ryIPRA  379
DSSP  -------------------------llLLLL


No 16: Query=1a5kC Sbjct=3mkvA Z-score=18.3

back to top
DSSP  leeehhhhhhhhlllllleeelllllleeelleellllllllllllllllllllllllll
Query snisrqayadmfgptvgdkvrladtelwieveddlttygeevkfgggkvirdgmgqgqml   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhhllLEEEEEEEEEELL--EEEE-EEEEEELLEEEEEELeelllllllLLEELLlLLEE
Query aadcvDLVLTNALIVDHW--GIVK-ADIGVKDGRIFAIGKagnpdiqpnVTIPIGaATEV  117
ident           |    |           |   || |                |       |
Sbjct ---ltTFLFRNGALLDPDhpDLLQgFEILIEDGFIREVSD---------KPIKSS-NAHV   47
DSSP  ---llEEEEEEEEELLLLllLLEEeEEEEEELLEEEEEEL---------LLLLLL-LLEE


DSSP  EELLLLEEEELEEEEEEELL--------------------LLLHHHHHHHHLEEEEE-EE
Query IAAEGKIVTAGGIDTHIHWI--------------------CPQQAEEALVSGVTTMV-GG  156
ident |   ||    | || | |                              |  | ||    |
Sbjct IDVKGKTIMPGLIDLHVHVVaiefnlprvatlpnvlvtlrAVPIMRAMLRRGFTTVRdAG  107
DSSP  EELLLLEEEELEEEEEELLLlllllhhhhllllhhhhhhhHHHHHHHHHHLLEEEEEeLL


DSSP  LLlllhhhhhlllllhhhhHHHHHHHHL---LLLLEEEEE-EELL---------------
Query GTgpaagthattctpgpwyISRMLQAAD---SLPVNIGLL-GKGN---------------  197
ident |                       ||                                  
Sbjct GA-----------------GYPFKQAVEsglVEGPRLFVSgRALSqtgghadprarsdym  150
DSSP  LL-----------------LHHHHHHHHlllLLLLEEEELlLEEElllllllllllllll


DSSP  ----------------------lLLHHHHHHHHHHLLLEEEEEHH------------hLL
Query ----------------------vSQPDALREQVAAGVIGLEIHED------------wGA  223
ident                            | ||    |     |                | 
Sbjct ppdspcgccvrvgalgrvadgvdEVRRAVREELQMGADQIXIMASggvasptdpvgvfGY  210
DSSP  llllllllllllllleeelllhhHHHHHHHHHHHHLLLLEEEELLlllllllllllllLL


DSSP  LHHHHHHHHHHHHHHLLEEEEELllllllllHHHHHHHHLLLLEEELLLLllllllllLH
Query TPAAIDCALTVADEMDIQVALHSdtlnesgfVEDTLAAIGGRTIHTFHTEgaggghapDI  283
ident     |      |      |  |               |         |           |
Sbjct SEDEIRAIVAEAQGRGTYVLAHA------ytPAAIARAVRCGVRTIEHGN--------LI  256
DSSP  LHHHHHHHHHHHHLLLLLEEEEE------llHHHHHHHHHLLLLEEEELL--------LL


DSSP  HH-HHHL---LLEEEEEEHHhllllllhhhHHHHHHHHhhLLLLllhHHHHLLLLLLLhh
Query IT-ACAH---PNILPSSTNPtlpytlntidEHLDMLMVchHLDPdiaEDVAFAESRIRre  339
ident                  |                       | |   |  |         
Sbjct DDeTARLvaeHGAYVVPTLV-------tydALASEGEK-yGLPP---ESIAKIADVHG--  303
DSSP  LHhHHHHhhhHLLEEELLHH-------hhhHHHHHLLL-lLLLH---HHHLLHHHHHL--


DSSP  HHHHHHHHHHL-LLLLEEELLLLL--llLLLLHHHHHHHHHhhhhhhhlllllllllllh
Query TIAAEDVLHDL-GAFSLTSSDSQA--mgRVGEVILRTWQVAhrmkvqrgalaeetgdndn  396
ident             |       |                  |                    
Sbjct AGLHSIEIMKRaGVKMGFGTDLLGeaqrLQSDEFRILAEVL-------------------  344
DSSP  LHHHHHHHHHHhLLLLLLLLLLLHhhhhHLLHHHHHHHLLL-------------------


DSSP  hHHHHHHHLLLHHHHHHLLLLLLLLLLLLLLLLLEEEELHH-----HLLL----LLLEEE
Query fRVKRYIAKYTINPALTHGIAHEVGSIEVGKLADLVVWSPA-----FFGV----KPATVI  447
ident       ||  ||  |   |     | |  |  ||  |                     | 
Sbjct -SPAEVIASATIVSAEVLGMQDKLGRIVPGAHADVLVVDGNplksvDCLLgqgeHIPLVM  403
DSSP  -LHHHHHHHLLHHHHHHLLLLLLLLLLLLLLLLLEEEELLLlllllLLLLllllLLLEEE


DSSP  ELLEEEEEEellllllllllllleeeelhhhlhhhhhhhleeeelhhhhhhlhhhhllll
Query KGGMIAIAPmgdinasiptpqpvhyrpmfgalgsarhhcrltflsqaaaangvaerlnlr  507
ident | |                                                         
Sbjct KDGRLFVNE---------------------------------------------------  412
DSSP  ELLEEEEEL---------------------------------------------------


DSSP  leeeellllllllhhhllllllllleeelllllleeelleellllllllllllllllll
Query saiavvkgcrtvqkadmvhnslqpnitvdaqtyevrvdgelitsepadvlpmaqryflf  566
ident                                                            
Sbjct ---------------------------------------------------------le  414
DSSP  ---------------------------------------------------------ll


No 17: Query=1a5kC Sbjct=1j6pA Z-score=18.1

back to top
DSSP  leeehhhhhhhhlllllleeelllllleeelleellllllllllllllllllllllllll
Query snisrqayadmfgptvgdkvrladtelwieveddlttygeevkfgggkvirdgmgqgqml   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhhlLLEEEEEEEEE-ELLEE-EEEEEEEELLEEEEEELeellllllllleellllleEE
Query aadcVDLVLTNALIV-DHWGI-VKADIGVKDGRIFAIGKagnpdiqpnvtipigaateVI  118
ident           | ||  |              | |                          
Sbjct ----HHXIIGNCLILkDFSSEpFWGAVEIENGTIKRVLQ--------------gevkvDL   42
DSSP  ----LEEEEEEEEELlLLLLLlEEEEEEEELLEEEEEEE--------------lllllLE


DSSP  ELLLLEEEELEEEEEEELL------------------------------------LLLHH
Query AAEGKIVTAGGIDTHIHWI------------------------------------CPQQA  142
ident    || |      || |                                           
Sbjct DLSGKLVXPALFNTHTHAPxtllrgvaedlsfeewlfskvlpiedrltekxayygTILAQ  102
DSSP  ELLLEEEEELEEEEEELHHhhhhllllllllhhhhhhllhhhhhllllhhhhhhhHHHHH


DSSP  HHHHHHLEEEEEEelllllhhhhhlLLLLhhhhHHHHHHHHLLLLLEEEEEEELLL--LL
Query EEALVSGVTTMVGggtgpaagthatTCTPgpwyISRMLQAADSLPVNIGLLGKGNV--SQ  200
ident  |    |    |                           |         |          
Sbjct XEXARHGIAGFVD------------XYFH----EEWIAKAVRDFGXRALLTRGLVDsnGD  146
DSSP  HHHHLLLEEEEEE------------EELL----HHHHHHHHHHHLLEEEEEEEELLllLL


DSSP  HHHHHHHHHHLL-----------LEEEE-EHHHLlLHHHHHHHHHHHHHHLLEEEEEL--
Query PDALREQVAAGV-----------IGLEI-HEDWGaTPAAIDCALTVADEMDIQVALHS--  246
ident      |                  |                     |      |  |   
Sbjct DGGRLEENLKLYnewngfegrifVGFGPhSPYLC-SEEYLKRVFDTAKSLNAPVTIHLye  205
DSSP  LLLHHHHHHHHHhhhllhhhleeEEEEElLLLLL-LHHHHHHHHHHHHHHLLLEEEEEll


DSSP  -lLLLLllLHHHHHHHHLLL-LEEELLLLLlllllLLLHHHHHHLLLEEEEEE-HHHLll
Query -dTLNEsgFVEDTLAAIGGR-TIHTFHTEGaggghAPDIITACAHPNILPSST-NPTLpy  303
ident           || |            |                       |      |  
Sbjct tsKEEY--DLEDILNIGLKEvKTIAAHCVH----lPERYFGVLKDIPFFVSHNpASNL--  257
DSSP  llLLLL--LLHHHHLLLLLLlLEEEEELLL----lLHHHHHHHLLLLEEEEELhHHHH--


DSSP  lllhhhhhhhhhhhhhllllllhhhhhlllllllhhhHHHHhhHHHLLL----LLEEELL
Query tlntidehldmlmvchhldpdiaedvafaesrirretIAAEdvLHDLGA----FSLTSSD  359
ident                                                            |
Sbjct ----------------------------------klgNGIA--PVQRXIehgxKVTLGTD  281
DSSP  ----------------------------------hllLLLL--LHHHHHhlllEEEELLL


DSSP  LLLLLLLLLHHHHHHHHHHHHHHHHLLLllllllllhhHHHHHHHLLLHHHHHHLLLllL
Query SQAMGRVGEVILRTWQVAHRMKVQRGALaeetgdndnfRVKRYIAKYTINPALTHGIahE  419
ident   |                  | |               |       |   |   |    
Sbjct GAASNNSLNLFFEXRLASLLQKAQNPRN---------lDVNTCLKXVTYDGAQAXGF--K  330
DSSP  LLLLLLLLLHHHHHHHHHHHHHLLLLLL---------lLHHHHHHHHLHHHHHHHLL--L


DSSP  LLLLLLLLLLLEEEELHH----------------hLLLLLLEEEELLEEEEEEellllll
Query VGSIEVGKLADLVVWSPA----------------fFGVKPATVIKGGMIAIAPmgdinas  463
ident  | || |  |||||                     |          |             
Sbjct SGKIEEGWNADLVVIDLDlpexfpvqniknhlvhaFSGEVFATXVAGKWIYFD-------  383
DSSP  LLLLLLLLLLLEEEEELLlhhhllhhhhhhhhhhlLLLLLLEEEELLEEEEEL-------


DSSP  llllllleEEELhhHLHHhhhhhleeeelhhhhhhlhhhhllllleeeellllllllhhh
Query iptpqpvhYRPMfgALGSarhhcrltflsqaaaangvaerlnlrsaiavvkgcrtvqkad  523
ident                  |                                          
Sbjct --------GEYP--TIDS------------------------------------------  391
DSSP  --------LLLL--LLLH------------------------------------------


DSSP  llllllllleeelllllleeelleellllllllllllllllll
Query mvhnslqpnitvdaqtyevrvdgelitsepadvlpmaqryflf  566
ident                                            
Sbjct ---------------------------eevkrelariekelys  407
DSSP  ---------------------------hhhhhhhhhhhhhhhl


No 18: Query=1a5kC Sbjct=3ls9A Z-score=17.8

back to top
DSSP  leeehhhhhhhhlllllleeelllllleeelleellllllllllllllllllllllllll
Query snisrqayadmfgptvgdkvrladtelwieveddlttygeevkfgggkvirdgmgqgqml   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhhllLEEEEEE-EEEEL---LEEEE-EEEEEELLEEEEEELEelllllllllEELLLLL
Query aadcvDLVLTNA-LIVDH---WGIVK-ADIGVKDGRIFAIGKAgnpdiqpnvtIPIGAAT  115
ident                            |||      | | ||                  
Sbjct -----MILIRGLtRVITFddqERELEdADILIDGPKIVAVGKD----------LSDRSVS   45
DSSP  -----LEEEEEEeEEELLlllLLEEEeEEEEEELLEEEEEELL----------LLLLLLL


DSSP  EEEELLLLEEEELEEEEEEELL--------------------------------------
Query EVIAAEGKIVTAGGIDTHIHWI--------------------------------------  137
ident   |   | |   | |  | |                                        
Sbjct RTIDGRGMIALPGLINSHQHLYegamraipqlervtmaswlegvltrsagwwrdgkfgpd  105
DSSP  EEEELLLEEEEELEEEEEELHHhhhhlllhhhllllhhhhhhhhhhhhhhhhhlllllhh


DSSP  -----LLLHHHHHHHHLEEEEEEelllllhhhhhlLLLLH-----HHHHHHHHHHHLLLL
Query -----CPQQAEEALVSGVTTMVGggtgpaagthatTCTPG-----PWYISRMLQAADSLP  187
ident            | |  | ||                           ||     ||  | 
Sbjct virevARAVLLESLLGGITTVAD------------QHLFFpgataDSYIDATIEAATDLG  153
DSSP  hhhhhHHHHHHHHHHLLEEEEEE------------EELLLlllllLLHHHHHHHHHHHHL


DSSP  LEEEEEEELLL------------------lLHHHHHHHHHHLL---------LEEEEE-H
Query VNIGLLGKGNV------------------sQPDALREQVAAGV---------IGLEIH-E  219
ident                                                     | |     
Sbjct IRFHAARSSMTlgkseggfcddlfvepvdrVVQHCLGLIDQYHepepfgmvrIALGPCgV  213
DSSP  LEEEEEELLLLllhhhlllllhhhlllhhhHHHHHHHHHHHHLllllllleeEEELLLlL


DSSP  HHLlLHHHHHHHHHHHHHHLLEEEEEL---lLLLL-----LLLH-HHHHHHHLLL-LEEE
Query DWGaTPAAIDCALTVADEMDIQVALHS---dTLNE-----SGFV-EDTLAAIGGR-TIHT  269
ident      |         |   |     |                                  
Sbjct PYD-KPELFEAFAQMAADYDVRLHTHFyeplDAGMsdhlyGMTPwRFLEKHGWASdRVWL  272
DSSP  LLL-LHHHHHHHHHHHHHHLLEEEEEEllllHHHHhhhhhLLLHhHHHHHLLLLLlLEEE


DSSP  LLLLLlllllLLLHH-HHHHLlLEEEEEE-HHHLlllllhhhhhhhhhhhhhllllllhh
Query FHTEGaggghAPDII-TACAHpNILPSST-NPTLpytlntidehldmlmvchhldpdiae  327
ident  |            |                | |                          
Sbjct AHAVV----pPREEIpEFADA-GVAIAHLiAPDL--------------------------  301
DSSP  EELLL----lLHHHHhHHHHH-LLEEEELhHHHH--------------------------


DSSP  hhhlllllllhhhHHHHhhHHHLLL----LLEEELLLLLL-LLLLlHHHHHHHHHHHHHH
Query dvafaesrirretIAAEdvLHDLGA----FSLTSSDSQAM-GRVGeVILRTWQVAHRMKV  382
ident                                       |               |     
Sbjct ----------rmgWGLA--PIREYLdagiTVGFGTTGSASnDGGN-LLGDLRLAALAHRP  348
DSSP  ----------hllLLLL--LHHHHHhlllEEEELLLLLLLlLLLL-HHHHHHHHHHHLHH


DSSP  HH--LLLLlllllllhhHHHHHHHLLLHHHHHHLLLLlLLLLLLLLLLLLEEEELH----
Query QR--GALAeetgdndnfRVKRYIAKYTINPALTHGIAhEVGSIEVGKLADLVVWSP----  436
ident                           |   |   |     |  | |  ||   |      
Sbjct ADpnEPEK-------wlSARELLRMATRGSAECLGRP-DLGVLEEGRAADIACWRLdgvd  400
DSSP  HLllLHHH-------llLHHHHHHHLLHHHHHHLLLL-LLLLLLLLLLLLEEEEELllhh


DSSP  --------HHLL-----LLLLEEEELLEEEEEEellllllllllllleEEELhhHLHHhh
Query --------AFFG-----VKPATVIKGGMIAIAPmgdinasiptpqpvhYRPMfgALGSar  483
ident                       |   |                      ||         
Sbjct rvgvhdpaIGLImtglsDRASLVVVNGQVLVEN---------------ERPV--LADL--  441
DSSP  hlllllhhHHHHhllllLLLLEEEELLEEEEEL---------------LEEL--LLLH--


DSSP  hhhleeeelhhhhhhlhhhhllllleeeellllllllhhhllllllllleeellllllee
Query hhcrltflsqaaaangvaerlnlrsaiavvkgcrtvqkadmvhnslqpnitvdaqtyevr  543
ident                                                             
Sbjct ------------------------------------------------------------  441
DSSP  ------------------------------------------------------------


DSSP  elleellllllllllllllllll
Query vdgelitsepadvlpmaqryflf  566
ident                        
Sbjct -----------erivanttalip  453
DSSP  -----------hhhhhhhhhhll


No 19: Query=1a5kC Sbjct=4c5yA Z-score=17.4

back to top
DSSP  leeehhhhhhhhlllllleeelllllleeelleellllllllllllllllllllllllll
Query snisrqayadmfgptvgdkvrladtelwieveddlttygeevkfgggkvirdgmgqgqml   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhhllLEEEEEEEEE-ELLEEEE-EEEEEELLEEEEEELEelllllllLLEE--LLLLL-
Query aadcvDLVLTNALIV-DHWGIVK-ADIGVKDGRIFAIGKAgnpdiqpnVTIP--IGAAT-  115
ident             |           |     |  |   |            ||      | 
Sbjct -deakVTIIYAGLLIpGDGEPLRnAALVISDKIIAFVGSE--------ADIPkkYLRSTq   51
DSSP  -llllEEEEEEEEELlLLLLLEEeEEEEEELLEEEEEEEH--------HHLLhhHHHHLl


DSSP  EEEELllLEEEELEEEEEEELL-----------------------LLLHHHHHHHHLEEE
Query EVIAAegKIVTAGGIDTHIHWI-----------------------CPQQAEEALVSGVTT  152
ident             |  | | |                               |||  | | 
Sbjct STHRV--PVLMPGLWDCHMHFGgdddyyndytsglathpassgarLARGCWEALQNGYTS  109
DSSP  LEEEE--EEEEELEEEEEELLLlllllllllhhhhhllhhhhhhhHHHHHHHHHHLLEEE


DSSP  EEE-ELLLllhhhhhlllllhhhhhhHHHHHHL---LLLLEEEEE-EELLL---------
Query MVG-GGTGpaagthattctpgpwyisRMLQAAD---SLPVNIGLL-GKGNV---------  198
ident      | |                      |         |                   
Sbjct YRDlAGYG-----------------cEVAKAINdgtIVGPNVYSSgAALSQtaghgdifa  152
DSSP  EEElLLLH-----------------hHHHHHHHlllLLLLEEEELlLEEELlllllllll


DSSP  --------------------------------LLHHHHHHHHHHLLLEEEEEH-------
Query --------------------------------SQPDALREQVAAGVIGLEIHE-------  219
ident                                     | | |   |               
Sbjct lpagevlgsygvmnprpgywgagplciadgveEVRRAVRLQIRRGAKVIXVMAsggvmsr  212
DSSP  llhhhhhhhhlllllllllllllleeelllhhHHHHHHHHHHHHLLLLEEEELlllllll


DSSP  -----hhLLLHHHHHHHHHHHHHHLLEEEEELlllllllLHHHHHHHHLLLLEEELLLLl
Query -----dwGATPAAIDCALTVADEMDIQVALHSdtlnesgFVEDTLAAIGGRTIHTFHTEg  274
ident           |         |      |  |              |||        |   
Sbjct ddnpnfaQFSPEELKVIVEEAARQNRIVSAHV------hGKAGIMAAIKAGCKSLEHVS-  265
DSSP  lllllllLLLHHHHHHHHHHHHHLLLLEEEEE------lLHHHHHHHHHHLLLEEEELL-


DSSP  lllllllLHHH-HHHL---LLEEEEEE-HHHLlllllHHHHHHHHHHhhhllllllhhhH
Query aggghapDIIT-ACAH---PNILPSST-NPTLpytlnTIDEHLDMLMvchhldpdiaedV  329
ident                      ||   |                  |              
Sbjct -------YADEeVWELmkeKGILYVATrSVIE----iFLASNGEGLV------------K  302
DSSP  -------LLLHhHHHHhhhHLLEEELLhHHHH----hHHHHLLLLLL------------L


DSSP  HLLlLLLL--HHHHHH-HHHHHHLLLLLEEELLLLllllLLLHHHHHHHHHHHHHhhhll
Query AFAeSRIR--RETIAA-EDVLHDLGAFSLTSSDSQamgrVGEVILRTWQVAHRMKvqrga  386
ident                         |       |       |   |       |       
Sbjct ESW-AKLQalADSHLKaYQGAIKAGVTIALGTDTA---pGGPTALELQFAVERGG-----  353
DSSP  LHH-HLLLhhHHHHHHhHHHHHHLLLLEELLLLLL---lLLLLHHHHHHHHHLLL-----


DSSP  lllllllllhhHHHHHHHLLLHHHHHHL--LLLLlLLLLLLLLLLLEEEELHHH-----L
Query laeetgdndnfRVKRYIAKYTINPALTH--GIAHeVGSIEVGKLADLVVWSPAF-----F  439
ident                 |   | |  |          |    |  ||              
Sbjct ----------mTPLEAIKAATANAPLSVgpQAPL-TGQLREGYEADVIALEENPledikV  402
DSSP  ----------lLHHHHHHHHLLLHHHHHhhHLLL-LLLLLLLLLLLEEEELLLLlllhhH


DSSP  LLL---LLEEEELLEEEEEEEllllllllllllleeEELHhhLHHHhhhhleeeelhhhh
Query GVK---PATVIKGGMIAIAPMgdinasiptpqpvhyRPMFgaLGSArhhcrltflsqaaa  496
ident          | |||     |                                        
Sbjct FQEpkaVTHVWKGGKLFKGPG-------------igPWGE-dARNP--------------  434
DSSP  HHLhhhEEEEEELLEEEELLL-------------llLLLL-lLLLL--------------


DSSP  hhlhhhhllllleeeellllllllhhhllllllllleeelllllleeelleellllllll
Query angvaerlnlrsaiavvkgcrtvqkadmvhnslqpnitvdaqtyevrvdgelitsepadv  556
ident                                                             
Sbjct ------------------------------------------------------------  434
DSSP  ------------------------------------------------------------


DSSP  llllllllll
Query lpmaqryflf  566
ident           
Sbjct --------fl  436
DSSP  --------ll


No 20: Query=1a5kC Sbjct=3icjA Z-score=17.2

back to top
DSSP  leeehhhhhhhhlllllleeelllllleeelleellllllllllllllllllllllllll
Query snisrqayadmfgptvgdkvrladtelwieveddlttygeevkfgggkvirdgmgqgqml   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhhllLEEEEEEE-EEEL-LEEEEEEEEEELLEEEEEELEelllllllLLEE--LLLL-L
Query aadcvDLVLTNAL-IVDH-WGIVKADIGVKDGRIFAIGKAgnpdiqpnVTIP--IGAA-T  115
ident         | |                     |    |           |       |  
Sbjct ----cMKALINGTiYTSFsPVKKVSGLVISNERVLYAGDS--------STALriAELAgG   48
DSSP  ----lEEEEELLEeEEEElLEEEELEEEEELLEEEEEELH--------HHHHhhHHHHlL


DSSP  EEEELLLLEEEELEEEEEEE-LLLL-----------------------------------
Query EVIAAEGKIVTAGGIDTHIH-WICP-----------------------------------  139
ident | |   || |     | | |                                        
Sbjct EIIDLKGKFVMPAFFDSHLHlDELGmslemvdlrgvksmeelvervkkgrgriifgfgwd  108
DSSP  EEEELLLLEEEELEEEEEELhHHHHhhhhleellllllhhhhhhhhhlllllleeeeeel


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  139
ident                                                             
Sbjct qdelgrwptredldvidrpvflyrrcfhvavmnskmidllnlkpskdfdestgivreral  168
DSSP  hhhhlllllhhhhlllllleeeeelllleeeelhhhhhhhllllllleelllleeehhhh


DSSP  ----------------------LHHHHHHHHLEEEEEEelllllhhhhhlLLLLHhHHHH
Query ----------------------QQAEEALVSGVTTMVGggtgpaagthatTCTPGpWYIS  177
ident                          |  |  ||                           
Sbjct eesrkiinekiltvkdykhyieSAQEHLLSLGVHSVGF------------MSVGE-KALK  215
DSSP  hhhhhhhhhllllhhhhhhhhhHHHHHHHHLLEEEEEE------------EEELH-HHHH


DSSP  HHHHHH--LLLLLEEEEEEELllllhhHHHHH----------hhhlLLEEEEEHH-----
Query RMLQAA--DSLPVNIGLLGKGnvsqpdALREQ----------vaagVIGLEIHED-----  220
ident           |  |              |                   |     |     
Sbjct ALFELEreGRLKMNVFAYLSP-----eLLDKLeelnlgkfegrrlrIWGVXLFVDgslga  270
DSSP  HHHHHHhlLLLLLEEEEEELH-----hHHHHHhhhlllleellleeEEEEEEELLlllll


DSSP  ------------------hLLLHHHHHHHHHHHHHHLLEEEEELllllllllHHHHHHHH
Query ------------------wGATPAAIDCALTVADEMDIQVALHSdtlnesgfVEDTLAAI  262
ident                          |      |      || |         |   | | 
Sbjct rtallsepytdnpttsgelVMNKDEIVEVIERAKPLGLDVAVHA---igdkaVDVALDAF  327
DSSP  lllllllllllllllllllLLLHHHHHHHHHHHLLLLLEEEEEE---llhhhHHHHHHHH


DSSP  L--LLLEEELLLLLlllllLLLHHHHHHLLLEEEEEEHHHLLLLLLHHHHhhhhhhhhhl
Query G--GRTIHTFHTEGaggghAPDIITACAHPNILPSSTNPTLPYTLNTIDEhldmlmvchh  320
ident           |          |            |                         
Sbjct EeaEFSGRIEHASL----vRDDQLERIKELKVRISAQPHFIVSDWWIVNR----------  373
DSSP  HhhLLLLEEEELLL----lLHHHHHHHHHHLLEEEELLLHHHHLLLHHHH----------


DSSP  lllllhhhhhllllllLHHHHhhHHHHHhLLLL-LEEELLLLlLLLLlLHHHHHHHHHHH
Query ldpdiaedvafaesriRRETIaaEDVLHdLGAF-SLTSSDSQaMGRVgEVILRTWQVAHR  379
ident                 |                    | ||                  |
Sbjct ------------vgeeRAKWA-yRLKTL-SSITkLGFSTDSP-IEPA-DPWVSIDAAVNR  417
DSSP  ------------hhhhHHHHL-lLHHHH-HHHLlEEELLLLL-LLLL-LHHHHHHHHHHL


DSSP  hhhhhlllllllllllhhHHHHHHHLLLHHHHHHLLLLlLLLLLLLLLLLLEEEELHHHL
Query mkvqrgalaeetgdndnfRVKRYIAKYTINPALTHGIAhEVGSIEVGKLADLVVWSPAFF  439
ident                           ||   |         |  | |  |          
Sbjct ---------yvvdpgervSREEALHLYTHGSAQVTLAE-DLGKLERGFRAEYIILDRDPL  467
DSSP  ---------llllhhhllLHHHHHHHLLHHHHHHLLLL-LLLLLLLLLLLLEEEELLLLL


DSSP  llllleeeelleeeeeeellllllllllllleeeelhhhlhhhhhhhleeeelhhhhhhl
Query gvkpatvikggmiaiapmgdinasiptpqpvhyrpmfgalgsarhhcrltflsqaaaang  499
ident                                                             
Sbjct ------------------------------------------------------------  467
DSSP  ------------------------------------------------------------


DSSP  hhhhllllleeeellllllllhhhllllllllleeelllllleeelleelllllllllll
Query vaerlnlrsaiavvkgcrtvqkadmvhnslqpnitvdaqtyevrvdgelitsepadvlpm  559
ident                                                             
Sbjct ------------------------------------------------------------  467
DSSP  ------------------------------------------------------------


DSSP  lllllll
Query aqryflf  566
ident        
Sbjct ------k  468
DSSP  ------l


No 21: Query=1a5kC Sbjct=3pnuA Z-score=17.0

back to top
DSSP  leeehhhhhhhhllLLLLEEELllllleeelleellllllllllllllllllllllllll
Query snisrqayadmfgpTVGDKVRLadtelwieveddlttygeevkfgggkvirdgmgqgqml   60
ident                                                             
Sbjct --------------ENLYFQSN--------------------------------------    8
DSSP  --------------LLLLLLLL--------------------------------------


DSSP  hhhllleeeeeeeeeelleeeeeeeeeelleeeeeeleellllllllleellllleeeel
Query aadcvdlvltnalivdhwgivkadigvkdgrifaigkagnpdiqpnvtipigaateviaa  120
ident                                                             
Sbjct ------------------------------------------------------------    8
DSSP  ------------------------------------------------------------


DSSP  llLEEEELEEEEEEELL----LLLHHHHHHHhLEEEEEEELllLLHHhhhlllLLHHHHH
Query egKIVTAGGIDTHIHWI----CPQQAEEALVsGVTTMVGGGtgPAAGthattcTPGPWYI  176
ident           | | |          |           |                      
Sbjct --AMKLKNPLDMHLHLRdnqmLELIAPLSAR-DFCAAVIMP-nLIPP------LCNLEDL   58
DSSP  --LEEEELLEEEEELLLlhhhHHHHHHHHHL-LLLEEEELL-lLLLL------LLLHHHH


DSSP  HHHHHHHLLLL----LEEEEEEELLLLLHHHHHHHHHhLLLEEEEEHH--------HLLL
Query SRMLQAADSLP----VNIGLLGKGNVSQPDALREQVAaGVIGLEIHED--------WGAT  224
ident                                |         |                  
Sbjct KAYKMRILKACkdenFTPLMTLFFKNYDEKFLYSAKD-EIFGIXLYPAgittnsngGVSS  117
DSSP  HHHHHHHHHHHllllLEEEEEEELLLLLHHHHHHHLL-LLLEEEELLLllllllllLLLL


DSSP  HH--hhHHHHHHHHHHLLEEEEELLLLL-----llLLHHHHHHHHLLL---LEEELLLLL
Query PA--aiDCALTVADEMDIQVALHSDTLN-----esGFVEDTLAAIGGR---TIHTFHTEG  274
ident          |       |    |  |          |               |   |   
Sbjct FDieylKPTLEAMSDLNIPLLVHGETNDfvmdresNFAKIYEKLAKHFprlKIVMEHITT  177
DSSP  LLhhhhHHHHHHHHHLLLLEEELLLLLLlhhhllhHHHHHHHHHHHHLlllLEEELLLLL


DSSP  lllllllLHHHHHH-LLLEEEEEEHHHLLLlllHHHHH------HHHHhhhhllllllhh
Query aggghapDIITACA-HPNILPSSTNPTLPYtlnTIDEH------LDMLmvchhldpdiae  327
ident                  |     |   |     | |                        
Sbjct ------kTLCELLKdYENLYATITLHHLII---TLDDViggkmnPHLF------------  216
DSSP  ------hHHHHHHHhLLLEEEEELLHHHLL---LHHHHhlllllHHHL------------


DSSP  hhhlllllLLHHHHHHHHHHHHLLL-lLEEELLLL--------LLLLLLLHHHHHHHHHH
Query dvafaesrIRRETIAAEDVLHDLGA-fSLTSSDSQ--------AMGRVGEVILRTWQVAH  378
ident          | |   |   |   |       |||                          
Sbjct ---ckpiaKRYEDKEALCELAFSGYekVMFGSDSAphpkgcaaGVFSAPVILPVLAELFK  273
DSSP  ---lllllLLHHHHHHHHHHHHLLLllEEELLLLLllllllllLLLLHHHHHHHHHHHHH


DSSP  HHhhhhlllllllllllhhHHHHHHHLLLHHHHHHlLLLLLlllllllLLLLEEEELHHH
Query RMkvqrgalaeetgdndnfRVKRYIAKYTINPALThGIAHEvgsievgKLADLVVWSPAF  438
ident                               |                 |           
Sbjct QN----------------sSEENLQKFLSDNTCKI-YDLKF-------KEDKILTLEEKE  309
DSSP  HH----------------lLHHHHHHHHLHHHHHH-HLLLL-------LLLLEEEEELLL


DSSP  lllllleeeelleeeeeeellllllllllllleeeelhhhlhhhhhhhleeeelhhhhhh
Query fgvkpatvikggmiaiapmgdinasiptpqpvhyrpmfgalgsarhhcrltflsqaaaan  498
ident                                                             
Sbjct ------------------------------------------------------------  309
DSSP  ------------------------------------------------------------


DSSP  lhhhhllllleeeellllllllhhhllllllllleeelllllleeelleellllllllll
Query gvaerlnlrsaiavvkgcrtvqkadmvhnslqpnitvdaqtyevrvdgelitsepadvlp  558
ident                                                             
Sbjct ------------------------------------------------------------  309
DSSP  ------------------------------------------------------------


DSSP  lllLLLLL------------------------
Query maqRYFLF------------------------  566
ident                                 
Sbjct ---WQVPNvyedkynqvvpymageilkfqlkh  338
DSSP  ---EELLLleelllleellllllleelleell


No 22: Query=1a5kC Sbjct=1k6wA Z-score=16.9

back to top
DSSP  leeehhhhhhhhlllllleeelllllleeelleellllllllllllllllllllllllll
Query snisrqayadmfgptvgdkvrladtelwieveddlttygeevkfgggkvirdgmgqgqml   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhhllLEEEEEEEEeelLEEE-EEEEEEELLEEEEEELEellllllllleelllLLEEEE
Query aadcvDLVLTNALIvdhWGIV-KADIGVKDGRIFAIGKAgnpdiqpnvtipigaATEVIA  119
ident           ||      |      |   || | ||                        
Sbjct ----aLQTIINARL---PGEEgLWQIHLQDGKISAIDAQ---------sgvmpiTENSLD   44
DSSP  ----lLLEEEEELL---LLLLlEEEEEEELLEEEEEEEE---------llllllLLLEEE


DSSP  LLLLEEEELEEEEEEELL--------------------------------------LLLH
Query AEGKIVTAGGIDTHIHWI--------------------------------------CPQQ  141
ident ||   |       |||                                          | 
Sbjct AEQGLVIPPFVEPHIHLDttqtagqpnwnqsgtlfegierwaerkallthddvkqrAWQT  104
DSSP  LLLLEEELLEEEEEELLLlllllllllllllllhhhhhhhhhllhhhllhhhhhhhHHHH


DSSP  HHHHHHHLEEEEEEElllllhhhhhllLLLH---HHHHHHHHHHHLLL--LLEEEEEEEL
Query AEEALVSGVTTMVGGgtgpaagthattCTPG---PWYISRMLQAADSL--PVNIGLLGKG  196
ident        |                                ||                  
Sbjct LKWQIANGIQHVRTH------------VDVSdatLTALKAMLEVKQEVapWIDLQIVAFP  152
DSSP  HHHHHHLLEEEEEEE------------EELLlllLHHHHHHHHHHHHHllLLEEEEEEEL


DSSP  --LLLL----HHHHHHHHHHLLLEEEEEHHHL----lLHHHHHHHHHHHHHHLLEEEEE-
Query --NVSQ----PDALREQVAAGVIGLEIHEDWG----aTPAAIDCALTVADEMDIQVALH-  245
ident              | |    |                           |   |     | 
Sbjct qeGILSypngEALLEEALRLGADVVGAIPHFEftreyGVESLHKTFALAQKYDRLIDVHc  212
DSSP  llLLLLlllhHHHHHHHHHLLLLEEEELHHHLllhhhHHHHHHHHHHHHHHHLLEEEEEe


DSSP  LLLLLllLLHHhHHHH-HLLL-------LEEELLLlllllLLLLL--------hhhhHHL
Query SDTLNesGFVEdTLAA-IGGR-------TIHTFHTegaggGHAPD--------iitaCAH  289
ident                                  ||                         
Sbjct DEIDD--EQSR-FVETvAALAhhegmgaRVTASHT-----TAMHSyngaytsrlfrlLKM  264
DSSP  LLLLL--LLLL-HHHHhHHHHhhhllhhHEEEEEL-----HHHHHllhhhhhhhhhhHHH


DSSP  LLEEEEEEHHHllllllhhhhhhhhhhhhhllllllhhhhhLLLLlllHHHH-hhHHHHH
Query PNILPSSTNPTlpytlntidehldmlmvchhldpdiaedvaFAESrirRETI-aaEDVLH  348
ident   |                                                         
Sbjct SGINFVANPLV-------------------------nihlqGRFDtypKRRGitrVKEML  299
DSSP  HLLEEEELHHH-------------------------hhhhlLLLLlllLLLLlllHHHHH


DSSP  HLLLLLEEELLLL----LLLLLLLHHHHHHHHHH--HHHHhhlllllllllllHHHHHHH
Query DLGAFSLTSSDSQ----AMGRVGEVILRTWQVAH--RMKVqrgalaeetgdndNFRVKRY  402
ident   |       |                      |                          
Sbjct ESGINVCFGHDDVfdpwYPLGTANMLQVLHMGLHvcQLMG-------------YGQINDG  346
DSSP  HLLLLEEELLLLLllllLLLLLLLHHHHHHHHHHhlLLLL-------------HHHHHHH


DSSP  HHLLLHHHHHHLLlLLLLlLLLLLLLLLEEEELH---HHLL---LLLLEEEELLEEEEEE
Query IAKYTINPALTHGiAHEVgSIEVGKLADLVVWSP---AFFG---VKPATVIKGGMIAIAP  456
ident     |   | |         |  |  | |               |       ||      
Sbjct LNLITHHSARTLN-LQDY-GIAAGNSANLIILPAengFDALrrqVPVRYSVRGGKVIAST  404
DSSP  HHHHLHHHHHHLL-LLLL-LLLLLLLLLEEEELLllhHHHHhhlLLLLEEEELLEEEEEL


DSSP  EllllllllLLLLleeeelhhhlhhhhhhhleeeelhhhhhhlhhhhllllleeeellll
Query MgdinasipTPQPvhyrpmfgalgsarhhcrltflsqaaaangvaerlnlrsaiavvkgc  516
ident                                                             
Sbjct Q-------pAQTT-----------------------------------------------  410
DSSP  L-------lLLEE-----------------------------------------------


DSSP  llllhhhllllllllleeelllllleeelleellllllllllllllllll
Query rtvqkadmvhnslqpnitvdaqtyevrvdgelitsepadvlpmaqryflf  566
ident                                                   
Sbjct -------------------------------------vyleqpeaidykr  423
DSSP  -------------------------------------eellleeeellll


No 23: Query=1a5kC Sbjct=3ooqA Z-score=16.8

back to top
DSSP  leeehhhhhhhhlllllleeelllllleeelleellllllllllllllllllllllllll
Query snisrqayadmfgptvgdkvrladtelwieveddlttygeevkfgggkvirdgmgqgqml   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhhllLEEEEEEEEE-ELLEEEEEEEEEELLEEEEEELEelllllllllEELLlLLEEEE
Query aadcvDLVLTNALIV-DHWGIVKADIGVKDGRIFAIGKAgnpdiqpnvtIPIGaATEVIA  119
ident           ||          | |  |  |     |            |      |   
Sbjct -----KILFKNATVFpITSRPFKGDVLVSNGKVEKVGEN----------IEDP-DAEIVD   44
DSSP  -----LEEEEEEEELlLLLLLEEEEEEEELLEEEEEELL----------LLLL-LLEEEE


DSSP  LLLLEEEELEEEEEEE--LLLL------------------------------LHHHHHHH
Query AEGKIVTAGGIDTHIH--WICP------------------------------QQAEEALV  147
ident   ||    |  | | |                                       | || 
Sbjct LTGKFLFPGFVDAHSHigLFEEgvgyyysdgneatdpvtphvkaldgfnpqdPAIERALA  104
DSSP  LLLLEEEELEEEEEELllLLLLlllhhhlllllllllllllllhhhhlllllHHHHHHHL


DSSP  HLEEEEEEElllllhhhhhLLLL----lhhhhhhhhhHHHLLLllEEEEeeelllllhhh
Query SGVTTMVGGgtgpaagthaTTCT----pgpwyisrmlQAADSLpvNIGLlgkgnvsqpda  203
ident  |||                                                        
Sbjct GGVTSVXIV----------PGSAnpvggqgsvikfrsIIVEEC--IVKD-----------  141
DSSP  LLEEEEEEL----------LLLLlleeeeeeeeelllLLHHHH--EEEE-----------


DSSP  hhhhhhhlLLEEEEE--HHHL--------------lLHHHHH------------------
Query lreqvaagVIGLEIH--EDWG--------------aTPAAID------------------  229
ident           ||     |                  |   |                   
Sbjct --------PAGLKXAfgENPKrvygerkqtpstrxgTAGVIRdyftkvknyxkkkelaqk  193
DSSP  --------EEEEEEEllHHHHhhhhhlllllllhhhHHHHHHhhhhhhhhhhhhhhhhhh


DSSP  ------------hhHHHHHHHLLEEEEELlllllllLHHHHHHHHL--LLLEEELLLLLl
Query ------------caLTVADEMDIQVALHSdtlnesgFVEDTLAAIG--GRTIHTFHTEGa  275
ident                       |    |                    |      |    
Sbjct egkeftetdlkxevGEXVLRKKIPARXHA---hradDILTAIRIAEefGFNLVIEHGTE-  249
DSSP  lllllllllhhhhhHHHHHLLLLLEEEEE---llhhHHHHHHHHHHhhLLLEEEEELLL-


DSSP  lllllllHHHH---HHLLLEEEEEEhHHLLllllhhhhhhhhhhhhhllllllhhhhhlL
Query ggghapdIITA---CAHPNILPSSTnPTLPytlntidehldmlmvchhldpdiaedvafA  332
ident                |   |      | |                               
Sbjct -------AYKIskvLAEKKIPVVVG-PLLT---------------------------frT  274
DSSP  -------HHHHhhhHHHHLLLEEEL-LLLL---------------------------llL


DSSP  LLLLlhHHHHhhHHHHHLLL----LLEEELLLLlLLLLLLHHHHHHHHhHHHHhhhllll
Query ESRIrrETIAaeDVLHDLGA----FSLTSSDSQaMGRVGEVILRTWQVaHRMKvqrgala  388
ident                               |                   |         
Sbjct KLEL--KDLT--XETIAKLLkdgvLIALXCDHP-VIPLEFATVQAATA-XRYG-------  321
DSSP  LHHH--LLLL--LLHHHHHHhlllLEEELLLLL-LLLHHHHHHHHHHH-HHHL-------


DSSP  lllllllhhHHHHHHHLLLHHHHHHLLLLLLLLLLLLLLLLLEEEELhhHLLL----LLL
Query eetgdndnfRVKRYIAKYTINPALTHGIAHEVGSIEVGKLADLVVWSpaFFGV----KPA  444
ident                   | |||   |     |||| || |||||||             
Sbjct --------aKEEDLLKILTVNPAKILGLEDRIGSIEPGKDADLVVWS--GHPFdxksVVE  371
DSSP  --------lLHHHHHHLLLHHHHHHLLLLLLLLLLLLLLLLLEEEEL--LLLLllllLEE


DSSP  EEEELLEEEEEEEllllllllllllleeeelhhhlhhhhhhhleeeelhhhhhhlhhhhl
Query TVIKGGMIAIAPMgdinasiptpqpvhyrpmfgalgsarhhcrltflsqaaaangvaerl  504
ident  |   |                                                      
Sbjct RVYIDGVEVFRRE-----------------------------------------------  384
DSSP  EEEELLEEEEELL-----------------------------------------------


DSSP  lllleeeellllllllhhhllllllllleeelllllleeelleellllllllllllllll
Query nlrsaiavvkgcrtvqkadmvhnslqpnitvdaqtyevrvdgelitsepadvlpmaqryf  564
ident                                                             
Sbjct ------------------------------------------------------------  384
DSSP  ------------------------------------------------------------


DSSP  ll
Query lf  566
ident   
Sbjct --  384
DSSP  --


No 24: Query=1a5kC Sbjct=2uz9A Z-score=16.4

back to top
DSSP  leeehhhhhhhhlllllleeelllllleeelleellllllllllllllllllllllllll
Query snisrqayadmfgptvgdkvrladtelwieveddlttygeevkfgggkvirdgmgqgqml   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhhLLLEEEEeEEEEEL-----LEEEE-EEEEEE-LLEEEEEEL------EELLllllll
Query aadCVDLVLTnALIVDH-----WGIVK-ADIGVK-DGRIFAIGK------AGNPdiqpnv  107
ident               |                ||   | |                     
Sbjct ---PLAHIFR-GTFVHStwtcpMEVLRdHLLGVSdSGKIVFLEEasqqekLAKE------   50
DSSP  ---LLLEEEE-EEEEELlllllLEEEEeEEEEELlLLLEEEEEEhhhhhhHHHH------


DSSP  leELLLllEEEELL-LLEEEELEEEEEEELLL----------------------------
Query tiPIGAatEVIAAE-GKIVTAGGIDTHIHWIC----------------------------  138
ident         |            |  |||||                               
Sbjct --WCFKpcEIRELShHEFFMPGLVDTHIHASQysfagssidlpllewltkytfpaehrfq  108
DSSP  --HLLLhhHEEELLlLLEEEELEEEEEEEHHHhhhllllllllhhhhhhhlhhhhhhhhh


DSSP  ---------LLHHHHHHHHLEEEEEEELllllhhhhhlllLLHHHHHHHHHHHHLLLLLE
Query ---------PQQAEEALVSGVTTMVGGGtgpaagthattcTPGPWYISRMLQAADSLPVN  189
ident                 |  | ||                 |             |     
Sbjct nidfaeevyTRVVRRTLKNGTTTACYFA------------TIHTDSSLLLADITDKFGQR  156
DSSP  lhhhhhhhhHHHHHHHHHLLEEEEEEEL------------LLLHHHHHHHHHHHHHHLLE


DSSP  EEEEEELLL-------------lLHHHHHHHHHHL--------LLEEEE-EHHHLlLHHH
Query IGLLGKGNV-------------sQPDALREQVAAG--------VIGLEI-HEDWGaTPAA  227
ident                                |                            
Sbjct AFVGKVCMDlndtfpeyketteeSIKETERFVSEMlqknysrvKPIVTPrFSLSC-SETL  215
DSSP  EEEELEELLlllllllllllhhhHHHHHHHHHHHHhhhlllleEEEEEElLHHHL-LHHH


DSSP  HHHHHHHHHHHLLEEEEEL--------lLLLL---LLLH-HHHHHHHLLLL-EEELLLLl
Query IDCALTVADEMDIQVALHS--------dTLNE---SGFV-EDTLAAIGGRT-IHTFHTEg  274
ident        |   |     |            |                         |   
Sbjct MGELGNIAKTRDLHIQSHIsenrdeveaVKNLypsYKNYtSVYDKNNLLTNkTVMAHGC-  274
DSSP  HHHHHHHHHHHLLEEEEEElllhhhhhhHHHHlllLLLHhHHHHHLLLLLLlEEEEELL-


DSSP  lllllllLHHH-HHHL---LLEEEEEE-HHHLlllllhhhhhhhhhhhhhllllllhhhh
Query aggghapDIIT-ACAH---PNILPSST-NPTLpytlntidehldmlmvchhldpdiaedv  329
ident                             |  |                            
Sbjct -------YLSAeELNVfheRGASIAHCpNSNL----------------------------  299
DSSP  -------LLLHhHHHHhhhHLLEEEELhHHHH----------------------------


DSSP  hlllllllhhhHHHHhhHHHLLL----lLEEELLLLLLLLLL--LHHHHHHHHHHHHHHH
Query afaesrirretIAAEdvLHDLGA----fSLTSSDSQAMGRVG--EVILRTWQVAHRMKVQ  383
ident                                  |            | |   |       
Sbjct --------slsSGFL--NVLEVLkhevkIGLGTDVAGGYSYSmlDAIRRAVMVSNILLIN  349
DSSP  --------hllLLLL--LHHHHHhllleEEELLLLLLLLLLLhhHHHHHHHHHHHHHHHL


DSSP  --HLLLllllllllhhHHHHHHHLLLHHHHHHLLLLLLLLLLLLLLLLLEEEELHH----
Query --RGALaeetgdndnfRVKRYIAKYTINPALTHGIAHEVGSIEVGKLADLVVWSPA----  437
ident                   |      |       |   | |  ||||  |     |     
Sbjct kvNEKS---------lTLKEVFRLATLGGSQALGLDGEIGNFEVGKEFDAILINPKasds  400
DSSP  llLLLL---------lLHHHHHHHHLHHHHHHLLLLLLLLLLLLLLLLLEEEELLLllll


DSSP  -------------------HLLL-----LLLEEEELLEEEEEEEllllllllllllleee
Query -------------------FFGV-----KPATVIKGGMIAIAPMgdinasiptpqpvhyr  473
ident                     |           |  ||                       
Sbjct pidlfygdffgdiseaviqKFLYlgddrNIEEVYVGGKQVVPFS----------------  444
DSSP  llllllhhhhlllllhhhhHHHHhllhhHEEEEEELLEEEELLL----------------


DSSP  elhhhlhhhhhhhleeeelhhhhhhlhhhhllllleeeellllllllhhhllllllllle
Query pmfgalgsarhhcrltflsqaaaangvaerlnlrsaiavvkgcrtvqkadmvhnslqpni  533
ident                                                             
Sbjct ------------------------------------------------------------  444
DSSP  ------------------------------------------------------------


DSSP  eelllllleeelleellllllllllllllllll
Query tvdaqtyevrvdgelitsepadvlpmaqryflf  566
ident                                  
Sbjct ---------------------------------  444
DSSP  ---------------------------------


No 25: Query=1a5kC Sbjct=3cjpA Z-score=15.2

back to top
DSSP  leeehhhhhhhhlllllleeelllllleeelleellllllllllllllllllllllllll
Query snisrqayadmfgptvgdkvrladtelwieveddlttygeevkfgggkvirdgmgqgqml   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhhllleeeeeeeeeelleeeeeeeeeelleeeeeeleellllllllleellllleeeel
Query aadcvdlvltnalivdhwgivkadigvkdgrifaigkagnpdiqpnvtipigaateviaa  120
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  llleeeeLEEEEEEELLLL--LHHHHHHHHLEEEEEEE-LLLLL----------------
Query egkivtaGGIDTHIHWICP--QQAEEALVSGVTTMVGG-GTGPA----------------  161
ident          || | | | |           ||                            
Sbjct -------LIIDGHTHVILPveKHIKIMDEAGVDKTILFsTSIHPetavnlrdvkkemkkl   53
DSSP  -------LLEEEEEELLLLhhHHHHHHHHHLLLEEEEElLLLLHhhlllhhhhhhhhhhh


DSSP  ----hhhhhlllllHHHHHHHHHHHHLLLlLEEEEEEELLLL-----LHHHHHHHH-HHL
Query ----agthattctpGPWYISRMLQAADSLpVNIGLLGKGNVS-----QPDALREQV-AAG  211
ident                   |                 |   |            |      
Sbjct ndvvngktnsmidvRRNSIKELTNVIQAYpSRYVGFGNVPVGlsendTNSYIEENIvNNK  113
DSSP  hhhhlllllllhhhHHHHHHHHHHHHHHLlLLEEEEELLLLLllhhhHHHHHHHHLlLLL


DSSP  LLEEE-EEHHhlLLHHhHHHHHHHHHHHL-LEEEEEL---LLLLlllLHHHHHHHHLLL-
Query VIGLE-IHEDwgATPAaIDCALTVADEMD-IQVALHS---DTLNesgFVEDTLAAIGGR-  265
ident   |                                |      |                 
Sbjct LVGIGeLTPAsgQIKS-LKPIFKYSMDSGsLPIWIHAfnpLVLQ---DIKEIAELCKAFp  169
DSSP  LLEEEeELLLllLHHH-HHHHHHHHHHLLlLLEEELLlllLLHH---HHHHHHHHHHHLl


DSSP  --LEEELLLLLLlllllLLHHHHHH-LLLEEEEEEHHHLLLlllhhhhhhhhhhhhhlll
Query --TIHTFHTEGAggghaPDIITACA-HPNILPSSTNPTLPYtlntidehldmlmvchhld  322
ident        |  |                 |                               
Sbjct kvPVILGHMGGS---nwMTAVELAKeIQNLYLDTSAYFSTF-------------------  207
DSSP  llLEEEHHHHHH---hhHHHHHHHHhLLLEEEELLLLLLHH-------------------


DSSP  lllhhhhhlllllllhhhhhHHHHHHHLLL-LLEEELLLLLlLLLLLHHHHHHHHHHhhh
Query pdiaedvafaesrirretiaAEDVLHDLGA-FSLTSSDSQAmGRVGEVILRTWQVAHrmk  381
ident                                      |    |     |           
Sbjct --------------------VLKIVINELPlKCIFGTDMPF-GDLQLSIEAIKKMSN---  243
DSSP  --------------------HHHHHHHHLLlLEELLLLLLL-LLHHHHHHHHHHHLL---


DSSP  hhhlllllllllllhhHHHHHHHLLLHHHHHHLLLlllllllllllllleeeelhhhlll
Query vqrgalaeetgdndnfRVKRYIAKYTINPALTHGIahevgsievgkladlvvwspaffgv  441
ident                       |    |      |                         
Sbjct ----------------DSYVANAVLGDNISRLLNI-------------------------  262
DSSP  ----------------LHHHHHHHHLHHHHHHHLL-------------------------


DSSP  llleeeelleeeeeeellllllllllllleeeelhhhlhhhhhhhleeeelhhhhhhlhh
Query kpatvikggmiaiapmgdinasiptpqpvhyrpmfgalgsarhhcrltflsqaaaangva  501
ident                                                             
Sbjct ------------------------------------------------------------  262
DSSP  ------------------------------------------------------------


DSSP  hhllllleeeellllllllhhhllllllllleeelllllleeelleelllllllllllll
Query erlnlrsaiavvkgcrtvqkadmvhnslqpnitvdaqtyevrvdgelitsepadvlpmaq  561
ident                                                             
Sbjct ------------------------------------------------------------  262
DSSP  ------------------------------------------------------------


DSSP  lllll
Query ryflf  566
ident      
Sbjct -----  262
DSSP  -----


No 26: Query=1a5kC Sbjct=4rdvB Z-score=15.2

back to top
DSSP  leeehhhhhhhhlllllleeelllllleeelleellllllllllllllllllllllllll
Query snisrqayadmfgptvgdkvrladtelwieveddlttygeevkfgggkvirdgmgqgqml   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhhlllEEEEEEEEEELLEEEE-EEEEEEL-LEEEEE-ELEEllllllllleelllllEE
Query aadcvdLVLTNALIVDHWGIVK-ADIGVKD-GRIFAI-GKAGnpdiqpnvtipigaatEV  117
ident                   |            |    |   |                   
Sbjct ------SAIFAERALLPEGWARnVRFEISAdGVLAEIrPDAN--------------adGA   40
DSSP  ------LEEEEEEEEELLEEEEeEEEEELLlLLEEEEeLLLL--------------llLL


DSSP  EELlLLEEEELEEEEEEELL----------------------------------------
Query IAAeGKIVTAGGIDTHIHWI----------------------------------------  137
ident     |  |  |    | |                                          
Sbjct ERL-GGAVLPGMPNLHSHAFqramaglaevagnpndsfwtwrelmyrmvarlspeqievi   99
DSSP  EEL-LLLEEELEEEEEELHHhhhhlllllllllllllhhhhhhhhhhhhllllhhhhhhh


DSSP  LLLHHHHHHHHLEEEEEEElllllhhhhhlLLLL----------HHHHHHHHHHHHLLLL
Query CPQQAEEALVSGVTTMVGGgtgpaagthatTCTP----------GPWYISRMLQAADSLP  187
ident   |   | |  | |                                    |   ||    
Sbjct ACQLYIEMLKAGYTAVAEF-----------HYVHhdldgrsyadPAELSLRISRAASAAG  148
DSSP  HHHHHHHHHHHLEEEEEEE-----------ELLLllllllllllLLHHHHHHHHHHHHHL


DSSP  LEEEEEEELLL-----------------lLHHHHHHHHHHL---------lLEEEEE-HH
Query VNIGLLGKGNV-----------------sQPDALREQVAAG---------vIGLEIH-ED  220
ident     ||                          |  |                ||  |   
Sbjct IGLTLLPVLYShagfggqpasegqrrfinGSEAYLELLQRLrapleaaghsLGLCFHsLR  208
DSSP  LEEEEEELLLLeeellleellhhhlllllLHHHHHHHHHHHhhhhhhhlleELEEELlLL


DSSP  HLlLHHHHHHHHHHhHHHLLEEEEEL----lLLLL-----LLLH-HHHHHHhLLLL--EE
Query WGaTPAAIDCALTVaDEMDIQVALHS----dTLNE-----SGFV-EDTLAAiGGRT--IH  268
ident    ||  |   |      |  |  |                                   
Sbjct AV-TPQQIATVLAA-GHDDLPVHIHIaeqqkEVDDcqawsGRRPlQWLYEN-VAVDqrWC  265
DSSP  LL-LHHHHHHHHLL-LLLLLLEEEEElllhhHHHHhhhhhLLLHhHHHHHH-LLLLllEE


DSSP  ELLLLLlllllllLHHHHHHLLLEEEEEE-HHHLlllllhhhhhhhhhhhhhllllllhh
Query TFHTEGaggghapDIITACAHPNILPSST-NPTLpytlntidehldmlmvchhldpdiae  327
ident   |              | |                                        
Sbjct LVHATH----adpAEVAAMARSGAVAGLClSTEA--------------------------  295
DSSP  EEELLL----llhHHHHHHHHHLLEEEELhHHHH--------------------------


DSSP  hhhlllllllhhhHHHHhhHHHLLL----LLEEELLLlllLLLLLHHHHHHHHHHHHHH-
Query dvafaesrirretIAAEdvLHDLGA----FSLTSSDSqamGRVGEVILRTWQVAHRMKV-  382
ident                                   |||        |              
Sbjct ----------nlgDGIF--PATDFLaqggRLGIGSDS---HVSLSVVEELRWLEYGQRLr  340
DSSP  ----------hllLLLL--LHHHHHhlllEEEELLLL---LLLLLHHHHHHHHHHHHHHh


DSSP  HHLLL----LLLLllllhHHHHHHHHLLLHHHHHHLLLllLLLLLLLLLLLLEEEELHH-
Query QRGAL----AEETgdndnFRVKRYIAKYTINPALTHGIahEVGSIEVGKLADLVVWSPA-  437
ident  |                              |   |     ||  ||  ||| |     
Sbjct DRKRNrlyrDDQP-----MIGRTLYDAALAGGAQALGQ--PIGSLAVGRRADLLVLDGNd  393
DSSP  HLLLLllllLLLL-----LHHHHHHHHHHHHHHHHHLL--LLLLLLLLLLLLEEEELLLl


DSSP  -----------------hLLLL-LLEEEELLEEEEEEellllllllllllleEEELhhHL
Query -----------------fFGVK-PATVIKGGMIAIAPmgdinasiptpqpvhYRPMfgAL  479
ident                    |      |   |                      |      
Sbjct pylasaegdallnrwlfaGGDRqVRDVMVAGRWVVRD---------------GRHA--GE  436
DSSP  hhhhllllhhhhhhhhhhLLHHhEEEEEELLEEEELL---------------LLLL--LH


DSSP  HHhhhhhleeeelhhhhhhlhhhhllllleeeellllllllhhhllllllllleeellll
Query GSarhhcrltflsqaaaangvaerlnlrsaiavvkgcrtvqkadmvhnslqpnitvdaqt  539
ident                                                             
Sbjct ER----------------------------------------------------------  438
DSSP  HH----------------------------------------------------------


DSSP  lleeelleellllllllllllllllll
Query yevrvdgelitsepadvlpmaqryflf  566
ident                            
Sbjct --------------sarafvqvlgell  451
DSSP  --------------hhhhhhhhhhhhl


No 27: Query=1a5kC Sbjct=2ob3A Z-score=15.1

back to top
DSSP  leeehhhhhhhhlllllleeelllllleeelleellllllllllllllllllllllllll
Query snisrqayadmfgptvgdkvrladtelwieveddlttygeevkfgggkvirdgmgqgqml   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhhllleeeeeeeeeelleeeeeeeeeelleeeeeeleellllllllleellllleeeel
Query aadcvdlvltnalivdhwgivkadigvkdgrifaigkagnpdiqpnvtipigaateviaa  120
ident                                                             
Sbjct ----------------------------------------------------drintvrg    8
DSSP  ----------------------------------------------------lleeelle


DSSP  llleeeeLEEEEEEELL-----------------------LLLHHHHHHHHLEEEEEEel
Query egkivtaGGIDTHIHWI-----------------------CPQQAEEALVSGVTTMVGgg  157
ident        |   || |                                |   || | |   
Sbjct pitiseaGFTLTHEHICgssagflrawpeffgsrkalaekAVRGLRRARAAGVRTIVD--   66
DSSP  eelhhhhLLEEEEELLEellllhhhhlhhhhllhhhhhhhHHHHHHHHHHLLLLEEEE--


DSSP  llllhhhhhlLLLLhhhHHHHHHHH-HLLLLLEEEEEEELL------------lLLHHHH
Query tgpaagthatTCTPgpwYISRMLQA-ADSLPVNIGLLGKGN------------vSQPDAL  204
ident             |         |        | |                          
Sbjct ----------VSTFdigRDVSLLAEvSRAADVHIVAATGLWfdpplsmrlrsveELTQFF  116
DSSP  ----------LLLHhhlLLHHHHHHhHHHHLLEEELEEELLllllhhhhlllhhHHHHHH


DSSP  HHHHH-------HLLLEEEEEHH---hllLHHHHHHHHHHHHHHLLEEEEELLLLLlllL
Query REQVA-------AGVIGLEIHED---wgaTPAAIDCALTVADEMDIQVALHSDTLNesgF  254
ident                                     |          |  |         
Sbjct LREIQygiedtgIRAGIIXVATTgkatpfQELVLKAAARASLATGVPVTTHTAASQ--rD  174
DSSP  HHHHHlllllllLLLLEEEEELLllllhhHHHHHHHHHHHHHHHLLLEEEELLHHH--lH


DSSP  HHHHHHHH--LLLL---EEELLLLLLlllllLLHH-HHHHLLlEEEEE-EHHHllllllH
Query VEDTLAAI--GGRT---IHTFHTEGAggghaPDII-TACAHPnILPSS-TNPTlpytlnT  307
ident  |   |     |         |                 |    |      |        
Sbjct GEQQAAIFesEGLSpsrVCIGHSDDT---ddLSYLtALAARG-YLIGLdHIPY-----sA  225
DSSP  HHHHHHHHhhLLLLhhhEEELLHHHL---llHHHHhHHHHLL-LEEEElLLLL-----lL


DSSP  HHH----hHHHHhhhhllllllhhhhhllllLLLH-hHHHHH-HHHHHLLLL--LEEELL
Query IDE----hLDMLmvchhldpdiaedvafaesRIRR-eTIAAE-DVLHDLGAF--SLTSSD  359
ident |          |                    ||   | |     | | |     | | |
Sbjct IGLednasASAL------------------lGIRSwqTRALLiKALIDQGYMkqILVSND  267
DSSP  LLLlllhhHHHH------------------hLLLLhhHHHHHhHHHHHLLLHhhEEELLL


DSSP  LL-----------------lllLLLLHH-HHHHHHHHHHhhhhlllllllllllhhHHHH
Query SQ-----------------amgRVGEVI-LRTWQVAHRMkvqrgalaeetgdndnfRVKR  401
ident                                                             
Sbjct WTfgfssyvtnimdvmdrvnpdGMAFIPlRVIPFLREKG----------------vPQET  311
DSSP  LLleellllllhhhhhhhhlllHHHHHHhLHHHHHHHLL----------------lLHHH


DSSP  HHHLLLHHHHHHLLllllllllllllllleeeelhhhlllllleeeelleeeeeeellll
Query YIAKYTINPALTHGiahevgsievgkladlvvwspaffgvkpatvikggmiaiapmgdin  461
ident        |||                                                  
Sbjct LAGITVTNPARFLS----------------------------------------------  325
DSSP  HHHHHLHHHHHHHL----------------------------------------------


DSSP  llllllllleeeelhhhlhhhhhhhleeeelhhhhhhlhhhhllllleeeellLLLLllh
Query asiptpqpvhyrpmfgalgsarhhcrltflsqaaaangvaerlnlrsaiavvkGCRTvqk  521
ident                                                             
Sbjct -----------------------------------------------------PTLR---  329
DSSP  -----------------------------------------------------LLLL---


DSSP  hhllllllllleeelllllleeelleellllllllllllllllll
Query admvhnslqpnitvdaqtyevrvdgelitsepadvlpmaqryflf  566
ident                                              
Sbjct ---------------------------------------------  329
DSSP  ---------------------------------------------


No 28: Query=1a5kC Sbjct=3k2gB Z-score=14.3

back to top
DSSP  leeehhhhhhhhlllllleeelllllleeelleellllllllllllllllllllllllll
Query snisrqayadmfgptvgdkvrladtelwieveddlttygeevkfgggkvirdgmgqgqml   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhhllleeeeeeeeeelleeeeeeeeeelleeeeeeleellllllllleellllleeeel
Query aadcvdlvltnalivdhwgivkadigvkdgrifaigkagnpdiqpnvtipigaateviaa  120
ident                                                             
Sbjct ----------------------------------------slselspchvrsgrixtvdg   20
DSSP  ----------------------------------------llllllllllllleeeelle


DSSP  llleeeeLEEEEEEELL-------------------------------------------
Query egkivtaGGIDTHIHWI-------------------------------------------  137
ident        |    | |                                             
Sbjct pipssalGHTLXHEHLQndcrcwwnppqeperqylaeapisieilselrqdpfvnkhnia   80
DSSP  eeehhhlLLEELLLLLLeelhhhllllllhhhhhhhhllllhhhhhhhhllhhhllllle


DSSP  ------LLLHHHHHHHHLEEEEEEelllllhhhhhlLLLLhhhHHHHHHHH-HLLLLLEE
Query ------CPQQAEEALVSGVTTMVGggtgpaagthatTCTPgpwYISRMLQA-ADSLPVNI  190
ident                  |    |                         |        |  
Sbjct lddldlAIAEVKQFAAVGGRSIVD------------PTCRgigRDPVKLRRiSAETGVQV  128
DSSP  ellhhhHHHHHHHHHHLLLLEEEE------------LLLLlllLLHHHHHHhHHHHLLEE


DSSP  EEEEELL-------------LLLH-HHHHHHHH-------HLLLEEE-EEHH---hllLH
Query GLLGKGN-------------VSQP-DALREQVA-------AGVIGLE-IHED---wgaTP  225
ident                          |              |       |           
Sbjct VXGAGYYlassxpetaarlsADDIaDEIVAEALegtdgtdARIGLIGeIGVSsdftaeEE  188
DSSP  EELLLLLlhhhllhhhhlllHHHHhHHHHHHHHlllllllLLLLLEEeELLLllllhhHH


DSSP  HHHHHHHHHHHHHLLEEEEELLLLLlllLHHHHHHHH---LLLL--EEELLLLLllllll
Query AAIDCALTVADEMDIQVALHSDTLNesgFVEDTLAAI---GGRT--IHTFHTEGagggha  280
ident      |             |             |      |         |         
Sbjct KSLRGAARAQVRTGLPLXVHLPGWF--rLAHRVLDLVeeeGADLrhTVLCHXNP--shxd  244
DSSP  HHHHHHHHHHHHHLLLEEELLLLLL--lLHHHHHHHHhhlLLLHhhEEELLLHH--hlll


DSSP  lLHHH-HHHLlLEEEEE-EHHHllllllhhhHHHHhhhhhhllllllhhhHHLLlLLLLh
Query pDIIT-ACAHpNILPSS-TNPTlpytlntidEHLDmlmvchhldpdiaedVAFAeSRIRr  338
ident                                                             
Sbjct pVYQAtLAQR-GAFLEFdXIGX---------DFFY---------------ADQG-VQCP-  277
DSSP  hHHHHhHHHH-LLEEEElLLLL---------LLEE---------------LLLL-EELL-


DSSP  hHHHHHHHHHHLLL------lLEEELLLLL--------llLLLLHHHHHHHHHHHHHhhh
Query eTIAAEDVLHDLGA------fSLTSSDSQA--------mgRVGEVILRTWQVAHRMKvqr  384
ident              |        | | |                 |         |     
Sbjct -SDDEVARAILGLAdhgyldrILLSHDVFVkxxltryggnGYAFVTKHFLPRLRRHG---  333
DSSP  -LHHHHHHHHHHHHhlllhhhEEELLLLLLhhhlhhhlllLLLHHHHLHHHHHHHLL---


DSSP  lllllllllllhhHHHHHHHLLLHHHHHHLLllllllllllllllleeeelhhhllllll
Query galaeetgdndnfRVKRYIAKYTINPALTHGiahevgsievgkladlvvwspaffgvkpa  444
ident                         ||                                  
Sbjct ------------lDDAALETLXVTNPRRVFD-----------------------------  352
DSSP  ------------lLHHHHHHHHLHHHHHHHL-----------------------------


DSSP  eeeelleeeeeeellllllllllllleeeelhhhlhhhhhhhleeeelhhhhhhlhhhhl
Query tvikggmiaiapmgdinasiptpqpvhyrpmfgalgsarhhcrltflsqaaaangvaerl  504
ident                                                             
Sbjct ------------------------------------------------------------  352
DSSP  ------------------------------------------------------------


DSSP  lllleeeellllllllhHHLLllllllleeelllllleeelleellllllllllllllll
Query nlrsaiavvkgcrtvqkADMVhnslqpnitvdaqtyevrvdgelitsepadvlpmaqryf  564
ident                                                             
Sbjct ---------------asIEGH---------------------------------------  358
DSSP  ---------------llLLLL---------------------------------------


DSSP  ll
Query lf  566
ident   
Sbjct --  358
DSSP  --


No 29: Query=1a5kC Sbjct=2y1hB Z-score=14.2

back to top
DSSP  leeehhhhhhhhlllllleeelllllleeelleellllllllllllllllllllllllll
Query snisrqayadmfgptvgdkvrladtelwieveddlttygeevkfgggkvirdgmgqgqml   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhhllleeeeeeeeeelleeeeeeeeeelleeeeeeleellllllllleellllleeeel
Query aadcvdlvltnalivdhwgivkadigvkdgrifaigkagnpdiqpnvtipigaateviaa  120
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  llleeEELEEEEEEELL-------LLLHHHHHHHHLEEEEEEElllllhhhhhllLLLHH
Query egkivTAGGIDTHIHWI-------CPQQAEEALVSGVTTMVGGgtgpaagthattCTPGP  173
ident        |  | | |              | |    |   |                   
Sbjct -----GVGLVDCHCHLSapdfdrdLDDVLEKAKKANVVALVAV------------AEHSG   43
DSSP  -----LLLEEEEEELLLlhhhlllHHHHHHHHHHLLEEEEEEL------------LLLHH


DSSP  hHHHHHHHHHLLLlLEEEEEEELL-----------llLHHHHHHHHHHL---LLEE-EEE
Query wYISRMLQAADSLpVNIGLLGKGN-----------vsQPDALREQVAAG---VIGL-EIH  218
ident        |                               |                 |  
Sbjct -EFEKIMQLSERYnGFVLPCLGVHpvqgldqrsvtlkDLDVALPIIENYkdrLLAIgEVG  102
DSSP  -HHHHHHHHHHHLlLLEEEEELLLleelllleellhhHHHHHHHHHHHHlllLLEEeEEE


DSSP  HH-----------hllLHHHHHHHHHHHHHHLLEEEEELLLlllllLHHHHHHHH--LLL
Query ED-----------wgaTPAAIDCALTVADEMDIQVALHSDTlnesgFVEDTLAAI--GGR  265
ident  |                         |      |  ||           |       | 
Sbjct LDfsprfagtgeqkeeQRQVLIRQIQLAKRLNLPVNVHSRS-----AGRPTINLLqeQGA  157
DSSP  EEllllllllhhhhhhHHHHHHHHHHHHHHHLLLEEEEEEL-----LHHHHHHHHhhLLL


DSSP  L-EEELLLLLlllllllLHHH-HHHLLlEEEEEEHhHLLLlllhhhhhhhhhhhhhllll
Query T-IHTFHTEGaggghapDIIT-ACAHPnILPSSTNpTLPYtlntidehldmlmvchhldp  323
ident          |                     |                            
Sbjct EkVLLHAFDG-----rpSVAMeGVRAG-YFFSIPP-SIIR--------------------  190
DSSP  LlEEEELLLL-----lhHHHHhHHHLL-LEEEELH-HHHL--------------------


DSSP  llhhhhhlllllllhHHHHHHHHHHhLLLLLEEELLLLLL-------LLLLLHHHHHHHH
Query diaedvafaesrirrETIAAEDVLHdLGAFSLTSSDSQAM-------GRVGEVILRTWQV  376
ident                                    || |                     
Sbjct --------------sGQKQKLVKQL-PLTSICLETDSPALgpekqvrNEPWNISISAEYI  235
DSSP  --------------lHHHHHHHHHL-LHHHEEELLLLLLLlllllllLLHHHHHHHHHHH


DSSP  HHHHHhhhlllllllllllhHHHHHHHHLlLHHHHHHLL-LLLLLlllllllllleeeel
Query AHRMKvqrgalaeetgdndnFRVKRYIAKyTINPALTHG-IAHEVgsievgkladlvvws  435
ident |                             | |         |                 
Sbjct AQVKG--------------iSVEEVIEVT-TQNALKLFPkLRHLL---------------  265
DSSP  HHHHL--------------lLHHHHHHHH-HHHHHHHLLlHHHHL---------------


DSSP  hhhlllllleeeelleeeeeeellllllllllllleeeelhhhlhhhhhhhleeeelhhh
Query paffgvkpatvikggmiaiapmgdinasiptpqpvhyrpmfgalgsarhhcrltflsqaa  495
ident                                                             
Sbjct ------------------------------------------------------------  265
DSSP  ------------------------------------------------------------


DSSP  hhhlhhhhllllleeeellllllllhhhllllllllleeelllllleeelleelllllll
Query aangvaerlnlrsaiavvkgcrtvqkadmvhnslqpnitvdaqtyevrvdgelitsepad  555
ident                                                             
Sbjct ------------------------------------------------------------  265
DSSP  ------------------------------------------------------------


DSSP  lllllllllll
Query vlpmaqryflf  566
ident            
Sbjct -----------  265
DSSP  -----------


No 30: Query=1a5kC Sbjct=1bf6A Z-score=13.9

back to top
DSSP  leeehhhhhhhhlllllleeelllllleeelleellllllllllllllllllllllllll
Query snisrqayadmfgptvgdkvrladtelwieveddlttygeevkfgggkvirdgmgqgqml   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhhllleeeeeeeeeelleeeeeeeeeelleeeeeeleellllllllleellllleeeel
Query aadcvdlvltnalivdhwgivkadigvkdgrifaigkagnpdiqpnvtipigaateviaa  120
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  llleeeELEEEEEEELL-------------------LLLHHHHHHHHLEEEEEEelllll
Query egkivtAGGIDTHIHWI-------------------CPQQAEEALVSGVTTMVGggtgpa  161
ident        |    | |                       |        ||           
Sbjct --sfdpTGYTLAHEHLHidlsgfknnvdcrldqyafICQEMNDLMTRGVRNVIE------   52
DSSP  --llllLLEEEEEELLLeelhhhhllhhheellhhhHHHHHHHHHHLLEEEEEE------


DSSP  hhhhhlLLLLHhhHHHHHHHH-HLLLLLEEEEEEELL--------------llLHHHHHH
Query agthatTCTPGpwYISRMLQA-ADSLPVNIGLLGKGN--------------vsQPDALRE  206
ident                             |                               
Sbjct ------MTNRYmgRNAQFMLDvMRETGINVVACTGYYqdaffpehvatrsvqeLAQEMVD  106
DSSP  ------LLLHHhlLLHHHHHHhHHHHLLEEEEEELLLlhhhlllhhhhllhhhHHHHHHH


DSSP  HHHH-------LLLEEE-EEHH----hllLHHHHHHHHHHHHHHLLEEEEELLLlllllL
Query QVAA-------GVIGLE-IHED----wgaTPAAIDCALTVADEMDIQVALHSDTlnesgF  254
ident                   |                 |             |         
Sbjct EIEQgidgtelKAGIIAeIGTSegkitplEEKVFIAAALAHNQTGRPISTHTSF---stM  163
DSSP  HHHLlllllllLEEEEEeEELLlllllhhHHHHHHHHHHHHHHHLLLEEEELHH---hlL


DSSP  HHHHHHHH---LLLL--EEELLLLLLlllllLLHH-HHHHLLlEEEEE-EHHHllllllh
Query VEDTLAAI---GGRT--IHTFHTEGAggghaPDII-TACAHPnILPSS-TNPTlpytlnt  307
ident     ||     |         |          | |              |          
Sbjct GLEQLALLqahGVDLsrVTVGHCDLK---dnLDNIlKMIDLG-AYVQFdTIGK-------  212
DSSP  HHHHHHHHhhlLLLHhhEEELLLLLL---llHHHHhHHHHLL-LEEEElLLLL-------


DSSP  hhhhhhhhhhhhllllllhhhhhllllLLLHhhHHHHHHHHHLL------lLLEEELLLL
Query idehldmlmvchhldpdiaedvafaesRIRRetIAAEDVLHDLG------aFSLTSSDSQ  361
ident                                                        | |  
Sbjct --------------------------nSYYP--DEKRIAMLHALrdrgllnRVMLSMDIT  244
DSSP  --------------------------lLLLL--HHHHHHHHHHHhhlllhhHEEELLLLL


DSSP  L--------llLLLLHH-HHHHHHHHHHhhhhlllllllllllhhHHHHHHHLLLHHHHH
Query A--------mgRVGEVI-LRTWQVAHRMkvqrgalaeetgdndnfRVKRYIAKYTINPAL  412
ident                       |                                 ||  
Sbjct RrshlkanggyGYDYLLtTFIPQLRQSG----------------fSQADVDVMLRENPSQ  288
DSSP  LhhhlhhhlllLLLHHHhLHHHHHHHLL----------------lLHHHHHHHHLHHHHH


DSSP  HLLllllllllllllllleeeelhhhlllllleeeelleeeeeeelllllllllllllee
Query THGiahevgsievgkladlvvwspaffgvkpatvikggmiaiapmgdinasiptpqpvhy  472
ident                                                             
Sbjct FFQ---------------------------------------------------------  291
DSSP  HLL---------------------------------------------------------


DSSP  eelhhhlhhhhhhhleeeelhhhhhhlhhhhllllleeeellllllllhhhlllllllll
Query rpmfgalgsarhhcrltflsqaaaangvaerlnlrsaiavvkgcrtvqkadmvhnslqpn  532
ident                                                             
Sbjct ------------------------------------------------------------  291
DSSP  ------------------------------------------------------------


DSSP  eeelllllleeelleellllllllllllllllll
Query itvdaqtyevrvdgelitsepadvlpmaqryflf  566
ident                                   
Sbjct ----------------------------------  291
DSSP  ----------------------------------


No 31: Query=1a5kC Sbjct=3irsA Z-score=13.8

back to top
DSSP  leeehhhhhhhhlllllleeelllllleeelleellllllllllllllllllllllllll
Query snisrqayadmfgptvgdkvrladtelwieveddlttygeevkfgggkvirdgmgqgqml   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhhllleeeeeeeeeelleeeeeeeeeelleeeeeeleellllllllleellllleeeel
Query aadcvdlvltnalivdhwgivkadigvkdgrifaigkagnpdiqpnvtipigaateviaa  120
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  llleeeELEEEEEEELL-----------------------------------LLLHHHHH
Query egkivtAGGIDTHIHWI-----------------------------------CPQQAEEA  145
ident          ||                                              || 
Sbjct ------LKIIDFRLRPPamgflnariytrpdirnrftrqlgfepapsaeeksLELMFEEM   54
DSSP  ------LLLEELLLLLLlhhhhhlhhhhlhhhhhhhhhhhlllllhhhhhllHHHHHHHH


DSSP  HHHLEEEEEEEL--lllLHHHhhlllllHHHHHHHHHHHHLlllLEEEEEEELLL----l
Query LVSGVTTMVGGG--tgpAAGThattctpGPWYISRMLQAADslpVNIGLLGKGNV----s  199
ident    |    |  |                          |           |         
Sbjct AAAGIEQGVCVGrnssvLGSV-------SNADVAAVAKAYP---DKFHPVGSIEAatrke  104
DSSP  HHLLLLEEEEELleellLEEL-------LHHHHHHHHHHLL---LLEEEEEELLLllhhh


DSSP  LHHHHHHHHHHLLLEEEEEHHH----LLLHH-hHHHHHHHHHHHLLEEEEEL---LLLLL
Query QPDALREQVAAGVIGLEIHEDW----GATPA-aIDCALTVADEMDIQVALHS---DTLNE  251
ident       |    |                                 | |            
Sbjct AMAQMQEILDLGIRIVNLEPGVwatpMHVDDrrLYPLYAFCEDNGIPVIMMTggnAGPDI  164
DSSP  HHHHHHHHHHLLLLLEEELHHHllllLLLLLhhHHHHHHHHHHLLLLEEEELlllLLLLH


DSSP  L-lLHHHHHHHHLL---LLEEELLLLLLlllllLLHHHHHH-LLLEEEEEEHHHLLLlll
Query S-gFVEDTLAAIGG---RTIHTFHTEGAggghaPDIITACA-HPNILPSSTNPTLPYtln  306
ident      |      |     |    |           ||      ||   |           
Sbjct TytNPEHIDRVLGDfpdLTVVSSHGNWP---wvQEIIHVAFrRPNLYLSPDMYLYNL---  218
DSSP  HhhLHHHHHHHHHHlllLLEEEEHHHLL---lhHHHHHHHHhLLLEEEELHHHHLLL---


DSSP  hhhhhhhhhhhhhllllllhhhhhlllllllhHHHHHHHHHHHLLL--LLEEELLLLLlL
Query tidehldmlmvchhldpdiaedvafaesrirrETIAAEDVLHDLGA--FSLTSSDSQAmG  364
ident                                    |              |         
Sbjct --------------------------------PGHADFIQAANSFLadRMLFGTAYPM-C  245
DSSP  --------------------------------LLHHHHHHHHLLHHhhLLLLLLLLLL-L


DSSP  LLLLHHHHHHHHHhhhhhhhlllllllllllhhHHHHHHHLLLHHHHHHLLlllllllll
Query RVGEVILRTWQVAhrmkvqrgalaeetgdndnfRVKRYIAKYTINPALTHGiahevgsie  424
ident    |                                        |               
Sbjct PLKEYTEWFLTLP-------------------iKPDAMEKILHGNAERLLA---------  277
DSSP  LHHHHHHHHHLLL-------------------lLHHHHHHHHLHHHHHHHH---------


DSSP  lllllleeeelhhhlllllleeeelleeeeeeellllllllllllleeeelhhhlhhhhh
Query vgkladlvvwspaffgvkpatvikggmiaiapmgdinasiptpqpvhyrpmfgalgsarh  484
ident                                                             
Sbjct ------------------------------------------------------------  277
DSSP  ------------------------------------------------------------


DSSP  hhleeeelhhhhhhlhhhhllllleeeellLLLLllhhhllllllllleeelllllleee
Query hcrltflsqaaaangvaerlnlrsaiavvkGCRTvqkadmvhnslqpnitvdaqtyevrv  544
ident                                                             
Sbjct ------------------------------QAGR--------------------------  281
DSSP  ------------------------------HLLL--------------------------


DSSP  lleellllllllllllllllll
Query dgelitsepadvlpmaqryflf  566
ident                       
Sbjct ----------------------  281
DSSP  ----------------------


No 32: Query=1a5kC Sbjct=2qpxA Z-score=13.8

back to top
DSSP  leeehhhhhhhhlllllleeELLLllleeelleellllllllllllllllllllllllll
Query snisrqayadmfgptvgdkvRLADtelwieveddlttygeevkfgggkvirdgmgqgqml   60
ident                      |                                      
Sbjct -----------------gxdDLSE------------------------------------    7
DSSP  -----------------lllLLHH------------------------------------


DSSP  hhhllleeeeeeeeeelleeeeeeeeeelleeeeeeleellllllllleellllleeeel
Query aadcvdlvltnalivdhwgivkadigvkdgrifaigkagnpdiqpnvtipigaateviaa  120
ident                                                             
Sbjct ------------------------------------------------------------    7
DSSP  ------------------------------------------------------------


DSSP  llleeEELEEEEEEELLL------------------------------------------
Query egkivTAGGIDTHIHWIC------------------------------------------  138
ident           | | |                                             
Sbjct --fvdQVPLLDHHCHFLIdgkvpnrddrlaqvsteadkdypladtknrlayhgflalake   65
DSSP  --hhhHLLEEEEEELLLLllllllhhhhhhhhlllllllllhhhhlllhhhhhhhhhhhh


DSSP  ------------------lLHHHHHHHHLEEEEEEEL-LLLLhhhhhlllllhhhhhhHH
Query ------------------pQQAEEALVSGVTTMVGGG-TGPAagthattctpgpwyisRM  179
ident                                         |                   
Sbjct faldannplaaxndpgyatYNHRIFGHFHFKELLIDTgFVPD-------------dpiLD  112
DSSP  hllllllllllllhhhhhhHHHHHHHHLLEEEEEEELlLLLL-------------lllLL


DSSP  HHHH-LLLLLEEEEEEELL-----------------llLHHHHHHHHHHLLLEEEEE-HH
Query LQAA-DSLPVNIGLLGKGN-----------------vsQPDALREQVAAGVIGLEIH-ED  220
ident |                                              | |  |       
Sbjct LDQTaELVGIPVKAIYRLEthaedfxlehdnfaawwqaFSNDVKQAKAHGFVGFXSIaAY  172
DSSP  HHHHhHHHLLLEEEEEEHHhhhhhhhlllllhhhhhhhHHHHHHLLLLLLLLLEEELhHH


DSSP  HL-------------------------------lLHHHHHHHHHHHHHHLLEEEEEL---
Query WG-------------------------------aTPAAIDCALTVADEMDIQVALHS---  246
ident                                                  |     |    
Sbjct RVglhlepvnvieaaagfdtwkhsgekrltskplIDYXLYHVAPFIIAQDXPLQFHVgyg  232
DSSP  HLllllllllhhhhhhhhhhhhhhlllllllhhhHHHHHHHHHHHHHHHLLLEEEEElll


DSSP  ----LLLL-lllLHHHHHHHHLL--LLEEELLLLLLllllllLHHHHHH-LLLEEEEEEH
Query ----DTLN-esgFVEDTLAAIGG--RTIHTFHTEGAggghapDIITACA-HPNILPSSTN  298
ident     |          | | |           |                   ||       
Sbjct dadtDXYLgnplLXRDYLKAFTKkgLKVVLLHCYPY----hrEAGYLASvFPNLYFDISL  288
DSSP  llllLHHHllhhHHHHHHHHHHHhlLLEEEEELLLL----hhHHHHHHHhLLLEEEELLL


DSSP  H------HLLLlllhhhhhhhhhhhhhllllllhhhhhlllllllhhhhhhHHHHHH---
Query P------TLPYtlntidehldmlmvchhldpdiaedvafaesrirretiaaEDVLHD---  349
ident                                                             
Sbjct LdnlgpsGASR----------------------------------------VFNEAVela  308
DSSP  HhhhlhhHHHH----------------------------------------HHHHHLlll


DSSP  lLLLLEEELLLL-lllLLLLHHHHHHHHHHHHHHhhLLLLLLllllLHHHHHHHHHLLLH
Query lGAFSLTSSDSQ-amgRVGEVILRTWQVAHRMKVqrGALAEEtgdnDNFRVKRYIAKYTI  408
ident      |  ||        |       |                            |    
Sbjct pYTRILFASDAStypeXYGLAARQFKQALVAHFN--QLPFVD----LAQKKAWINAICWQ  362
DSSP  lHHHEELLLLLLllhhHHHHHHHHHHHHHHHHHH--LLLLLL----HHHHHHHHHHHHLH


DSSP  HHHHHLLLLlLLLLLllllllleeeelhhhlllllleeeelleeeeeeelllllllllll
Query NPALTHGIAhEVGSIevgkladlvvwspaffgvkpatvikggmiaiapmgdinasiptpq  468
ident   |                                                         
Sbjct TSAKLYHQE-RELRV---------------------------------------------  376
DSSP  HHHHHLLLH-HHHLL---------------------------------------------


DSSP  lleeeelhhhlhhhhhhhleeeelhhhhhhlhhhhllllleeeellllllllhhhlllll
Query pvhyrpmfgalgsarhhcrltflsqaaaangvaerlnlrsaiavvkgcrtvqkadmvhns  528
ident                                                             
Sbjct ------------------------------------------------------------  376
DSSP  ------------------------------------------------------------


DSSP  lllleeelllllleeelleellllllllllllllllll
Query lqpnitvdaqtyevrvdgelitsepadvlpmaqryflf  566
ident                                       
Sbjct --------------------------------------  376
DSSP  --------------------------------------


No 33: Query=1a5kC Sbjct=4mupB Z-score=13.5

back to top
DSSP  leeehhhhhhhhlllllleeelllllleeelleellllllllllllllllllllllllll
Query snisrqayadmfgptvgdkvrladtelwieveddlttygeevkfgggkvirdgmgqgqml   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhhllleeeeeeeeeelleeeeeeeeeelleeeeeeleellllllllleellllleeeel
Query aadcvdlvltnalivdhwgivkadigvkdgrifaigkagnpdiqpnvtipigaateviaa  120
ident                                                             
Sbjct ---------------------------------------------------lvrklsgta    9
DSSP  ---------------------------------------------------lllllllll


DSSP  llleeEELEEEEEEEL-------------------LLLL-HHHHHHHHLEEEEEEELlll
Query egkivTAGGIDTHIHW-------------------ICPQ-QAEEALVSGVTTMVGGGtgp  160
ident        |  ||  |                      |          |           
Sbjct pnpafPRGAVDTQMHMylpgypalpggpglppgalPGPEdYRRLMQWLGIDRVIITQ--g   67
DSSP  lllllLLLLEELLLLLlllllllllllllllllllLLHHhHHHHHHHHLLLEEEEEL--l


DSSP  LHHHhhllllLHHHHHHHHHHHHLllllEEEEEEELlLLLHH--HHHHHHHHLLLEEEEE
Query AAGThattctPGPWYISRMLQAADslpvNIGLLGKGnVSQPD--ALREQVAAGVIGLEIH  218
ident  |                                                |||  |  | 
Sbjct NAHQ------RDNGNTLACVAEMG---eAAHAVVII-DATTTekDMEKLTAAGTVGARIM  117
DSSP  HHHL------LLLHHHHHHHHHHH---hHEEEEELL-LLLLLhhHHHHHHHLLEEEEEEE


DSSP  H---HHLLLHhHHHHHHHHHHHHLLEEEEELLLLLlllLHHHHHHHHlLLLEEELLLLLL
Query E---DWGATPaAIDCALTVADEMDIQVALHSDTLNesgFVEDTLAAIgGRTIHTFHTEGA  275
ident              |     |   |  ||   |           |  |        |    
Sbjct DlpgGAVNLS-ELDAVDERAHAADWMVAVQFDGNG-llDHLPRLQKI-RSRWVFDHHGKF  174
DSSP  LlllLLLLHH-HHHHHHHHHHHLLLEEEEELLHHH-hhHHHHHHHLL-LLEEEELHHHHL


DSSP  ------lllllllhhHHHHLLLEEEEEEHHHllllllHHHHHhhhhhhhhllllllhhhh
Query ------ggghapdiiTACAHPNILPSSTNPTlpytlnTIDEHldmlmvchhldpdiaedv  329
ident                      |                                      
Sbjct fkgirtdgpemaallKLIDRGNLWFKFAGVY----esSRKSW------------------  212
DSSP  llllllllhhhhhhhHHHHHLLEEEEELLHH----hlLLLLL------------------


DSSP  hlllllllHHHHHHHHHHHHLLL-LLEEELLLLLL--------llLLLHHHHHHHHHhhh
Query afaesrirRETIAAEDVLHDLGA-FSLTSSDSQAM--------grVGEVILRTWQVAhrm  380
ident             |   |                                   |       
Sbjct ------pyADVAAFSRVIAAHAPeRIVWGTNWPHNsvretaaypdDARLAELTLGWL---  263
DSSP  ------llHHHHHHHHHHHHHLHhHEEELLLLLLLllllhhhlllHHHHHHHHHLLL---


DSSP  hhhhlllllllllllhhHHHHHHHLLLHHHHHHLLLLLLllllllllllleeeelhhhll
Query kvqrgalaeetgdndnfRVKRYIAKYTINPALTHGIAHEvgsievgkladlvvwspaffg  440
ident                             ||                              
Sbjct ----------------pDEAARHRALVENPEALFKLSPV---------------------  286
DSSP  ----------------lLHHHHHHHHLHHHHHHHLLLLL---------------------


DSSP  lllleeeelleeeeeeellllllllllllleeeelhhhlhhhhhhhleeeelhhhhhhlh
Query vkpatvikggmiaiapmgdinasiptpqpvhyrpmfgalgsarhhcrltflsqaaaangv  500
ident                                                             
Sbjct ------------------------------------------------------------  286
DSSP  ------------------------------------------------------------


DSSP  hhhllllleeeellllllllhhhllllllllleeelllllleeelleellllllllllll
Query aerlnlrsaiavvkgcrtvqkadmvhnslqpnitvdaqtyevrvdgelitsepadvlpma  560
ident                                                             
Sbjct ------------------------------------------------------------  286
DSSP  ------------------------------------------------------------


DSSP  llllll
Query qryflf  566
ident       
Sbjct ------  286
DSSP  ------


No 34: Query=1a5kC Sbjct=2vc5A Z-score=13.5

back to top
DSSP  leeehhhhhhhhlllllleeelllllleeelleellllllllllllllllllllllllll
Query snisrqayadmfgptvgdkvrladtelwieveddlttygeevkfgggkvirdgmgqgqml   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhhllleeeeeeeeeelleeeeeeeeeelleeeeeeleellllllllleellllleeeel
Query aadcvdlvltnalivdhwgivkadigvkdgrifaigkagnpdiqpnvtipigaateviaa  120
ident                                                             
Sbjct ---------------------------------------------------mriplvgkd    9
DSSP  ---------------------------------------------------lllllllll


DSSP  llleeeeLEEEEEEELL----------------------LLLHHHHHHHHLEEEEEEell
Query egkivtaGGIDTHIHWI----------------------CPQQAEEALVSGVTTMVGggt  158
ident        |    | |                               |   || | |    
Sbjct sieskdiGFTLIHEHLRvfseavrqqwphlynedeefrnAVNEVKRAMQFGVKTIVD---   66
DSSP  lllhhhlLLEELLLLLLlllhhhhhhlhhhllhhhhhhhHHHHHHHHHHLLLLEEEE---


DSSP  lllhhhhhlLLLL-hhhHHHHHHHHHLLLLLEEEEEEELL--------------llLHHH
Query gpaagthatTCTP-gpwYISRMLQAADSLPVNIGLLGKGN--------------vsQPDA  203
ident                   |  |         |                          | 
Sbjct ---------PTVMglgrDIRFMEKVVKATGINLVAGTGIYiyidlpfyflnrsideIADL  117
DSSP  ---------LLLLllllLHHHHHHHHHLLLLEEEELEELLllllllhhhllllhhhHHHH


DSSP  HHHHHH-------HLLLEEEEEHH----hllLHHHHHHHHHHHHHHLLEEEEELLLLLll
Query LREQVA-------AGVIGLEIHED----wgaTPAAIDCALTVADEMDIQVALHSDTLNes  252
ident                     |  |           |  |     |       ||   |  
Sbjct FIHDIKegiqgtlNKAGFVXIAADepgitkdVEKVIRAAAIANKETKVPIITHSNAHN--  175
DSSP  HHHHHHlllllllLLLLLEEEELLlllllhhHHHHHHHHHHHHHHHLLLEEEELLLLL--


DSSP  lLHHHHHHHHLLL-----LEEELLLLLLllllllLHHH-HHHLLlEEEEE-EHHHlllll
Query gFVEDTLAAIGGR-----TIHTFHTEGAggghapDIIT-ACAHPnILPSS-TNPTlpytl  305
ident                    |   |          | |                       
Sbjct nTGLEQQRILTEEgvdpgKILIGHLGDT---dniDYIKkIADKG-SFIGLdRYGL-----  226
DSSP  lHHHHHHHHHHHLlllhhHEEELLHHHL---llhHHHHhHHHLL-LEEEElLLLL-----


DSSP  lhhhhhhhhhhhhhllllllhhhhhllllLLLHHHH-HHHHHHHHLLLL--LEEELLLL-
Query ntidehldmlmvchhldpdiaedvafaesRIRRETI-AAEDVLHDLGAF--SLTSSDSQ-  361
ident                                           |   |       | |   
Sbjct ---------------------------dlFLPVDKRnETTLRLIKDGYSdkIMISHDYCc  259
DSSP  ---------------------------llLLLHHHHhHHHHHHHHLLLLllEEELLLLLl


DSSP  ----------------llLLLLLHHH-HHHHHHHHHhhhhlllllllllllhhHHHHHHH
Query ----------------amGRVGEVIL-RTWQVAHRMkvqrgalaeetgdndnfRVKRYIA  404
ident                                                             
Sbjct tidwgtakpeykpklaprWSITLIFEdTIPFLKRNG----------------vNEEVIAT  303
DSSP  llllllllhhhhhhhlllLLLLHHHHlHHHHHHLLL----------------lLHHHHHH


DSSP  LLLHHHHHHLLllllllllllllllleeeelhhhlllllleeeelleeeeeeelllllll
Query KYTINPALTHGiahevgsievgkladlvvwspaffgvkpatvikggmiaiapmgdinasi  464
ident     ||                                                      
Sbjct IFKENPKKFFS-------------------------------------------------  314
DSSP  HHLHHHHHHLL-------------------------------------------------


DSSP  lllllleeeelhhhlhhhhhhhleeeelhhhhhhlhhhhllllleeeellllllllhhhl
Query ptpqpvhyrpmfgalgsarhhcrltflsqaaaangvaerlnlrsaiavvkgcrtvqkadm  524
ident                                                             
Sbjct ------------------------------------------------------------  314
DSSP  ------------------------------------------------------------


DSSP  lllllllleeelllllleeelleellllllllllllllllll
Query vhnslqpnitvdaqtyevrvdgelitsepadvlpmaqryflf  566
ident                                           
Sbjct ------------------------------------------  314
DSSP  ------------------------------------------


No 35: Query=1a5kC Sbjct=4dlfA Z-score=13.3

back to top
DSSP  leeehhhhhhhhlllllleeelllllleeelleellllllllllllllllllllllllll
Query snisrqayadmfgptvgdkvrladtelwieveddlttygeevkfgggkvirdgmgqgqml   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhhllleeeeeeeeeelleeeeeeeeeelleeeeeeleellllllllleellllleeeel
Query aadcvdlvltnalivdhwgivkadigvkdgrifaigkagnpdiqpnvtipigaateviaa  120
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  llleeeELEEEEEEEL---------------------LLLL-HHHHHHHHLEEEEEEEll
Query egkivtAGGIDTHIHW---------------------ICPQ-QAEEALVSGVTTMVGGgt  158
ident       |  || | |                        |                    
Sbjct ------ALRIDSHQHFwryraadypwigagmgvlardYLPDaLHPLMHAQALGASIAV--   52
DSSP  ------LLLEEEEELLllllhhhllllllllhhhlllLLHHhHHHHHHHLLLLEEEEE--


DSSP  lllhhhhhlLLLLHHHHHHHHHHHHLLLLLEEEEEEELLLLLHHHHhHHHHHL---LLEE
Query gpaagthatTCTPGPWYISRMLQAADSLPVNIGLLGKGNVSQPDALrEQVAAG---VIGL  215
ident              |       |  |          |      |               | 
Sbjct ---------QARAGRDETAFLLELACDEARIAAVVGWEDLRAPQLAeRVAEWRgtkLRGF  103
DSSP  ---------LLLLLHHHHHHHHHHHLLLLLEEEEEELLLLLLLLHHhHHHLLLlllEEEE


DSSP  EEEHHHL----lLHHH--hHHHHHHHHHHLLEEEEELLLLllllLHHHHHHHHLLL---L
Query EIHEDWG----aTPAA--iDCALTVADEMDIQVALHSDTLnesgFVEDTLAAIGGR---T  266
ident                              |                 |  |         
Sbjct RHQLQDEadvraFVDDadfARGVAWLQANDYVYDVLVFER----QLPDVQAFCARHdahW  159
DSSP  EELHHHLllhhhHHHLhhhHHHHHHHHHLLLEEEELLLHH----HHHHHHHHHHHLlllL


DSSP  EEELLLLLL----------llllLLLHHH-HHHLLLEEEEEEHHHllllllhhhHHHHhh
Query IHTFHTEGA----------ggghAPDIIT-ACAHPNILPSSTNPTlpytlntidEHLDml  315
ident     |                           | |                         
Sbjct LVLDHAGKPalaefdrddtalarWRAALReLAALPHVVCKLSGLV------teaDWRR--  211
DSSP  EEEHHHHLLlhhhllllllhhhhHHHHHHhHHLLLLEEEEELLLL------lllLLLL--


DSSP  hhhhllllllhhhhhlllllllHHHHHHHHHHHhLLLL---LEEELLLLLL---lLLLLH
Query mvchhldpdiaedvafaesrirRETIAAEDVLHdLGAF---SLTSSDSQAM---gRVGEV  369
ident                       |      |               ||           ||
Sbjct ---------------glrasdlRHIEQCLDAAL-DAFGpqrLMFGSDWPVCllaaSYDEV  255
DSSP  ---------------lllhhhhHHHHHHHHHHH-HHHLhhhEEELLLLLHHhhllLHHHH


DSSP  HHHHHHHHHHHhhhhlllllllllllhhHHHHHHHLLLHHHHHHLLLLllllllllllll
Query ILRTWQVAHRMkvqrgalaeetgdndnfRVKRYIAKYTINPALTHGIAhevgsievgkla  429
ident        |                          |      |                  
Sbjct ASLVERWAESR----------------lSAAERSALWGGTAARCYALP------------  287
DSSP  HHHHHHHHHHH----------------lLHHHHHHHLLHHHHHHLLLL------------


DSSP  leeeelhhhlllllleeeelleeeeeeellllllllllllleeeelhhhlhhhhhhhlee
Query dlvvwspaffgvkpatvikggmiaiapmgdinasiptpqpvhyrpmfgalgsarhhcrlt  489
ident                                                             
Sbjct ------------------------------------------------------------  287
DSSP  ------------------------------------------------------------


DSSP  eelhhhhhhlhhhhllllleeeellllllllhhhllllllllleeelllllleeelleel
Query flsqaaaangvaerlnlrsaiavvkgcrtvqkadmvhnslqpnitvdaqtyevrvdgeli  549
ident                                                             
Sbjct ------------------------------------------------------------  287
DSSP  ------------------------------------------------------------


DSSP  lllllllllllllllll
Query tsepadvlpmaqryflf  566
ident                  
Sbjct -----------------  287
DSSP  -----------------


No 36: Query=1a5kC Sbjct=3qy6A Z-score=12.9

back to top
DSSP  leeehhhhhhhhlllllleeelllllleeelleellllllllllllllllllllllllll
Query snisrqayadmfgptvgdkvrladtelwieveddlttygeevkfgggkvirdgmgqgqml   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhhllleeeeeeeeeelleeeeeeeeeelleeeeeeleellllllllleellllleeeel
Query aadcvdlvltnalivdhwgivkadigvkdgrifaigkagnpdiqpnvtipigaateviaa  120
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  llleeeelEEEEEEELL------------LLLHHHHHHHHLEEEEEEelllllhhhhhLL
Query egkivtagGIDTHIHWI------------CPQQAEEALVSGVTTMVGggtgpaagthaTT  168
ident          || | |                  |  |   |  |              | 
Sbjct --------MIDIHCHILpamddgagdsadSIEMARAAVRQGIRTIIA-----------TP   41
DSSP  --------LEELLLLLLlllllllllhhhHHHHHHHHHHLLLLEEEL-----------LL


DSSP  LL------LHHHHHHHH-HHHHLLL-----LLEEEEEeelllllhhhhhhhhhhllleEE
Query CT------PGPWYISRM-LQAADSL-----PVNIGLLgkgnvsqpdalreqvaagvigLE  216
ident           |        |    |     |                            |
Sbjct HHnngvykNEPAAVREAaDQLNKRLikediPLHVLPG---------------------QE   80
DSSP  EEllllllLLHHHHHHHhHHHHHHHhhlllLLEEELL---------------------LE


DSSP  EEhhhlLLHHhhhhHHHHHHHH-------lLEEEEELLLLLlllLHHHHHHHHLLL----
Query IHedwgATPAaidcALTVADEM-------dIQVALHSDTLNesgFVEDTLAAIGGR----  265
ident |                                                           
Sbjct IR----IYGE----VEQDLAKRqllslndtKYILIEFPFDH---VPRYAEQLFYDLqlkg  129
DSSP  EE----LLLL----HHHHHHLLllllhhhlLEEEEELLLLL---LLLLHHHHHHHHhhll


DSSP  -LEEELLLLLllllLLLL---hhHHHH--LLLEEEEEEHHHLLLlllhhhhhhhhhhhhh
Query -TIHTFHTEGagggHAPD---iiTACA--HPNILPSSTNPTLPYtlntidehldmlmvch  319
ident       | |                            |   |                  
Sbjct yIPVIAHPER----NREIrenpsLLYHlvEKGAASQITSGSLAG----------------  169
DSSP  lEEEEELHHH----LHHHhhllhHHHHhhHLLLEEEEEHHHHLL----------------


DSSP  llllllhhhhhlllllllHHHHHHHHHHHHLLLLLEEELLLL--lLLLLlLHHHHHHHHH
Query hldpdiaedvafaesrirRETIAAEDVLHDLGAFSLTSSDSQ--aMGRVgEVILRTWQVA  377
ident                       |    |          ||                    
Sbjct ---------------ifgKQLKAFSLRLVEANLIHFVASDAHnvkTRNF-HTQEALYVLE  213
DSSP  ---------------lllHHHHHHHHHHHHLLLLLEEELLLLlllLLLL-LHHHHHHHHH


DSSP  HHHhhhhlllllllllllhhHHHHHHHLLlHHHHHHLLLLllllllllllllleeeelhh
Query HRMkvqrgalaeetgdndnfRVKRYIAKYtINPALTHGIAhevgsievgkladlvvwspa  437
ident                                |  |                         
Sbjct KEF-----------------GSELPYMLT-ENAELLLRNQ--------------------  235
DSSP  HHH-----------------LLHHHHHHH-HHHHHHHLLL--------------------


DSSP  hlllllleeeelleeeeeeellllllllllllleeeelhhhlhhhhhhhleeeelhhhhh
Query ffgvkpatvikggmiaiapmgdinasiptpqpvhyrpmfgalgsarhhcrltflsqaaaa  497
ident                                                             
Sbjct ------------------------------------------------------------  235
DSSP  ------------------------------------------------------------


DSSP  hlhhhhllllleeeellllllllhhHLLLlLLLLLEeelllllleeelleelllllllll
Query ngvaerlnlrsaiavvkgcrtvqkaDMVHnSLQPNItvdaqtyevrvdgelitsepadvl  557
ident                                                             
Sbjct -------------------------TIFR-QPPQPV------------------------  245
DSSP  -------------------------LLLL-LLLLLL------------------------


DSSP  lllllllll
Query pmaqryflf  566
ident          
Sbjct -------kr  247
DSSP  -------ll


No 37: Query=1a5kC Sbjct=2dvtA Z-score=12.6

back to top
DSSP  leeehhhhhhhhlllllleeelllllleeelleellllllllllllllllllllllllll
Query snisrqayadmfgptvgdkvrladtelwieveddlttygeevkfgggkvirdgmgqgqml   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhhllleeeeeeeeeelleeeeeeeeeelleeeeeeleellllllllleellllleeeel
Query aadcvdlvltnalivdhwgivkadigvkdgrifaigkagnpdiqpnvtipigaateviaa  120
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  llleeEELEEEEEEEL------------------------LLLL---HHHHHHHHLEEEE
Query egkivTAGGIDTHIHW------------------------ICPQ---QAEEALVSGVTTM  153
ident        |      |                                        |  ||
Sbjct -----MQGKVALEEHFaipetlqdsagfvpgdywkelqhrLLDIqdtRLKLMDAHGIETM   55
DSSP  -----LLLEEEEEEEEllhhhhhhhlllllllhhhhhhhhHHLLllhHHHHHHHLLEEEE


DSSP  EEELllllhhHHHL---------llllHHHHHHHHHHHHLLLLLEEEEEEEL-LLLL---
Query VGGGtgpaagTHAT---------tctpGPWYISRMLQAADSLPVNIGLLGKG-NVSQ---  200
ident                                           |                 
Sbjct ILSL------NAPAvqaipdrrkaieiARRANDVLAEECAKRPDRFLAFAALpLQDPdaa  109
DSSP  EEEE------LLLHhhhlllhhhhhhhHHHHHHHHHHHHHHLLLLEEEEELLlLLLHhhh


DSSP  HHHHHHHHH-HLLLEEEEEHHH--------LLLHH-hhHHHHHHHHHHLLEEEEEL----
Query PDALREQVA-AGVIGLEIHEDW--------GATPA-aiDCALTVADEMDIQVALHS----  246
ident    |   |   |  |                                 |    ||     
Sbjct TEELQRCVNdLGFVGALVNGFSqegdgqtpLYYDLpqyRPFWGEVEKLDVPFYLHPrnpl  169
DSSP  HHHHHHHHHlLLLLEEEEELLLllllllllLLLLLhhhHHHHHHHHHHLLLEEEELllll


DSSP  ----------------------LLLLllllHHHHHH-HHLL----LLEEELLLLLlllll
Query ----------------------DTLNesgfVEDTLA-AIGG----RTIHTFHTEGagggh  279
ident                        |           |           |   |        
Sbjct pqdsriydghpwllgptwafaqETAV---hALRLMAsGLFDehprLNIILGHMGE-----  221
DSSP  hhhlhhhlllhhhlhhhlhhhhHHHH---hHHHHHHlLHHHhlllLLEEELHHHL-----


DSSP  llLHHH-------------------------hhHLLLEEEEEEHhHLLLlllhhhhhhhh
Query apDIIT-------------------------acAHPNILPSSTNpTLPYtlntidehldm  314
ident                                     |                       
Sbjct --GLPYmmwridhrnawvklpprypakrrfmdyFNENFHITTSG-NFRT-----------  267
DSSP  --LHHHhhhhhhhllllllllllllllllhhhhHHHHEEEELLL-LLLH-----------


DSSP  hhhhhllllllhhhhhlllllllhhhhhHHHHHHHL---LLLLEEELLLLLlLLLLLHHH
Query lmvchhldpdiaedvafaesrirretiaAEDVLHDL---GAFSLTSSDSQAmGRVGEVIL  371
ident                                    |       | | |            
Sbjct ----------------------------QTLIDAILeigADRILFSTDWPF-ENIDHASD  298
DSSP  ----------------------------HHHHHHHLlllHHHEELLLLLLL-LLHHHHHH


DSSP  HHHHHHhhhhhhhlllllllllllhhHHHHHHHLLLHHHHHHLLLLllllllllllllle
Query RTWQVAhrmkvqrgalaeetgdndnfRVKRYIAKYTINPALTHGIAhevgsievgkladl  431
ident                                      |                      
Sbjct WFNATS-------------------iAEADRVKIGRTNARRLFKLD--------------  325
DSSP  HHHHLL-------------------lLHHHHHHHHLHHHHHHLLLL--------------


DSSP  eeelhhhlllllleeeelleeeeeeellllllllllllleeeelhhhlhhhhhhhleeee
Query vvwspaffgvkpatvikggmiaiapmgdinasiptpqpvhyrpmfgalgsarhhcrltfl  491
ident                                                             
Sbjct ------------------------------------------------------------  325
DSSP  ------------------------------------------------------------


DSSP  lhhhhhhlhhhhllllleeeellllllllhhhllllllllleeelllllleeelleelll
Query sqaaaangvaerlnlrsaiavvkgcrtvqkadmvhnslqpnitvdaqtyevrvdgelits  551
ident                                                             
Sbjct ------------------------------------------------------------  325
DSSP  ------------------------------------------------------------


DSSP  lllllllllllllll
Query epadvlpmaqryflf  566
ident                
Sbjct ---------------  325
DSSP  ---------------


No 38: Query=1a5kC Sbjct=4ofcA Z-score=12.5

back to top
DSSP  leeehhhhhhhhlllllleeelllllleeelleellllllllllllllllllllllllll
Query snisrqayadmfgptvgdkvrladtelwieveddlttygeevkfgggkvirdgmgqgqml   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhhllleeeeeeeeeelleeeeeeeeeelleeeeeeleellllllllleellllleeeel
Query aadcvdlvltnalivdhwgivkadigvkdgrifaigkagnpdiqpnvtipigaateviaa  120
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  llleeeeLEEEEEEEL-------------------------------------------L
Query egkivtaGGIDTHIHW-------------------------------------------I  137
ident          || | |                                             
Sbjct -------MKIDIHSHIlpkewpdlkkrfgyggwvqlqhhskgeakllkdgkvfrvvrenC   53
DSSP  -------LLEEEEEELlllllllhhhhhllllleeeeeeelleeeeeelleeeeeeehhH


DSSP  LLL--HHHHHHHHLEEEEEEELllllhhHHHL---------llllHHHHHHHHHHHHLLL
Query CPQ--QAEEALVSGVTTMVGGGtgpaagTHAT---------tctpGPWYISRMLQAADSL  186
ident         |    |||                                          | 
Sbjct WDPevRIREMDQKGVTVQALST------VPVMfsywakpedtlnlCQLLNNDLASTVVSY  107
DSSP  LLHhhHHHHHHHHLLLEEEEEL------LHHHhlllllhhhhhhhHHHHHHHHHHHHHHL


DSSP  LLEEEEEEELlLLLH-HHHHHHHHH----LLLEEEEEHHH--LLLHH-hhHHHHHHHHHH
Query PVNIGLLGKGnVSQP-DALREQVAA----GVIGLEIHEDW--GATPA-aiDCALTVADEM  238
ident |     ||      |  |  |        |  |  |          |         |   
Sbjct PRRFVGLGTLpMQAPeLAVKEMERCvkelGFPGVQIGTHVneWDLNAqelFPVYAAAERL  167
DSSP  LLLEEEEELLlLLLHhHHHHHHHHHhhllLLLEEEEELEEllEELLLhhhHHHHHHHHHH


DSSP  LLEEEEEL----------------------LLLLllllHHHHH--HHHL---lLLEEELL
Query DIQVALHS----------------------DTLNesgfVEDTL--AAIG---gRTIHTFH  271
ident       |                        |                           |
Sbjct KCSLFVHPwdmqmdgrmakywlpwlvgmpaETTI---aICSMImgGVFEkfpkLKVCFAH  224
DSSP  LLEEEEELllllllhhhhlllhhhhlhhhhHHHH---hHHHHHllLHHHhlllLLEEELH


DSSP  LLLlllllllLHHH------------------------hhHLLLEEEEEEhhHLLLlllh
Query TEGaggghapDIIT------------------------acAHPNILPSSTnpTLPYtlnt  307
ident   |                                                         
Sbjct GGG-------AFPFtvgrishgfsmrpdlcaqdnpmnpkkYLGSFYTDAL--VHDP----  271
DSSP  HHL-------LHHHhhhhhhhhhhhlhhhhlllllllhhhHLLLLEEELL--LLLH----


DSSP  hhhhhhhhhhhhllllllhhhhhlllllllhhhhHHHHHHHhLLLL---LEEELLLLL-L
Query idehldmlmvchhldpdiaedvafaesrirretiAAEDVLHdLGAF---SLTSSDSQA-M  363
ident                                        |              |     
Sbjct ----------------------------------LSLKLLT-DVIGkdkVILGTDYPFpL  296
DSSP  ----------------------------------HHHHHHH-HHHLlllEELLLLLLLlL


DSSP  LLLlLHHHHHHHhHHHHhhhhlllllllllllhhHHHHHHHLLLHHHHHHLLLLLLLlll
Query GRVgEVILRTWQvAHRMkvqrgalaeetgdndnfRVKRYIAKYTINPALTHGIAHEVgsi  423
ident |   |                                        |     |        
Sbjct GEL-EPGKLIES-MEEF-----------------DEETKNKLKAGNALAFLGLERKQ---  334
DSSP  LLL-LLLHHHHH-LLLL-----------------LHHHHHHHHLHHHHHHHLLLHHH---


DSSP  llllllleeeelhhhlllllleeeelleeeeeeellllllllllllleeeelhhhlhhhh
Query evgkladlvvwspaffgvkpatvikggmiaiapmgdinasiptpqpvhyrpmfgalgsar  483
ident                                                             
Sbjct ------------------------------------------------------------  334
DSSP  ------------------------------------------------------------


DSSP  hhhleeeelhhhhhhlhhhhllllleeeellllllllhhhllllllllleeellllllee
Query hhcrltflsqaaaangvaerlnlrsaiavvkgcrtvqkadmvhnslqpnitvdaqtyevr  543
ident                                                             
Sbjct ------------------------------------------------------------  334
DSSP  ------------------------------------------------------------


DSSP  elleellllllllllllllllll
Query vdgelitsepadvlpmaqryflf  566
ident                        
Sbjct ----------------------f  335
DSSP  ----------------------l


No 39: Query=1a5kC Sbjct=3gg7A Z-score=12.5

back to top
DSSP  leeehhhhhhhhlllllleeelllllleeelleellllllllllllllllllllllllll
Query snisrqayadmfgptvgdkvrladtelwieveddlttygeevkfgggkvirdgmgqgqml   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhhllleeeeeeeeeelleeeeeeeeeelleeeeeeleellllllllleellllleeeel
Query aadcvdlvltnalivdhwgivkadigvkdgrifaigkagnpdiqpnvtipigaateviaa  120
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  llleeeeLEEEEEEELL----LLLHHHHHHHHLEeEEEEElllllhhhhhllLLLHHhHH
Query egkivtaGGIDTHIHWI----CPQQAEEALVSGVtTMVGGgtgpaagthattCTPGPwYI  176
ident          || | |          |         |                 |      
Sbjct -------SLIDFHVHLDlypdPVAVARACEERQL-TVLSV------------TTTPA-AW   39
DSSP  -------LLEEEEELHHhlllHHHHHHHHHHLLL-EEEEL------------LLLHH-HH


DSSP  HHHHHHHLLLlLEEEEEEELL-------lllHHHHHHHHHhLLLEEE-EEHH--------
Query SRMLQAADSLpVNIGLLGKGN-------vsqPDALREQVAaGVIGLE-IHED--------  220
ident    |  |                                            |        
Sbjct RGTLALAAGR-PHVWTALGFHpevvseraadLPWFDRYLP-ETRFVGeVGLDgspslrgt   97
DSSP  HHHHHHHLLL-LLEEELLLLLhhhllllhhhLHHHHHHHH-HLLEEEeEELLllhhhhhh


DSSP  hllLHHHHHHHHHHHHHH-LLEEEEELLLlllllLHHHHHHHHLLL----LEEELLLLLl
Query wgaTPAAIDCALTVADEM-DIQVALHSDTlnesgFVEDTLAAIGGR----TIHTFHTEGa  275
ident      |     |             ||            |          |       | 
Sbjct wtqQFAVFQHILRRCEDHgGRILSIHSRR-----AESEVLNCLEANprsgTPILHWYSG-  151
DSSP  hhhHHHHHHHHHHHHHHLlLEEEEEELLL-----LHHHHHHHHHHLhhheEEEEELLLL-


DSSP  llllLLLHHH-HHHLlLEEEEEEHHHLLLlllhhhhhhhhhhhhhllllllhhhhhllll
Query ggghAPDIIT-ACAHpNILPSSTNPTLPYtlntidehldmlmvchhldpdiaedvafaes  334
ident            |        |                                       
Sbjct ----SVTELRrAISL-GCWFSVGPTMVRT-------------------------------  175
DSSP  ----LHHHHHhHHHL-LLEEEELHHHHLL-------------------------------


DSSP  lllhHHHHHHHHHHhLLLLLEEELLLLLL------LLLLLHHHHHHHHHHHHHhhhllll
Query rirrETIAAEDVLHdLGAFSLTSSDSQAM------GRVGEVILRTWQVAHRMKvqrgala  388
ident        ||           ||  |               |                   
Sbjct ----QKGAALIRSM-PRDRVLTETDGPFLeldgqaALPWDVKSVVEGLSKIWQ-------  223
DSSP  ----HHHHHHHHHL-LHHHEEELLLLLLLeelleeLLHHHHHHHHHHHHHHHL-------


DSSP  lllllllhHHHHHHHHLlLHHHHHHLLllllllllllllllleeeelhhhlllllleeee
Query eetgdndnFRVKRYIAKyTINPALTHGiahevgsievgkladlvvwspaffgvkpatvik  448
ident                     |     |                                 
Sbjct -------iPASEVERIV-KENVSRLLG---------------------------------  242
DSSP  -------lLHHHHHHHH-HHHHHHHHH---------------------------------


DSSP  lleeeeeeellllllllllllleeeelhhhlhhhhhhhleeeelhhhhhhlhhhhlllll
Query ggmiaiapmgdinasiptpqpvhyrpmfgalgsarhhcrltflsqaaaangvaerlnlrs  508
ident                                                             
Sbjct ------------------------------------------------------------  242
DSSP  ------------------------------------------------------------


DSSP  eeeellllllllhhhllllllllleeelllllleeelleellllllllllllllllll
Query aiavvkgcrtvqkadmvhnslqpnitvdaqtyevrvdgelitsepadvlpmaqryflf  566
ident                                                           
Sbjct ---------------------------------------------------------t  243
DSSP  ---------------------------------------------------------l


No 40: Query=1a5kC Sbjct=1a4mA Z-score=12.4

back to top
DSSP  leeehhhhhhhhlllllleeelllllleeelleellllllllllllllllllllllllll
Query snisrqayadmfgptvgdkvrladtelwieveddlttygeevkfgggkvirdgmgqgqml   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhhllleeeeeeeeeelleeeeeeeeeelleeeeeeleellllllllleellllleeeel
Query aadcvdlvltnalivdhwgivkadigvkdgrifaigkagnpdiqpnvtipigaateviaa  120
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  llleeEELEEEEEEELL-------------------------------------------
Query egkivTAGGIDTHIHWI-------------------------------------------  137
ident             | |                                             
Sbjct -tpafNKPKVELHVHLDgaikpetilyfgkkrgialpadtveelrniigmdkplslpgfl   59
DSSP  -llllLLLEEEEEEEHHhlllhhhhhhhhhhhllllllllhhhhhhhhlllllllhhhhh


DSSP  --------------------lLLHHHHHHHHLEEEEEEelllllhhhhhlLLLL------
Query --------------------cPQQAEEALVSGVTTMVGggtgpaagthatTCTP------  171
ident                          |     ||                    |      
Sbjct akfdyympviagcreaikriaYEFVEMKAKEGVVYVEV------------RYSPhllans  107
DSSP  llhhhhhhhhlllhhhhhhhhHHHHHHHHHLLEEEEEE------------EELLhhhlll


DSSP  ---------------HHHHHHHHHHHHLLL----LLEEEEEEELL---LLLHHHHHHHHH
Query ---------------GPWYISRMLQAADSL----PVNIGLLGKGN---VSQPDALREQVA  209
ident                         |                        |      |   
Sbjct kvdpmpwnqtegdvtPDDVVDLVNQGLQEGeqafGIKVRSILCCMrhqPSWSLEVLELCK  167
DSSP  lllllhhhlllllllHHHHHHHHHHHHHHHhhhhLLEEEEEEEEElllHHHHHHHHHHHH


DSSP  HL----LLEEEEEHH---hlLLHH-HHHHHHHHHHHHLLEEEEELlllllllLHHHHHHH
Query AG----VIGLEIHED---wgATPA-AIDCALTVADEMDIQVALHSdtlnesgFVEDTLAA  261
ident       |       |              |   |    |    |                
Sbjct KYnqktVVAMDLAGDetiegSSLFpGHVEAYEGAVKNGIHRTVHA----gevGSPEVVRE  223
DSSP  HLllllEEEEEEELLlllllHHHLhHHHHHHHHHHHHLLEEEEEE----lllLLHHHHHH


DSSP  HLL--LLEEELLLLllllllllLHHH------hHHLLlEEEEEEHHHllllllhhhhhhh
Query IGG--RTIHTFHTEgaggghapDIIT------aCAHPnILPSSTNPTlpytlntidehld  313
ident       |    |            |                                   
Sbjct AVDilKTERVGHGY--------HTIEdealynrLLKEnMHFEVCPWS-------------  262
DSSP  HHHllLLLEEEELH--------HHHHlhhhhhhHHHLlLEEEELHHH-------------


DSSP  hhhhhhllllllhhhhhlllLLLLHHHhHHHHHHHHL-LLLLEEELLLLLLLlllLHHHH
Query mlmvchhldpdiaedvafaeSRIRRETiAAEDVLHDL-GAFSLTSSDSQAMGrvgEVILR  372
ident                           |     |      |      |             
Sbjct ----------------syltGAWDPKT-THAVVRFKNdKANYSLNTDDPLIF-ksTLDTD  304
DSSP  ----------------hhhlLLLLLLL-LLHHHHHHHlLLLEEELLLLLLLL-llLHHHH


DSSP  HHHHHHHHHhhhlllllllllllhhHHHHHHHLlLHHHHHHLLL----LLLL--LLLLll
Query TWQVAHRMKvqrgalaeetgdndnfRVKRYIAKyTINPALTHGI----AHEV--GSIEvg  426
ident        |                           || |           |         
Sbjct YQMTKKDMG---------------fTEEEFKRL-NINAAKSSFLpeeeKKELleRLYR--  346
DSSP  HHHHHHLLL---------------lLHHHHHHH-HHHHHHLLLLlhhhHHHHhhHHHH--


DSSP  lllleeeelhhhlllllleeeelleeeeeeellllllllllllleeeelhhhlhhhhhhh
Query kladlvvwspaffgvkpatvikggmiaiapmgdinasiptpqpvhyrpmfgalgsarhhc  486
ident                                                             
Sbjct ------------------------------------------------------------  346
DSSP  ------------------------------------------------------------


DSSP  leeeelhhhhhhlhhhhllllleeeellllllllhhhllllllllleeelllllleeell
Query rltflsqaaaangvaerlnlrsaiavvkgcrtvqkadmvhnslqpnitvdaqtyevrvdg  546
ident                                                             
Sbjct ------------------------------------------------------------  346
DSSP  ------------------------------------------------------------


DSSP  eellllllllllllllllll
Query elitsepadvlpmaqryflf  566
ident                     
Sbjct -----------------eyq  349
DSSP  -----------------hll


No 41: Query=1a5kC Sbjct=2imrA Z-score=12.3

back to top
DSSP  leeehhhhhhhhlllllleeelllllleeelleellllllllllllllllllllllllll
Query snisrqayadmfgptvgdkvrladtelwieveddlttygeevkfgggkvirdgmgqgqml   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhhllleeeEEEEE--EELL--EEEEEEEEeelleeEEEELeellllllllleellllle
Query aadcvdlvlTNALI--VDHW--GIVKADIGvkdgriFAIGKagnpdiqpnvtipigaate  116
ident                                                             
Sbjct ------htpRLLTCdvLYTGaqSPGGVVVV-----gETVAA-------aghpdelrrqyp   42
DSSP  ------lleEEEEEleEELLeeLLEEEEEE-----lLEEEE-------eelhhhhhhhll


DSSP  eeelLLLE--EEELEEEEEEELL------------------------------LLLHHHH
Query viaaEGKI--VTAGGIDTHIHWI------------------------------CPQQAEE  144
ident     |             | |                                    |  
Sbjct haaeERAGavIAPPPVNAHTHLDmsayefqalpyfqwipevvirgrhlrgvaaAQAGADT  102
DSSP  lleeEELLleELLLLLEEEEELLllhhhhhhlhhhhllhhhhhhhllllhhhhHHHHHHH


DSSP  HHHHLEEEEEEelllllhhhhhlLLLLHhHHHHHHHhHHLLllLEEEEEEELLL------
Query ALVSGVTTMVGggtgpaagthatTCTPGpWYISRMLqAADSlpVNIGLLGKGNV------  198
ident     |                              | |         |            
Sbjct LTRLGAGGVGD------------IVWAP-EVMDALL-ARED--LSGTLYFEVLNpfpdka  146
DSSP  HHHLLLLLEEE------------EELLH-HHHHHHH-LLLL--LLEEEEEEELLllhhhh


DSSP  -lLHHHHHHHHHHL--------lLEEEEEHhHLLLHHHHHHHHHHHHHHLLEEEEEL---
Query -sQPDALREQVAAG--------vIGLEIHEdWGATPAAIDCALTVADEMDIQVALHS---  246
ident      | |                ||  |                |         |    
Sbjct deVFAAARTHLERWrrlerpglrLGLSPHTpFTVSHRLMRLLSDYAAGEGLPLQIHVaeh  206
DSSP  hhHHHHHHHHHHHHhlllllleeEEEEELLlLLLLHHHHHHHHHHHHHHLLLLEEEElll


DSSP  -lLLLL--------------------------------llLHHHHHHH-HLLLLEEELLL
Query -dTLNE--------------------------------sgFVEDTLAA-IGGRTIHTFHT  272
ident    |                                     |                | 
Sbjct ptELEMfrtgggplwdnrmpalyphtlaevigrepgpdltPVRYLDELgVLAARPTLVHM  266
DSSP  hhHHHHhhhlllllhhhllhhhllllhhhhhlllllllllHHHHHHHHlLHHHLLEEEEL


DSSP  LLllllllllHHHHHHLLLEEEEEE-HHHLlllllhhhhhhhhhhhhhllllllhhhhhl
Query EGaggghapdIITACAHPNILPSST-NPTLpytlntidehldmlmvchhldpdiaedvaf  331
ident            |   |                                            
Sbjct VN----vtpdDIARVARAGCAVVTCpRSNH------------------------------  292
DSSP  LL----llhhHHHHHHHHLLLEEELhHHHH------------------------------


DSSP  llllllhhhHHHHhhHHHLLL----LLEEELLLLLLLLLLLHHHHHHHHHHHHHHhhlll
Query aesrirretIAAEdvLHDLGA----FSLTSSDSQAMGRVGEVILRTWQVAHRMKVqrgal  387
ident                     |          || | |    |                  
Sbjct ------hleCGTF--DWPAFAaagvEVALGTDSVASGETLNVREEVTFARQLYPG-----  339
DSSP  ------hllLLLL--LHHHHHhlllLEEELLLLHHHHLLLLLHHHHHHHHHHLLL-----


DSSP  llllllllhhHHHHHHHLLLHHHHHHLLlllllLLLLL--lllllEEEElhhhllllLLE
Query aeetgdndnfRVKRYIAKYTINPALTHGiahevGSIEV--gkladLVVWspaffgvkPAT  445
ident                            |                    |           
Sbjct ---------lDPRVLVRAAVKGGQRVVG-----TPFLRrgetwqeGFRW--------ELS  377
DSSP  ---------lLHHHHHHHHHHHHHHHHL-----LLLLLllllllhHHLH--------HHL


DSSP  Eeelleeeeeeellllllllllllleeeelhhhlhhhhhhhleeeelhhhhhhlhhhhll
Query Vikggmiaiapmgdinasiptpqpvhyrpmfgalgsarhhcrltflsqaaaangvaerln  505
ident                                                             
Sbjct R-----------------------------------------------------------  378
DSSP  L-----------------------------------------------------------


DSSP  llleeeellllllllhhhllllllllleeelllllleeelleelllllllllllllllll
Query lrsaiavvkgcrtvqkadmvhnslqpnitvdaqtyevrvdgelitsepadvlpmaqryfl  565
ident                                                             
Sbjct -----------------------------------------------------------d  379
DSSP  -----------------------------------------------------------l


DSSP  l
Query f  566
ident  
Sbjct l  380
DSSP  l


No 42: Query=1a5kC Sbjct=1itqA Z-score=12.3

back to top
DSSP  leeehhhhhhhhlllllleeelLLLLleeelleellllllllllllllllllllllllll
Query snisrqayadmfgptvgdkvrlADTElwieveddlttygeevkfgggkvirdgmgqgqml   60
ident                                                             
Sbjct ----------------------DFFR----------------------------------    4
DSSP  ----------------------LHHH----------------------------------


DSSP  hhhllleeeeeeeeeelleeeeeeeeeelleeeeeeleellllllllleellllleeeel
Query aadcvdlvltnalivdhwgivkadigvkdgrifaigkagnpdiqpnvtipigaateviaa  120
ident                                                             
Sbjct ---------------------------------------------------------dea    7
DSSP  ---------------------------------------------------------hhh


DSSP  llleEEELEEEEEEE-LLLL---------------------LHHH-HHHHHLEEEEEEEL
Query egkiVTAGGIDTHIH-WICP---------------------QQAE-EALVSGVTTMVGGG  157
ident          || |                                       |       
Sbjct erimRDSPVIDGHNDlPWQLldmfnnrlqderanlttlagtHTNIpKLRAGFVGGQFWSV   67
DSSP  hhhhLLLLEEEEEELhHHHHhhhhllllllhhhllllllllLLLHhHHHHLLEEEEEEEE


DSSP  llllhhhhhlllllHHHHHHHHHHHH--LLLL------------------LEEEEEEELL
Query tgpaagthattctpGPWYISRMLQAA--DSLP------------------VNIGLLGKGN  197
ident                                                   |       | 
Sbjct ytpcdtqnkdavrrTLEQMDVVHRMCrmYPETflyvtssagirqafregkVASLIGVEGG  127
DSSP  lllhhhllllhhhhHHHHHHHHHHHHhhLLLLeeelllhhhhhhhhhlllEEEEEEEELH


DSSP  L---LLHHHHHHHHHHLLLEEEEEHHHLlLHHH--------------------HHHHHHH
Query V---SQPDALREQVAAGVIGLEIHEDWGaTPAA--------------------IDCALTV  234
ident     |    ||     |   |        || |                           
Sbjct HsidSSLGVLRALYQLGMRYLTLTHSCN-TPWAdnwlvdtgdsepqsqglspfGQRVVKE  186
DSSP  HhllLLHHHHHHHHHLLEEEEELLLLLL-LLLLllhhhlllllllllllllhhHHHHHHH


DSSP  HHHHLLEEE-EELLlllllllHHHHHHHHLLL--LEEE-LLLLL----LLLLllllHHHH
Query ADEMDIQVA-LHSDtlnesgfVEDTLAAIGGR--TIHT-FHTEG----AGGGhapdIITA  286
ident            |         |    |                                 
Sbjct LNRLGVLIDlAHVS-------VATMKATLQLSraPVIFsHSSAYsvcaSRRN---vPDDV  236
DSSP  HHHHLLEEElLLLL-------HHHHHHHHHHLllLLEElLLLLLllllLLLL---lLHHH


DSSP  HHL---LLEEEEEEHHHllllllHHHHHhhhhhhhhllllllhhhhhlllllllhhhhhH
Query CAH---PNILPSSTNPTlpytlnTIDEHldmlmvchhldpdiaedvafaesrirretiaA  343
ident          |                                                  
Sbjct LRLvkqTDSLVMVNFYN--nyisCTNKA-------------------------nlsqvaD  269
DSSP  HHHhhhHLLEEEELLLH--hhhlLLLLL-------------------------lhhhhhH


DSSP  HHHHHHLLL---LLEEELLLLLL-------lLLLLHHHHHHHHHHHHhhhhlllllllll
Query EDVLHDLGA---FSLTSSDSQAM-------gRVGEVILRTWQVAHRMkvqrgalaeetgd  393
ident         |         |             |            |              
Sbjct HLDHIKEVAgarAVGFGGDFDGVprvpegleDVSKYPDLIAELLRRN-------------  316
DSSP  HHHHHHHHLlhhHEEELLLLLLLllllllllLLLLHHHHHHHHHHLL-------------


DSSP  llhhHHHHHHHLLLHHHHHHLLllllllllllllllleeeelhhhlllllleeeelleee
Query ndnfRVKRYIAKYTINPALTHGiahevgsievgkladlvvwspaffgvkpatvikggmia  453
ident                |                                            
Sbjct ---wTEAEVKGALADNLLRVFE--------------------------------------  335
DSSP  ---lLHHHHHHHHLHHHHHHHH--------------------------------------


DSSP  eeeellllllllllllleeeelhhhlhhhhhhhleeeelhhhhhhlhhhhllllleeeel
Query iapmgdinasiptpqpvhyrpmfgalgsarhhcrltflsqaaaangvaerlnlrsaiavv  513
ident                                                             
Sbjct ------------------------------------------------------------  335
DSSP  ------------------------------------------------------------


DSSP  lLLLLllhhhllllllllleeelllllleeelleellllllllllllllllll
Query kGCRTvqkadmvhnslqpnitvdaqtyevrvdgelitsepadvlpmaqryflf  566
ident                                                      
Sbjct -AVEQ------------------asnltqapeeepipldqlggscrthygyss  369
DSSP  -HHHH------------------llllllllllllllhhhlllllllllllll


No 43: Query=1a5kC Sbjct=2ffiA Z-score=12.2

back to top
DSSP  leeehhhhhhhhlllllleeelllllleeelleellllllllllllllllllllllllll
Query snisrqayadmfgptvgdkvrladtelwieveddlttygeevkfgggkvirdgmgqgqml   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhhllleeeeeeeeeelleeeeeeeeeelleeeeeeleellllllllleellllleeeel
Query aadcvdlvltnalivdhwgivkadigvkdgrifaigkagnpdiqpnvtipigaateviaa  120
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  llleeeELEEEEEEEL------------------LLLL-HHHHHHHHLEEEEEEELllll
Query egkivtAGGIDTHIHW------------------ICPQ-QAEEALVSGVTTMVGGGtgpa  161
ident          || | |                                |    |       
Sbjct ----lhLTAIDSHAHVfsrglnlasqrryapnydAPLGdYLGQLRAHGFSHGVLVQ----   52
DSSP  ----llLLLEELLLLLllhhhhhhllllllllllLLHHhHHHHHHHLLLLEELLLL----


DSSP  hhHHHLlllLHHHHHHHHHHHHLllllEEEEEEELlLLLHHhhHHHHHHL----LLEEEE
Query agTHATtctPGPWYISRMLQAADslpvNIGLLGKGnVSQPDalREQVAAG----VIGLEI  217
ident              |    ||                           |      | |   
Sbjct --PSFL--gTDNRYLLSALQTVP---gQLRGVVXL-ERDVE--QATLAEXarlgVRGVRL  102
DSSP  --LHHH--lLLLHHHHHHHHHLL---lLLLLLLLL-LLLLL--HHHHHHHhlllLLEEEL


DSSP  EHHHL--LLHH--hhHHHHHHHHHHLLEEEEELlllllllLHHHHHHHHL--LLLEEELL
Query HEDWG--ATPA--aiDCALTVADEMDIQVALHSdtlnesgFVEDTLAAIG--GRTIHTFH  271
ident                   |    |    | ||               |    |  |   |
Sbjct NLXGQdxPDLTgaqwRPLLERIGEQGWHVELHR----qvaDIPVLVRALQpyGLDIVIDH  158
DSSP  LLLLLllLLLLllllHHHHHHHHHHLLEEEELL----lllLHHHHHHHHLllLLLEEELH


DSSP  LLLL---llllLLLHhHHHHL---LLEEEEEEHHHllllllhhhhhhhhhhhhhllllll
Query TEGA---ggghAPDIiTACAH---PNILPSSTNPTlpytlntidehldmlmvchhldpdi  325
ident             |                                               
Sbjct FGRPdarrglgQPGFaELLTLsgrGKVWVKVSGIY-------------------------  193
DSSP  HHLLlllllllLLLHhHHLLLlllLLEEEEEELHH-------------------------


DSSP  hhhhhllllLLLH--HHHHHHHHHHHLLL------lLEEELLLLLL-----lLLLLHHHH
Query aedvafaesRIRR--ETIAAEDVLHDLGA------fSLTSSDSQAM-----gRVGEVILR  372
ident                |  |                     ||            |     
Sbjct --------rLQGSpeENLAFARQALCALEahygaerLXWGSDWPHTqhesevSFGSAVEQ  245
DSSP  --------hLLLLhhHHHHHHHHHHHHHHhhllhhhEEEELLLLLLllllllLHHHHHHH


DSSP  HHHHHhhhhhhhlllllllllllhhHHHHHHHLLLHHHHHHLlLLLLLllllllllllee
Query TWQVAhrmkvqrgalaeetgdndnfRVKRYIAKYTINPALTHgIAHEVgsievgkladlv  432
ident                                |                            
Sbjct FEALG-------------------cSAQLRQALLLDTARALF-GFELE------------  273
DSSP  HHHHL-------------------lLHHHHHHHHLHHHHHHL-LLLLL------------


DSSP  eelhhhlllllleeeelleeeeeeellllllllllllleeeelhhhlhhhhhhhleeeel
Query vwspaffgvkpatvikggmiaiapmgdinasiptpqpvhyrpmfgalgsarhhcrltfls  492
ident                                                             
Sbjct ------------------------------------------------------------  273
DSSP  ------------------------------------------------------------


DSSP  hhhhhhlhhhhllllleeeellllllllhhhllllllllleeelllllleeelleellll
Query qaaaangvaerlnlrsaiavvkgcrtvqkadmvhnslqpnitvdaqtyevrvdgelitse  552
ident                                                             
Sbjct ------------------------------------------------------------  273
DSSP  ------------------------------------------------------------


DSSP  llllllllllllll
Query padvlpmaqryflf  566
ident               
Sbjct --------------  273
DSSP  --------------


No 44: Query=1a5kC Sbjct=2gwgA Z-score=11.9

back to top
DSSP  leeehhhhhhhhlllllleeelllllleeelleellllllllllllllllllllllllll
Query snisrqayadmfgptvgdkvrladtelwieveddlttygeevkfgggkvirdgmgqgqml   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhhllleeeeeeeeeelleeeeeeeeeelleeeeeeleellllllllleellllleeeel
Query aadcvdlvltnalivdhwgivkadigvkdgrifaigkagnpdiqpnvtipigaateviaa  120
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  llleeeeLEEEEEEELLL----------------------------------------lL
Query egkivtaGGIDTHIHWIC----------------------------------------pQ  140
ident          || | |                                             
Sbjct -------XIIDIHGHYTTapkaledwrnrqiagikdpsvxpkvselkisddelqasiieN   53
DSSP  -------LLEEEEEELLLllhhhhhhhhhhhhhhhlhhhlllhhhllllhhhhhhhhhlL


DSSP  HHHHHHHHLEEEEEEELLlllhhhhhlllllHHHHHHHHHHHHLLLLLEEEEEEEL----
Query QAEEALVSGVTTMVGGGTgpaagthattctpGPWYISRMLQAADSLPVNIGLLGKG----  196
ident |       |    |                                | |           
Sbjct QLKKXQERGSDLTVFSPR---agdfnvsstwAAICNELCYRVSQLFPDNFIGAAXLpqsp  110
DSSP  HHHHHHHHLLLEEEEELL---lllhhhhhhhHHHHHHHHHHHHHHLLLLEEEEEELllll


DSSP  --lLLLHHH-HHHHHHHL-LLEEEEEHHH---------llLHHHhHHHHHHHHHHLLEEE
Query --nVSQPDA-LREQVAAG-VIGLEIHEDW---------gaTPAAiDCALTVADEMDIQVA  243
ident           |   |            |                         |  |   
Sbjct gvdPKTCIPeLEKCVKEYgFVAINLNPDPsgghwtsppltDRIW-YPIYEKXVELEIPAX  169
DSSP  lllHHHHHHhHHHHHHLLlLLEEEELLLLlllllllllllLHHH-HHHHHHHHHHLLLEE


DSSP  EE------------lLLLLlllLHHHHHHHHLLLLEEELLLLLlllllllLHHH------
Query LH------------sDTLNesgFVEDTLAAIGGRTIHTFHTEGaggghapDIIT------  285
ident  |                       |             |  |                 
Sbjct IHvstgahylnadttAFXQ--cVAGDLFKDFPELKFVIPHGGG-------AVPYhwgrfr  220
DSSP  ELlllllhhhhhhhhHHHH--hHHLLHHHHLLLLLEEELHHHL-------LLHHhhhhhh


DSSP  ------------hhhLLLEEEEEEhHHLLLlllhhhhhhhhhhhhhllllllhhhhhlll
Query ------------acaHPNILPSSTnPTLPYtlntidehldmlmvchhldpdiaedvafae  333
ident                  ||                                         
Sbjct glaqexkkplledhvLNNIFFDTC-VYHQP------------------------------  249
DSSP  hhhhhlllllhhhhlLLLEEEELL-LLLHH------------------------------


DSSP  llllhhhhhHHHHHHHLLLL--LEEELLLLLL---------llllLHHHHHHHhHHHHhh
Query srirretiaAEDVLHDLGAF--SLTSSDSQAM---------grvgEVILRTWQvAHRMkv  382
ident            | |         |  |                                 
Sbjct ---------GIDLLNTVIPVdnVLFASEXIGAvrgidprtgfyydDTKRYIEA-STIL--  297
DSSP  ---------HHHHHHHHLLHhhEELLLLLLLLllleelllleellLLHHHHHH-LLLL--


DSSP  hhlllllllllllhhHHHHHHHLLLHHHHHHLL-LLLLLlllllLLLLleeeelhhhlll
Query qrgalaeetgdndnfRVKRYIAKYTINPALTHG-IAHEVgsievGKLAdlvvwspaffgv  441
ident                        |  |                  |              
Sbjct ---------------TPEEKQQIYEGNARRVYPrLDAAL----kAKGK------------  326
DSSP  ---------------LHHHHHHHHLHHHHHHLHhHHHHH----hHHHH------------


DSSP  llleeeelleeeeeeellllllllllllleeeelhhhlhhhhhhhleeeelhhhhhhlhh
Query kpatvikggmiaiapmgdinasiptpqpvhyrpmfgalgsarhhcrltflsqaaaangva  501
ident                                                             
Sbjct ------------------------------------------------------------  326
DSSP  ------------------------------------------------------------


DSSP  hhllllleeeellllllllhhhllllllllleeelllllleeelleelllllllllllll
Query erlnlrsaiavvkgcrtvqkadmvhnslqpnitvdaqtyevrvdgelitsepadvlpmaq  561
ident                                                             
Sbjct ------------------------------------------------------------  326
DSSP  ------------------------------------------------------------


DSSP  lllll
Query ryflf  566
ident      
Sbjct --leh  329
DSSP  --hll


No 45: Query=1a5kC Sbjct=4qrnA Z-score=11.8

back to top
DSSP  leeehhhhhhhhlllllleeELLLllleeelleellllllllllllllllllllllllll
Query snisrqayadmfgptvgdkvRLADtelwieveddlttygeevkfgggkvirdgmgqgqml   60
ident                                                             
Sbjct --------------------SMTQ------------------------------------    4
DSSP  --------------------LLLL------------------------------------


DSSP  hhhllleeeeeeeeeelleeeeeeeeeelleeeeeeleellllllllleellllleeeel
Query aadcvdlvltnalivdhwgivkadigvkdgrifaigkagnpdiqpnvtipigaateviaa  120
ident                                                             
Sbjct ---------------------------------------------------------dlk    7
DSSP  ---------------------------------------------------------lll


DSSP  lllEEEELEEEEEEEL--------------------------------------------
Query egkIVTAGGIDTHIHW--------------------------------------------  136
ident          | |                                                
Sbjct tggEQGYLRIATEEAFatreiidvylrmirdgtadkgmvslwgfyaqspseratqilerl   67
DSSP  lllLLLLLLEEEEEEEllhhhhhhhhhhhhhllllhhhhhhhhhhhhlllhhhhhhhhhh


DSSP  LLLL--HHHHHHHHLEEEEEEELllllhhHHHL---------llllHHHHHHHHHHHHLL
Query ICPQ--QAEEALVSGVTTMVGGGtgpaagTHAT---------tctpGPWYISRMLQAADS  185
ident               |              |                          |   
Sbjct LDLGerRIADMDATGIDKAILAL------TSPGvqplhdldeartlATRANDTLADACQK  121
DSSP  HLLLhhHHHHHHHLLLLEEEEEE------LLLLllllllhhhhhhhHHHHHHHHHHHHHH


DSSP  LLLEEEEEEELlLLLHHHHHHHHHHL-----LLEEEEEHHH--LLLHH-hhHHHHHHHHH
Query LPVNIGLLGKGnVSQPDALREQVAAG-----VIGLEIHEDW--GATPA-aiDCALTVADE  237
ident  |      |      |         |       |  |              |       |
Sbjct YPDRFIGMGTVaPQDPEWSAREIHRGarelgFKGIQINSHTqgRYLDEeffDPIFRALVE  181
DSSP  LLLLEEELLLLlLLLHHHHHHHHHHHhhlllLLLEEELLLLllLLLLLhhhHHHHHHHHH


DSSP  HLLEEEEE--------------------------LLLLlllllhHHHHH-HHLL----LL
Query MDIQVALH--------------------------SDTLnesgfvEDTLA-AIGG----RT  266
ident  |     |                                           |        
Sbjct VDQPLYIHpatspdsmidpmleagldgaifgfgvETGM----hlLRLITiGIFDkypsLQ  237
DSSP  HLLLEEELlllllllllhhhhhhlllllllhhhhHHHH----hhHHHHHhLHHHhlllLL


DSSP  EEELLLLLlllllllLHHH-----------------------------hhHLLLEEEEEE
Query IHTFHTEGaggghapDIIT-----------------------------acAHPNILPSST  297
ident |   |                                                | |    
Sbjct IMVGHMGE-------ALPYwlyrldymhqagvrsqryermkplkktiegyLKSNVLVTNS  290
DSSP  EEELHHHH-------LHHHhhhhhhhhhhhhhhlllllllllllllhhhhHHHLEEEELL


DSSP  HHHLLllllhhhhhhhhhhhhhllllllhhhhhlllllllhhhhHHHHHHHhLLLL---L
Query NPTLPytlntidehldmlmvchhldpdiaedvafaesrirretiAAEDVLHdLGAF---S  354
ident                                              |              
Sbjct GVAWE---------------------------------------PAIKFCQ-QVMGedrV  310
DSSP  LLLLH---------------------------------------HHHHHHH-HHHLhhhE


DSSP  EEELLLLLllLLLL-hHHHHHHHHhhhhhhhlllllllllllhhHHHHHHHLLLHHHHHH
Query LTSSDSQAmgRVGE-vILRTWQVAhrmkvqrgalaeetgdndnfRVKRYIAKYTINPALT  413
ident     |                                                  |    
Sbjct MYAMDYPY--QYVAdeVRAMDAMD-------------------mSAQTKKKFFQTNAEKW  349
DSSP  ELLLLLLL--LLLHhhHHHHHLLL-------------------lLHHHHHHHHLHHHHHH


DSSP  LLLlllllllllllllleeeelhhhlllllleeeelleeeeeeellllllllllllleee
Query HGIahevgsievgkladlvvwspaffgvkpatvikggmiaiapmgdinasiptpqpvhyr  473
ident                                                             
Sbjct FKL---------------------------------------------------------  352
DSSP  LLL---------------------------------------------------------


DSSP  elhhhlhhhhhhhleeeelhhhhhhlhhhhllllleeeellllllllhhhllllllllle
Query pmfgalgsarhhcrltflsqaaaangvaerlnlrsaiavvkgcrtvqkadmvhnslqpni  533
ident                                                             
Sbjct ------------------------------------------------------------  352
DSSP  ------------------------------------------------------------


DSSP  eelllllleeelleellllllllllllllllll
Query tvdaqtyevrvdgelitsepadvlpmaqryflf  566
ident                                  
Sbjct ---------------------------------  352
DSSP  ---------------------------------


No 46: Query=1a5kC Sbjct=4hk5D Z-score=11.6

back to top
DSSP  leeehhhhhhhhlllllleeelllllleeelleellllllllllllllllllllllllll
Query snisrqayadmfgptvgdkvrladtelwieveddlttygeevkfgggkvirdgmgqgqml   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhhllleeeeeeeeeelleeeeeeeeeelleeeeeeleellllllllleellllleeeel
Query aadcvdlvltnalivdhwgivkadigvkdgrifaigkagnpdiqpnvtipigaateviaa  120
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  llleeEELEEEEEEELL-------------------------------------------
Query egkivTAGGIDTHIHWI-------------------------------------------  137
ident      |    | | |                                             
Sbjct -----TPVVVDIHTHMYppsyiamlekrqtiplvrtfpqadeprlillsselaaldaala   55
DSSP  -----LLLLEEEEEEELlhhhhhhhhlllllleeeeelleeeeeeellhhhhhhhhhhhh


DSSP  -----------------LLLHHHHHHHHLEEEEEEELllllhhHHHL--------llllH
Query -----------------CPQQAEEALVSGVTTMVGGGtgpaagTHAT--------tctpG  172
ident                    |        |    |                          
Sbjct dpaaklpgrplsthfasLAQKMHFMDTNGIRVSVISL------ANPWfdflapdeapgiA  109
DSSP  lllllllleellhhhllHHHHHHHHHHLLLLEEEEEE------LLLLllllllllhhhhH


DSSP  HHHHHHHHHHHLLLLLEEEEEEELLL-----lLHHHHHHHHHHL-LLEEEEEHHHL--LL
Query PWYISRMLQAADSLPVNIGLLGKGNV-----sQPDALREQVAAG-VIGLEIHEDWG--AT  224
ident                                                |            
Sbjct DAVNAEFSDMCAQHVGRLFFFAALPLsapvdaVKASIERVKNLKyCRGIILGTSGLgkGL  169
DSSP  HHHHHHHHHHHHLLLLLEEEEEELLLlllhhhHHHHHHHHHLLLlEEEEEELLLLLllLL


DSSP  HH-hhHHHHHHHHHHLLEEEEEL----------------------------LLLLllllH
Query PA-aiDCALTVADEMDIQVALHS----------------------------DTLNesgfV  255
ident                   | ||                              |      |
Sbjct DDphlLPVFEAVADAKLLVFLHPhyglpnevygprseeyghvlplalgfpmETTI---aV  226
DSSP  LLhhhHHHHHHHHHLLLEEEELLlllllhhhhlllhhhlllhhhhhlhhhhHHHH---hH


DSSP  HHHH--HHHL---LLLEEELLLLLlllllllLHHH-------------------------
Query EDTL--AAIG---GRTIHTFHTEGaggghapDIIT-------------------------  285
ident                     |  |                                    
Sbjct ARMYmaGVFDhvrNLQMLLAHSGG-------TLPFlagriescivhdghlvktgkvpkdr  279
DSSP  HHHHhlLHHHhllLLLEEEHHHHL-------LHHHhhhhhhhhhhllhhhhhllllllll


DSSP  ----hhHLLLEEEEEEhhHLLLlllhhhhhhhhhhhhhllllllhhhhhlllllllhhhh
Query ----acAHPNILPSSTnpTLPYtlntidehldmlmvchhldpdiaedvafaesrirreti  341
ident           |                                                 
Sbjct rtiwtvLKEQIYLDAV--IYSE--------------------------------------  299
DSSP  llhhhhHHHLEEEELL--LLLH--------------------------------------


DSSP  hHHHHHHHL---LLLLEEELLLLLL--------llllLHHHHHHHHHHHhhhhhllllll
Query aAEDVLHDL---GAFSLTSSDSQAM--------grvgEVILRTWQVAHRmkvqrgalaee  390
ident                     |                   |    |              
Sbjct -VGLQAAIAssgADRLMFGTDHPFFppieedvqgpwdSSRLNAQAVIKA-----------  347
DSSP  -HHHHHHHHhhlHHHEELLLLLLLLlllllllllllhHHHHHHHHHHHH-----------


DSSP  lllllhhHHHHHHHLLLHHHHHHLLLLLLLlllllllllleeeelhhhlllllleeeELL
Query tgdndnfRVKRYIAKYTINPALTHGIAHEVgsievgkladlvvwspaffgvkpatviKGG  450
ident              |    |         |                               
Sbjct ----vgeGSSDAAAVMGLNAVRVLSLKAEL-------------------------ehHHH  378
DSSP  ----hllLLHHHHHHHLHHHHHHLLLHHHH-------------------------hhHHH


DSSP  EEeeeeellllllllllllleeeelhhhlhhhhhhhleeeelhhhhhhlhhhhlllllee
Query MIaiapmgdinasiptpqpvhyrpmfgalgsarhhcrltflsqaaaangvaerlnlrsai  510
ident                                                             
Sbjct HH----------------------------------------------------------  380
DSSP  HL----------------------------------------------------------


DSSP  eellllllllhhhllllllllleeelllllleeelleellllllllllllllllll
Query avvkgcrtvqkadmvhnslqpnitvdaqtyevrvdgelitsepadvlpmaqryflf  566
ident                                                         
Sbjct --------------------------------------------------------  380
DSSP  --------------------------------------------------------


No 47: Query=1a5kC Sbjct=4dziC Z-score=10.6

back to top
DSSP  leeehhhhhhhhlllllleeelllllleeelleellllllllllllllllllllllllll
Query snisrqayadmfgptvgdkvrladtelwieveddlttygeevkfgggkvirdgmgqgqml   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhhllleeeeeeeeeelleeeeeeeeeelleeeeeeleellllllllleellllleeeel
Query aadcvdlvltnalivdhwgivkadigvkdgrifaigkagnpdiqpnvtipigaateviaa  120
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  llleeEELEEEEEEELL-------------------------------------------
Query egkivTAGGIDTHIHWI-------------------------------------------  137
ident          ||   |                                             
Sbjct ---alNYRVIDVDNHYYepldsftrhldkkfkrrgvqmlsdgkrtwavigdrvnhfipnp   57
DSSP  ---llLLLEEEEEEELLlllllllllllhhhlllleeeeelllleeeeelleelllllll


DSSP  ------------------------------------------LLLHHHHHHHHLEEEEEE
Query ------------------------------------------CPQQAEEALVSGVTTMVG  155
ident                                                         |   
Sbjct tfdpiivpgcldllfrgeipdgvdpaslmkverladhpeyqnRDARIAVMDEQDIETAFM  117
DSSP  lllleelllllhhhhhllllllllhhhllleelhhhlhhhllHHHHHHHHHHHLEEEEEE


DSSP  ELllllhhHHHL----------------lllLHHHHHHHHHhhHLLLllEEEEEEELLLL
Query GGtgpaagTHAT----------------tctPGPWYISRMLqaADSLpvNIGLLGKGNVS  199
ident         |                         |               |         
Sbjct LP------TFGCgveealkhdieatmasvhaFNLWLDEDWGfdRPDH--RIIAAPIVSLA  169
DSSP  EL------LHHHhhhhhllllhhhhhhhhhhHHHHHHHHLLllLLLL--LEEELLLLLLL


DSSP  ----LHHHHHHHHHHLLLEEEEEHhhlLLHH-----------hhHHHHHHHHHHLLEEEE
Query ----QPDALREQVAAGVIGLEIHEdwgATPA-----------aiDCALTVADEMDIQVAL  244
ident              | |           |                |       |    |  
Sbjct dptrAVEEVDFVLARGAKLVLVRP---APVPglvkprslgdrshDPVWARLAEAGVPVGF  226
DSSP  lhhhHHHHHHHHHHLLLLLEELLL---LLLLllllllllllhhhHHHHHHHHHHLLLEEE


DSSP  E---------------------------lLLLLllllHHHHH-HHHLL----LLEEELLL
Query H---------------------------sDTLNesgfVEDTL-AAIGG----RTIHTFHT  272
ident |                                                           
Sbjct HlsdsgylhiaaawggakdpldqvllddrAIHD---tMASMIvHGVFTrhpkLKAVSIEN  283
DSSP  EllllllhhhhhhllllllhhhhhhhllhHHHH---hHHHHHhLLHHHhlllLLEEEELL


DSSP  LLlllllllLHHH----------------------hhHLLLEEEEEehhHLLLlllhhhh
Query EGaggghapDIIT----------------------acAHPNILPSStnpTLPYtlntide  310
ident                                         |                   
Sbjct GS-------YFVHrlikrlkkaantqpqyfpedpveqLRNNVWIAP---YYED-------  326
DSSP  LL-------LHHHhhhhhhhhhhhhlhhhllllhhhhHHHHEEELL---LLLL-------


DSSP  hhhhhhhhhllllllhhhhhlllllllhhhhhhHHHHHHL---LLLLEEELLLLL-LLLL
Query hldmlmvchhldpdiaedvafaesrirretiaaEDVLHDL---GAFSLTSSDSQA-MGRV  366
ident                                                |  ||     |  
Sbjct ---------------------------------DLPELARvigVDKILFGSDWPHgEGLA  353
DSSP  ---------------------------------LHHHHHHhhlHHHLLLLLLLLLlLLLL


DSSP  lLHHHHHhHHHHHhhhhhlllllllllllhhHHHHHHHLLLHHHHHHLLlllllllllll
Query gEVILRTwQVAHRmkvqrgalaeetgdndnfRVKRYIAKYTINPALTHGiahevgsievg  426
ident       |                                   |     |           
Sbjct -SPVSFT-AELKG-----------------fSESDIRKIMRDNALDLLG-----------  383
DSSP  -LHHHHH-HHHLL-----------------lLHHHHHHHHLHHHHHHHL-----------


DSSP  lllleeeelhhhlllllleeeelleeeeeeellllllllllllleeeelhhhlhhhhhhh
Query kladlvvwspaffgvkpatvikggmiaiapmgdinasiptpqpvhyrpmfgalgsarhhc  486
ident                                                             
Sbjct ------------------------------------------------------------  383
DSSP  ------------------------------------------------------------


DSSP  leeeelhhhhhhlhhhhllllleeeellllllllhhhllllllllleeelllllleeell
Query rltflsqaaaangvaerlnlrsaiavvkgcrtvqkadmvhnslqpnitvdaqtyevrvdg  546
ident                                                             
Sbjct ------------------------------------------------------------  383
DSSP  ------------------------------------------------------------


DSSP  eellllllllllllllllll
Query elitsepadvlpmaqryflf  566
ident                     
Sbjct ---------------vqvgs  388
DSSP  ---------------lllll


No 48: Query=1a5kC Sbjct=1j5sA Z-score=10.4

back to top
DSSP  leeehhhhhhhhlllllleeELLL-LLLEeelleelllllllllllllllllllllllll
Query snisrqayadmfgptvgdkvRLAD-TELWieveddlttygeevkfgggkvirdgmgqgqm   59
ident                                                             
Sbjct ----------------hmflGEDYlLTNR-------------------------------   13
DSSP  ----------------llllLLLLlLLLH-------------------------------


DSSP  lhhhllleeeeeeeeeelleeeeeeeeeelleeeeeeleellllllllleellllleeee
Query laadcvdlvltnalivdhwgivkadigvkdgrifaigkagnpdiqpnvtipigaatevia  119
ident                                                             
Sbjct --------------------------------------------------------aavr   17
DSSP  --------------------------------------------------------hhhh


DSSP  lllleeEELEEEEEEELLLLL---------------------------------------
Query aegkivTAGGIDTHIHWICPQ---------------------------------------  140
ident            | | |                                            
Sbjct lfnevkDLPIVDPHNHLDAKDivenkpwndiwevegatdhyvwelmrrcgvseeyitgsr   77
DSSP  hhhhhlLLLEEELLLLLLHHHhhhllllllhhhhhllllhhhhhhhhhllllhhhlllll


DSSP  -----------------------------------------------------------H
Query -----------------------------------------------------------Q  141
ident                                                             
Sbjct snkekwlalakvfprfvgnptyewihldlwrrfnikkviseetaeeiweetkkklpemtP  137
DSSP  lhhhhhhhhhhhhhhhlllhhhhhhhhhhhhhllllllllhhhhhhhhhhhhhhlllllH


DSSP  HHHHHHHLEEEEEEElllllhhhhhlllLLHHHHhHHHHHH-HLLL-LLEEEEEEELL--
Query AEEALVSGVTTMVGGgtgpaagthattcTPGPWYiSRMLQA-ADSL-PVNIGLLGKGN--  197
ident         |                                       | |         
Sbjct QKLLRDMKVEILCTT-------------DDPVST-LEHHRKaKEAVeGVTILPTWRPDra  183
DSSP  HHHHHHLLEEEEELL-------------LLLLLL-LHHHHHhHHHLlLLEEELLLLLHhh


DSSP  --------------------------llLHHHHHHHHHHL----LLEEEEEH--------
Query --------------------------vsQPDALREQVAAG----VIGLEIHE--------  219
ident                                ||                           
Sbjct mnvdkegwreyvekmgerygedtstldgFLNALWKSHEHFkehgCVASDHALlepsvyyv  243
DSSP  hllllllhhhhhhhhhhhhllllllhhhHHHHHHHHHHHHhlllLLEEEEEEllllllll


DSSP  ----------------------hhlllhHHHHHHHHHHHHHLLEEEEELLLL--------
Query ----------------------dwgatpAAIDCALTVADEMDIQVALHSDTL--------  249
ident                                        |      ||   |        
Sbjct denraravhekafsgekltqdeindykaFMMVQFGKMNQETNWVTQLHIGALrdyrdslf  303
DSSP  lhhhhhhhhhhhlllllllhhhhhhhhhHHHHHHHHHHHHHLLEEEEEELEEllllhhhh


DSSP  -------------lLLLLHHHHHHHHLLL----LEEEllLLLLlllllLLHHHHHH-LLL
Query -------------nESGFVEDTLAAIGGR----TIHTfhTEGAggghaPDIITACA-HPN  291
ident                    |              |             | | |     ||
Sbjct ktlgpdsggdistnFLRIAEGLRYFLNEFdgklKIVL--YVLD-pthlPTISTIARaFPN  360
DSSP  hhlllllllleellLLLHHHHHHHHHHHLllllLEEE--EELL-hhhhHHHHHHHHhLLL


DSSP  EEEEEE--hHHLLLlllhhhhhhhhhhhhhllllllhhhhhlllllllhhhhHHHHHHHH
Query ILPSST--nPTLPYtlntidehldmlmvchhldpdiaedvafaesrirretiAAEDVLHD  349
ident             |                                               
Sbjct VYVGAPwwfNDSPF------------------------------------gmEMHLKYLA  384
DSSP  EEELLLlllLLLHH------------------------------------hhHHHHHHHH


DSSP  L---LLLL-EEELLLLlllLLLL-HHHHHHHHHHHHHHHHLLlLLLLllllHHHHHHHHH
Query L---GAFS-LTSSDSQamgRVGE-VILRTWQVAHRMKVQRGAlAEETgdndNFRVKRYIA  404
ident              ||      |                                      
Sbjct SvdlLYNLaGMVTDSRkllSFGSrTEMFRRVLSNVVGEMVEKgQIPI----KEARELVKH  440
DSSP  LlllHHHLlLLLLLLLlllHHHHhHHHHHHHHHHHHHHHHHLlLLLH----HHHHHHHHH


DSSP  LLLHHHHHHLLllllllllllllllleeeelhhhlllllleeeelleeeeeeelllllll
Query KYTINPALTHGiahevgsievgkladlvvwspaffgvkpatvikggmiaiapmgdinasi  464
ident      |                                                      
Sbjct VSYDGPKALFF-------------------------------------------------  451
DSSP  HHLHHHHHHHL-------------------------------------------------


DSSP  lllllleeeelhhhlhhhhhhhleeeelhhhhhhlhhhhllllleeeellllllllhhhl
Query ptpqpvhyrpmfgalgsarhhcrltflsqaaaangvaerlnlrsaiavvkgcrtvqkadm  524
ident                                                             
Sbjct ------------------------------------------------------------  451
DSSP  ------------------------------------------------------------


DSSP  lllllllleeelllllleeelleellllllllllllllllll
Query vhnslqpnitvdaqtyevrvdgelitsepadvlpmaqryflf  566
ident                                           
Sbjct ------------------------------------------  451
DSSP  ------------------------------------------


No 49: Query=1a5kC Sbjct=1v77A Z-score=10.1

back to top
DSSP  leeehhhhhhhhlllllleeelllllleeelleellllllllllllllllllllllllll
Query snisrqayadmfgptvgdkvrladtelwieveddlttygeevkfgggkvirdgmgqgqml   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhhllleeeeeeeeeelleeeeeeeeeelleeeeeeleellllllllleellllleeeel
Query aadcvdlvltnalivdhwgivkadigvkdgrifaigkagnpdiqpnvtipigaateviaa  120
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  llleeeELEEEEEEELLllLHHHHHHHHlEEEEEEELllllhhhhhlllllHHHHHHHHH
Query egkivtAGGIDTHIHWIcpQQAEEALVSgVTTMVGGGtgpaagthattctpGPWYISRML  180
ident          |   |        | |        |                          
Sbjct ------VKFIEMDIRDK--EAYELAKEW-FDEVVVSI--------kfneevDKEKLREAR   43
DSSP  ------LLLEEEEELLH--HHHHHHHHH-LLEEEEEE--------eellllLHHHHHHHH


DSSP  HHHllllleEEEEeelllllhhhhhhhhhhllleEEEEHhhlLLHHHHHHHHHHHHhhLL
Query QAAdslpvnIGLLgkgnvsqpdalreqvaagvigLEIHEdwgATPAAIDCALTVADemDI  240
ident                                             |               
Sbjct KEY------GKVA---------------------ILLSN---PKPSLVRDTVQKFK--SY   71
DSSP  HHH------LLEE---------------------EEEEL---LLHHHHHHHHHHLL--LL


DSSP  EEEEELLlllllllHHHHHHHHlLLLE-EELLLLLLllllLLLHHH--hhHLLL----EE
Query QVALHSDtlnesgfVEDTLAAIgGRTI-HTFHTEGAggghAPDIIT--acAHPN----IL  293
ident      |                                    |       |         
Sbjct LIYVESN-------DLRVIRYSiEKGVdAIISPWVN----RKDPGIdhvlAKLMvkknVA  120
DSSP  EEEEELL-------LHHHHHHHhHLLLlEEELLLLL----LLLLLLlhhhHHHHhhhlLE


DSSP  EEEEHHHllllllHHHHhhhhhhhhhllllllhhhhhlllllLLHHHHHHHHHHHHLLL-
Query PSSTNPTlpytlnTIDEhldmlmvchhldpdiaedvafaesrIRRETIAAEDVLHDLGA-  352
ident                                            |            |   
Sbjct LGFSLRP----llYSNP------------------------yERANLLRFMMKAWKLVEk  152
DSSP  EEEELHH----hhHLLH------------------------hHHHHHHHHHHHHHHHHHh


DSSP  ---lLEEELLLLLllLLLLhHHHH-HHHHHhhhhhhlllllllllllhhHHHHHHHLLLH
Query ---fSLTSSDSQAmgRVGEvILRT-WQVAHrmkvqrgalaeetgdndnfRVKRYIAKYTI  408
ident         |  |    |                                      |    
Sbjct ykvrRFLTSSAQEkwDVRY-PRDLiSLGVV----------------igmEIPQAKASISM  195
DSSP  hlllEEEELLLLLhhHLLL-HHHHhHHHHH----------------lllLHHHHHHLLLH


DSSP  HHHHHLLllllllllllllllleeeelhhhlllllleeeelleeeeeeelllllllllll
Query NPALTHGiahevgsievgkladlvvwspaffgvkpatvikggmiaiapmgdinasiptpq  468
ident  |                                                          
Sbjct YPEIILK-----------------------------------------------------  202
DSSP  HHHHHHL-----------------------------------------------------


DSSP  lleeeelhhhlhhhhhhhleeeelhhhhhhlhhhhllllleeeellllllllhhhlllll
Query pvhyrpmfgalgsarhhcrltflsqaaaangvaerlnlrsaiavvkgcrtvqkadmvhns  528
ident                                                             
Sbjct ------------------------------------------------------------  202
DSSP  ------------------------------------------------------------


DSSP  lllleeelllllleeelleellllllllllllllllll
Query lqpnitvdaqtyevrvdgelitsepadvlpmaqryflf  566
ident                                       
Sbjct --------------------------------------  202
DSSP  --------------------------------------


No 50: Query=1a5kC Sbjct=3iacA Z-score=9.8

back to top
DSSP  leeehhhhhhhhlllllleeeLLLL---LLEEelleelllllllllllllllllllllll
Query snisrqayadmfgptvgdkvrLADT---ELWIeveddlttygeevkfgggkvirdgmgqg   57
ident                                                             
Sbjct ---------------atfxteDFLLkndIART----------------------------   17
DSSP  ---------------llllllLLLLllhHHHH----------------------------


DSSP  lllhhhllleeeeeeeEEELleeeeeeeeeelleeeeeeleellllllllleelllllee
Query qmlaadcvdlvltnalIVDHwgivkadigvkdgrifaigkagnpdiqpnvtipigaatev  117
ident                                                             
Sbjct --------------lyHKYA----------------------------------------   23
DSSP  --------------hhHHLL----------------------------------------


DSSP  eelllleeEELEEEEEEELLLLL-------------------------------------
Query iaaegkivTAGGIDTHIHWICPQ-------------------------------------  140
ident              | | |                                          
Sbjct -------aPXPIYDFHCHLSPQEiaddrrfdnlgqiwlegdhykwralrsagvdeslitg   76
DSSP  -------lLLLEEELLLLLLHHHhhhllllllhhhhhhllllhhhhhhhhllllhhhlll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  140
ident                                                             
Sbjct ketsdyekyxawantvpktlgnplyhwthlelrrpfgitgtlfgpdtaesiwtqcnekla  136
DSSP  llllhhhhhhhhhhhhhhllllhhhhhhhhhhhlllllllllllhhhhhhhhhhhhhhhl


DSSP  -----HHHHHHHHLEEEEEEElllllhhhhhllLLLHHHhhHHHHHHHLL---LLLEEEE
Query -----QAEEALVSGVTTMVGGgtgpaagthattCTPGPWyiSRMLQAADS---LPVNIGL  192
ident               |                    |                        
Sbjct tpafsARGIXQQXNVRXVGTT------------DDPIDS--LEYHRQIAAddsIDIEVAP  182
DSSP  lhhhlHHHHHHHLLEEEEELL------------LLLLLL--LHHHHHHHHlllLLLEEEL


DSSP  EEELLLL----------------------------LHHHHHHHHHHL----LLEEEEEHH
Query LGKGNVS----------------------------QPDALREQVAAG----VIGLEIHED  220
ident                                       ||                    
Sbjct SWRPDKVfkieldgfvdylrkleaaadvsitrfddLRQALTRRLDHFaacgCRASDHGIE  242
DSSP  LLLLHHHhllllllhhhhhhhhhhhhllllllhhhHHHHHHHHHHHHhhllLLEEEEEEL


DSSP  -------------------------------hllLHHHHHHHHHHHHHHLLEEEEELLL-
Query -------------------------------wgaTPAAIDCALTVADEMDIQVALHSDT-  248
ident                                   | |                 ||    
Sbjct tlrfapvpddaqldailgkrlagetlseleiaqfTTAVLVWLGRQYAARGWVXQLHIGAi  302
DSSP  lllllllllhhhhhhhhhhhhllllllhhhhhhhHHHHHHHHHHHHHHHLLEEEEEELEe


DSSP  --------------------LLLLlLHHHHHHHHLLL-------LEEELlllllllLLLL
Query --------------------LNESgFVEDTLAAIGGR-------TIHTFhtegaggGHAP  281
ident                                                            |
Sbjct rnnntrxfrllgpdtgfdsiGDNN-ISWALSRLLDSXdvtnelpKTILY-------CLNP  354
DSSP  llllhhhhhhhllllllleeLLLL-LHHHHHHHHHHHhllllllEEEEE-------ELLH


DSSP  LHH-HHHHLL----------LEEEEE--ehhHLLLlllhhhhhhhhhhhhhllllllhhh
Query DII-TACAHP----------NILPSS--tnpTLPYtlntidehldmlmvchhldpdiaed  328
ident                          |                                  
Sbjct RDNeVLATXIgnfqgpgiagKVQFGSgwwfnDQKD-------------------------  389
DSSP  HHHhHHHHHHhhllllllllLEEELLllhhhLLHH-------------------------


DSSP  hhlllllllhhHHHHHHHH----hhLLLLLEEELLLLLllLLLLHHHHHHHHHHHHHHHH
Query vafaesrirreTIAAEDVL----hdLGAFSLTSSDSQAmgRVGEVILRTWQVAHRMKVQR  384
ident                          |  |     ||                      | 
Sbjct -----------GXLRQLEQlsqxglLSQFVGXLTDSRS-fLSYTRHEYFRRILCNLLGQW  437
DSSP  -----------HHHHHHHHhhhhllHHHLLLLLLLLLL-lLLLHHHHHHHHHHHHHHHHH


DSSP  LL--lLLLLlllLHHHHHHHHHLLLHHHHHHLLLlllllllllllllleeeelhhhllll
Query GA--lAEETgdnDNFRVKRYIAKYTINPALTHGIahevgsievgkladlvvwspaffgvk  442
ident                           |      |                          
Sbjct AQdgeIPDD---EAXLSRXVQDICFNNAQRYFTI--------------------------  468
DSSP  HHlllLLLL---HHHHHHHHHHHHLHHHHHHLLL--------------------------


DSSP  lleeeelleeeeeeellllllllllllleeeelhhhlhhhhhhhleeeelhhhhhhlhhh
Query patvikggmiaiapmgdinasiptpqpvhyrpmfgalgsarhhcrltflsqaaaangvae  502
ident                                                             
Sbjct ------------------------------------------------------------  468
DSSP  ------------------------------------------------------------


DSSP  hllllleeeellllllllhhhllllllllleeelllllleeelleellllllllllllll
Query rlnlrsaiavvkgcrtvqkadmvhnslqpnitvdaqtyevrvdgelitsepadvlpmaqr  562
ident                                                             
Sbjct ------------------------------------------------------------  468
DSSP  ------------------------------------------------------------


DSSP  llll
Query yflf  566
ident     
Sbjct ---k  469
DSSP  ---l


No 51: Query=1a5kC Sbjct=2a3lA Z-score=7.7

back to top
DSSP  leeehhhhhhhhlllllleeelllllLEEELL----------------------------
Query snisrqayadmfgptvgdkvrladteLWIEVE----------------------------   32
ident                                                             
Sbjct ----------------------qpdpIAADILrkepeqetfvrlnvplevptsdeveayk   38
DSSP  ----------------------llllLLLLLLllllllllllllllllllllllllllhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------   32
ident                                                             
Sbjct clqeclelrkryvfqetvapwekeepfahypqgksdhcfemqdgvvhvfankdakedlfp   98
DSSP  hhhhhhhhhhllllllllllllllllllllllllllllllllllllllllllllllllll


DSSP  -----------------eellllllllllllllllllllllllllhhhllleeeeeEEEE
Query -----------------ddlttygeevkfgggkvirdgmgqgqmlaadcvdlvltnALIV   75
ident                                                             
Sbjct vadatafftdlhhvlkviaagnirtlchrrlvlleqkfnlhlmlnadkeflaqksaPHRD  158
DSSP  lllhhhhhhhhhhhhhhlllhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhlLLLL


DSSP  ElleeeeeeeeeelleeeeeeleellllllllleellllleeeelllleeEELEEEEEEE
Query DhwgivkadigvkdgrifaigkagnpdiqpnvtipigaateviaaegkivTAGGIDTHIH  135
ident                                                        ||| |
Sbjct F------------------------------------------------yNVRKVDTHVH  170
DSSP  L------------------------------------------------lLLLEEEEEEE


DSSP  LL----------------------------------------------------------
Query WI----------------------------------------------------------  137
ident                                                             
Sbjct HSacmnqkhllrfiksklrkepdevvifrdgtyltlrevfesldltgydlnvdlldvhad  230
DSSP  LLllllhhhhhhhhhhhhhllllllleeelleeelhhhhhhhhlllllllllllllllll


DSSP  -----------------------------------------LLLHHHHHH-HHLEeEEEE
Query -----------------------------------------CPQQAEEAL-VSGVtTMVG  155
ident                                            |                
Sbjct kstfhrfdkfnlkynpcgqsrlreiflkqdnliqgrflgeiTKQVFSDLEaSKYQ-MAEY  289
DSSP  llllllllllhhhhllllllhhhhhhlllllllllllhhhhHHHHHHHHLlLLLE-EEEE


DSSP  elllllhhhhhlLLLL------HHHHHHHHHHHhLLLLLEEEEEEELLL-----------
Query ggtgpaagthatTCTP------GPWYISRMLQAaDSLPVNIGLLGKGNV-----------  198
ident                                   |    |   |                
Sbjct ------------RISIygrkmsEWDQLASWIVNnDLYSENVVWLIQLPRlyniykdmgiv  337
DSSP  ------------EEELllllllHHHHHHHHHHLlLLLLLLEEEEEEEELlhhhhllllll


DSSP  ----lLHHHHHH----------------hhhhlLLEEEEEHH------------------
Query ----sQPDALRE----------------qvaagVIGLEIHED------------------  220
ident        |                         | |     |                  
Sbjct tsfqnILDNIFIplfeatvdpdshpqlhvflkqVVGFDLVDDeskperrptkhmptpaqw  397
DSSP  lllhhHHHHHLLhhhhhhhlhhhllllhhhhllEEEEEEELLllllllllllllllllll


DSSP  ----hllLHHHHHHHHHHHHHH----------LLEEEEELllllllLLHHhHHHHHLLLL
Query ----wgaTPAAIDCALTVADEM----------DIQVALHSdtlnesGFVEdTLAAIGGRT  266
ident                                  |    ||      |     |||     
Sbjct tnafnpaFSYYVYYCYANLYVLnklreskgmtTITLRPHS---geaGDID-HLAATFLTC  453
DSSP  lllllllHHHHHHHHHHHHHHHhhhhllllllLLEELLLL---lllLLLH-HHHHHHHHL


DSSP  EEELLLLllllllllLHHH------hHHLLLEEEEEEHHHllllllhhhhhhhhhhhhhl
Query IHTFHTEgaggghapDIIT------aCAHPNILPSSTNPTlpytlntidehldmlmvchh  320
ident     |                          |                            
Sbjct HSIAHGI--------NLRKspvlqylYYLAQIGLAMSPLS--------------------  485
DSSP  LLLLLLH--------HHHHlhhhhhhHHHHLLLEEELHHH--------------------


DSSP  lllllhhhhhllllLLLHhhHHHHHHHHHLLLLLEEELLLLLLLL--lLLHHHHHHHHHH
Query ldpdiaedvafaesRIRRetIAAEDVLHDLGAFSLTSSDSQAMGR--vGEVILRTWQVAH  378
ident                          |    |     | |                   | 
Sbjct -----------nnsLFLDyhRNPFPVFFLRGLNVSLSTDDPLQIHltkEPLVEEYSIAAS  534
DSSP  -----------hllLLLLllLLLHHHHHHLLLLEEELLLLHHHHLlllLHHHHHHHHHHH


DSSP  HHHhhhlllllllllllhhHHHHHHHLlLHHHHHHLLLLLLLL--LLLLLLllleeeelh
Query RMKvqrgalaeetgdndnfRVKRYIAKyTINPALTHGIAHEVG--SIEVGKladlvvwsp  436
ident   |                           |     |  |      |             
Sbjct VWK---------------lSACDLCEI-ARNSVYQSGFSHALKshWIGKDY---------  569
DSSP  HHL---------------lLHHHHHHH-HHHHHHHLLLLHHHHhhHLLLLL---------


DSSP  hhlllllleeeelleeeeeeellllllllllllleeeelhhhlhhhhhhhleeeelhhhh
Query affgvkpatvikggmiaiapmgdinasiptpqpvhyrpmfgalgsarhhcrltflsqaaa  496
ident                                                             
Sbjct ------------------------------------------------------------  569
DSSP  ------------------------------------------------------------


DSSP  hhlhhhhllllleeeellllllllhhhllllllllleeelllllleeelleellllllll
Query angvaerlnlrsaiavvkgcrtvqkadmvhnslqpnitvdaqtyevrvdgelitsepadv  556
ident                                                             
Sbjct -----------------------ykrgpdgndihktnvphirvefrdtiwkeemqqvylg  606
DSSP  -----------------------llllhhhllhhhhlllhhhhhhhhhhhhhhhhhhlll


DSSP  llllllllll
Query lpmaqryflf  566
ident           
Sbjct kavisdevvp  616
DSSP  llllllllll


No 52: Query=1a5kC Sbjct=3au2A Z-score=7.5

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct mrnqelarifeeiglmseflgdnpfrvrayhqaartlydldtpieeiaekgkealmelpg   60
DSSP  llhhhhhhhhhhhhhhhhhllllhhhhhhhhhhhhhhhhllllhhhhhlllhhhhlllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct vgpdlaekileflrtgkvrkheelsrkvprgvlevmevpgvgpktarllyeglgidslek  120
DSSP  llhhhhhhhhhhhhhlllhhhhhhhhhllhhhhhhhllllllhhhhhhhhhhhllllhhh


DSSP  ---------------------------------------------------leeeHHHHH
Query ---------------------------------------------------snisRQAYA    9
ident                                                             
Sbjct lkaaldrgdltrlkgfgpkraerireglalaqaagkrrplgavlslarslleairALPGV  180
DSSP  hhhhhhhlhhhhlllllhhhhhhhhhhhhhhhhlllleehhhhhhhhhhhhhhhhLLLLL


DSSP  HhhlllllLEEEllLLLL------------------------------------------
Query DmfgptvgDKVRlaDTEL------------------------------------------   27
ident                                                             
Sbjct E------rAELC-gSARRykdtvgdldflvasregeravegfvrlpqvkevyakgkerat  233
DSSP  L------eEEEL-hHHHLllleelleeeeeelllhhhhhhhhhlllleeeeeeellleee


DSSP  ---------------------------------------------------------eee
Query ---------------------------------------------------------wie   30
ident                                                             
Sbjct vflknglqvdlrvvppesygaglqyltgskahsirlralaqekglklseygvfrgekria  293
DSSP  eeelllleeeeeeelhhhhhhhhhhhhllhhhhhhhhhhhhhllleeelleeeelleeee


DSSP  llEELLllllllllllllllllllllllllhhhllleeeeeeeeeelleeeeeeeeeell
Query veDDLTtygeevkfgggkvirdgmgqgqmlaadcvdlvltnalivdhwgivkadigvkdg   90
ident                                                             
Sbjct geTEEE------------------------------------------------------  299
DSSP  llLHHH------------------------------------------------------


DSSP  eeeeeeleellllllllleellllleeeelllleeEELEEEEEEEL------LLLL-HHH
Query rifaigkagnpdiqpnvtipigaateviaaegkivTAGGIDTHIHW------ICPQ-QAE  143
ident                                         |   |              |
Sbjct vyaalglpwippplredqgeveaalegrlpkllelPQVKGDLQVHStysdgqNTLEeLWE  359
DSSP  hhhhlllllllhhhlllllhhhhhhlllllllllhHHLLEEEEELLllllllLLHHhHHH


DSSP  HHHHHLEEEEEEEL-llllhhhhhllllLHHHHHHHHHHHHL-LLLLEEEEEeelllllh
Query EALVSGVTTMVGGG-tgpaagthattctPGPWYISRMLQAAD-SLPVNIGLLgkgnvsqp  201
ident  |   |                                       |              
Sbjct AAKTMGYRYLAVTDhspavrvaggpspeEALKRVGEIRRFNEtHGPPYLLAG--------  411
DSSP  HHHHHLLLEEEEEEelhhhhllllllhhHHHHHHHHHHHHHHhHLLLEEEEE--------


DSSP  hhhhhhhhhllleEEEEhhhlLLHHhHHHHHHHhhhhllEEEEELLLLLLL---LLHHHH
Query dalreqvaagvigLEIHedwgATPAaIDCALTVademdiQVALHSDTLNES---GFVEDT  258
ident               |        |                |                   
Sbjct -------------AEVD----IHPDgTLDYPDWvlreldLVLVSVHSRFNLpkaDQTKRL  454
DSSP  -------------EEEE----LLLLlLLLLLHHhhllllEEEEELLLLLLLlhhHHHHHH


DSSP  HHHHLLLLE-EELLLLLL---llllLLLHH-HHHHL---LLEEEEEEHHHllllllhhhh
Query LAAIGGRTI-HTFHTEGA---ggghAPDII-TACAH---PNILPSSTNPTlpytlntide  310
ident | |          |                                              
Sbjct LKALENPFVhVLAHPTARllgrrapIEADWeAVFQKakeKGVAVEIDGYY----------  504
DSSP  HHHHLLLLLlEELLLLLLlllllllLLLLHhHHHHHhhhHLLEEEEELLL----------


DSSP  hhhhhhhhhllllllhhhhhlllllllhhhhhhHHHHHHLLL----lLEEELLLLLllLL
Query hldmlmvchhldpdiaedvafaesrirretiaaEDVLHDLGA----fSLTSSDSQAmgRV  366
ident                                   | |             | |       
Sbjct ----------------------------drmdlPDDLARMAYgmglwISLSTDAHQtdHL  536
DSSP  ----------------------------lllllLHHHHHHHHhllllEEEELLLLLhhHH


DSSP  LLHHHHHHHHHHhhhhhhlllllllllllhhhhhHHHHlllHHHHhhllLLLLlllllll
Query GEVILRTWQVAHrmkvqrgalaeetgdndnfrvkRYIAkytINPAlthgIAHEvgsievg  426
ident     |                                                       
Sbjct RFMELAVGTAQR---------------------aWIGP--eRVLN--tlDYED-------  564
DSSP  HHHHHHHHHHHH---------------------lLLLL--lLLHH--hlLHHH-------


DSSP  lllleeeelhhhlllllleeeelleeeeeeellllllllllllleeeelhhhlhhhhhhh
Query kladlvvwspaffgvkpatvikggmiaiapmgdinasiptpqpvhyrpmfgalgsarhhc  486
ident                                                             
Sbjct ------------------------------------------------------------  564
DSSP  ------------------------------------------------------------


DSSP  leeeelhhhhhhlhhhhllllleeeeLLLL-LLLLhhhllllllllleeelllllleeel
Query rltflsqaaaangvaerlnlrsaiavVKGC-RTVQkadmvhnslqpnitvdaqtyevrvd  545
ident                                                             
Sbjct -------------------------lLSWLkARRG-------------------------  574
DSSP  -------------------------hHHHHhLLLL-------------------------


DSSP  leellllllllllllllllll
Query gelitsepadvlpmaqryflf  566
ident                      
Sbjct --------------------v  575
DSSP  --------------------l


No 53: Query=1a5kC Sbjct=1m65A Z-score=7.3

back to top
DSSP  leeehhhhhhhhlllllleeelllllleeelleellllllllllllllllllllllllll
Query snisrqayadmfgptvgdkvrladtelwieveddlttygeevkfgggkvirdgmgqgqml   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhhllleeeeeeeeeelleeeeeeeeeelleeeeeeleellllllllleellllleeeel
Query aadcvdlvltnalivdhwgivkadigvkdgrifaigkagnpdiqpnvtipigaateviaa  120
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  llleeeelEEEEEEEL-------LLLL-HHHHHHHHLEEEEEEElllllhhhhhllLLLH
Query egkivtagGIDTHIHW-------ICPQ-QAEEALVSGVTTMVGGgtgpaagthattCTPG  172
ident           | | |                 |   |                       
Sbjct -------yPVDLHMHTvasthaySTLSdYIAQAKQKGIKLFAIT------------DHGP   41
DSSP  -------lLEELLLLLlllllllLLHHhHHHHHHHHLLLEEEEE------------EELL


DSSP  -------HHHHHHHHHhHLLLL--LEEEEEE-ELLL--LLHHHHH-HHHHhLLLEEEEEH
Query -------PWYISRMLQaADSLP--VNIGLLG-KGNV--SQPDALR-EQVAaGVIGLEIHE  219
ident         |    |          | |                                 
Sbjct dmedaphHWHFINMRI-WPRVVdgVGILRGIeANIKnvDGEIDCSgKMFD-SLDLIIAGF   99
DSSP  lllllllLHHHHHHHH-LLLEEllEEEEEEEeEELLllLLLLLLLhHHHH-HLLEEEEEL


DSSP  H--------hllLHHHHHHH-HHHHhhhllEEEEE-LLLLLLLLLHHHHHHHHLLLLEEE
Query D--------wgaTPAAIDCA-LTVAdemdiQVALH-SDTLNESGFVEDTLAAIGGRTIHT  269
ident                |                             |     |        
Sbjct HepvfaphdkatNTQAMIATiASGN-----VHIIShPGNPKYEIDVKAVAEAAAKHQVAL  154
DSSP  LllllllllhhhHHHHHHHHhHLLL-----LLEELlLLLLLLLLLHHHHHHHHHHHLLEE


DSSP  LLllllllllllLHHH-HHHLLlEEEEEE-----------HHHLlllllhhhhhhhhhhh
Query FHtegaggghapDIIT-ACAHPnILPSST-----------NPTLpytlntidehldmlmv  317
ident                                                             
Sbjct EI---nnssncrEVAAaVRDAG-GWVALGsdshtaftmgeFEEC----------------  194
DSSP  EE---ellllhhHHHHhHHHHL-LLEEEElllllhhhlllLHHH----------------


DSSP  hhllllllhhhhhlllllllhhhhHHHHHHhHLLL-LLEEelllllllllllhhhhhhhh
Query chhldpdiaedvafaesrirretiAAEDVLhDLGA-FSLTssdsqamgrvgevilrtwqv  376
ident                            |   |      |                     
Sbjct -----------------------lKILDAV-DFPPeRILN--------------------  210
DSSP  -----------------------hHHHHHL-LLLHhHLHH--------------------


DSSP  hhhhhhhhlllllllllllhhhhhhhhhLLLHHHHHHLlllllllllllllllleeeelh
Query ahrmkvqrgalaeetgdndnfrvkryiaKYTINPALTHgiahevgsievgkladlvvwsp  436
ident                                                             
Sbjct ----------------------------VSPRRLLNFL----------------------  220
DSSP  ----------------------------HLHHHHHHHH----------------------


DSSP  hhlllllleeeelleeeeeeellllllllllllleeeelhhhlhhhhhhhleeeelhhhh
Query affgvkpatvikggmiaiapmgdinasiptpqpvhyrpmfgalgsarhhcrltflsqaaa  496
ident                                                             
Sbjct ------------------------------------------------------------  220
DSSP  ------------------------------------------------------------


DSSP  hhlhhhhllllleeeelLLLLlllhhhllllllllleeelllllleeelleellllllll
Query angvaerlnlrsaiavvKGCRtvqkadmvhnslqpnitvdaqtyevrvdgelitsepadv  556
ident                                                             
Sbjct -----------------ESRG---------------------------------------  224
DSSP  -----------------HHLL---------------------------------------


DSSP  llllllllll
Query lpmaqryflf  566
ident           
Sbjct mapiaefadl  234
DSSP  llllhhhlll


No 54: Query=1a5kC Sbjct=3f2bA Z-score=6.8

back to top
DSSP  ---------------------------------------------------lEEEHHHHH
Query ---------------------------------------------------sNISRQAYA    9
ident                                                          |  
Sbjct vrrletiveeerrvvvqgyvfdaevselksgrtlltmkitdytnsilvkmfsRDKEDAEL   60
DSSP  lllhhhlllleeeeeeeeeeeeeeeeellllleeeeeeeelllleeeeeeelLLHHHHHH


DSSP  HH-hlllllleeelllllleeelleeLLLLlLLLLLllllllllllllllllhhhlllee
Query DM-fgptvgdkvrladtelwieveddLTTYgEEVKFgggkvirdgmgqgqmlaadcvdlv   68
ident                                                             
Sbjct MSgvkkgmwvkvrgsvqndtfvrdlvIIAN-DLNEI------------------------   95
DSSP  HHlllllleeeeeeeeeeelllleeeEEEE-EEEEE------------------------


DSSP  eeeeeeeelleeeeeeeeeelleeeeeeleellllllllleellllleeeelllleEEEL
Query ltnalivdhwgivkadigvkdgrifaigkagnpdiqpnvtipigaateviaaegkiVTAG  128
ident                                                             
Sbjct ----------------------------------------------aanerqdtapEGEK  109
DSSP  ----------------------------------------------llllllllllLLLL


DSSP  EEEEEEEL--------LLLL-HHHHHHHHLEEEEEEElllllhhhhhlLLLLhhhhhhHH
Query GIDTHIHW--------ICPQ-QAEEALVSGVTTMVGGgtgpaagthatTCTPgpwyisRM  179
ident     | |                | |   |                              
Sbjct RVELHLHTpmsqmdavTSVTkLIEQAKKWGHPAIAVT-----------DHAV-----vQS  153
DSSP  LLLLLLLLllllllllLLHHhHHHHHHHLLLLLEEEL-----------LLLL-----lLL


DSSP  HHH-HLLL---LLEEEEEeelllllhhhhhhhhhhllleEEEEhhhlLLHH---------
Query LQA-ADSL---PVNIGLLgkgnvsqpdalreqvaagvigLEIHedwgATPA---------  226
ident                                        ||                   
Sbjct FPEaYSAAkkhGMKVIYG---------------------LEAN----IVDDpfhvtllaq  188
DSSP  HHHhHHHHhhhLLLEEEE---------------------EEEE----EELLleeeeeeel


DSSP  ------------------------HHHH--HHHHHhhHLLEeeeelllllllllhhhhhh
Query ------------------------AIDC--ALTVAdeMDIQvalhsdtlnesgfvedtla  260
ident                          |                                  
Sbjct netglknlfklvslshiqyfhrvpRIPRsvLVKHR--DGLL-------------------  227
DSSP  lhhhhhhhhhhhhhhhllllllllLEEHhhHHHLL--LLEE-------------------


DSSP  hhllllEEELLllllLLLLlllHHHH--hHLLLE-EEEEEHHHllllllhhhhhhhhhhh
Query aiggrtIHTFHtegaGGGHapdIITA--cAHPNI-LPSSTNPTlpytlntidehldmlmv  317
ident                  |                       |                  
Sbjct ------VGSGC----DKGE---LFDNvedIARFYdFLEVHPPD-----------------  257
DSSP  ------EELLL----LLLL---LLLLlllLHHHLlLEEELLHH-----------------


DSSP  hhllllllhhhhhllllLLLH----HHHHHHHHHHHLLL----lLEEELLLL--------
Query chhldpdiaedvafaesRIRR----ETIAAEDVLHDLGA----fSLTSSDSQ--------  361
ident                                     ||                      
Sbjct --------------vykPLYVkdeeMIKNIIRSIVALGEkldipVVATGNVHylnpedki  303
DSSP  --------------hhlLLLLllhhHHHHHHHHHHHHHHhllllEEELLLLLlllhhhhh


DSSP  --------------------lLLLLlLHHHHHHHHHHHhhhhhlllllllllllhhHHHH
Query --------------------aMGRVgEVILRTWQVAHRmkvqrgalaeetgdndnfRVKR  401
ident                                                             
Sbjct yrkilihsqgganplnrhelpDVYF-RTTNEMLDCFSF-----------------lGPEK  345
DSSP  hhhhhhhllhhhlllllllllLLLL-LLHHHHHHHHHH-----------------hHHHH


DSSP  HHHLLLHHHHHHLLLlllllllllllllleeeelhhhlllllleeeelleeeeeeellll
Query YIAKYTINPALTHGIahevgsievgkladlvvwspaffgvkpatvikggmiaiapmgdin  461
ident        |                                                    
Sbjct AKEIVVDNTQKIASL---------------------------------------------  360
DSSP  HHHHHLHHHHHHHHL---------------------------------------------


DSSP  llllllllleeeelhhhlhhhhhhhlEEEE------------------------------
Query asiptpqpvhyrpmfgalgsarhhcrLTFL------------------------------  491
ident                                                             
Sbjct -------------------------iGDVKpikdelytpriegadeeiremsyrrakeiy  395
DSSP  -------------------------lLLLLlllllllllllllhhhhhhhhhhhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  491
ident                                                             
Sbjct gdplpklveerlekelksiighgfaviylishklvkkslddgylvgsrgsvgssfvatmt  455
DSSP  lllllhhhhhhhhhhhhhhhhlllhhhhhhhhhhhhhhhhllllleelhhhhhlhhhhhl


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  491
ident                                                             
Sbjct eitevnplpphyvcpnckhseffndgsvgsgfdlpdkncprcgtkykkdghdipfetflg  515
DSSP  lllllllllleeelllllleeellllllllhhhllllllllllllleeellllllhhhhl


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  491
ident                                                             
Sbjct fkgdkvpdidlnfsgeyqprahnytkvlfgednvyragtigtvadktaygfvkayasdhn  575
DSSP  lllllllleeeeeelllhhhhhhhhhhhhlllleeeeeeeeellhhhhhhhhhhhhhhll


DSSP  --------------------------------lhhhhHHLH-------------------
Query --------------------------------sqaaaANGV-------------------  500
ident                                                             
Sbjct lelrgaeidrlaagctgvkrttgqhpggiivvpdymeIYDFtpiqypaddtssewrtthf  635
DSSP  llllhhhhhhhhhhhllleeeeeeeeeeeeellllllHHHLlleelhhhllllllleeee


DSSP  hHHLL-------------------------------------------------------
Query aERLN-------------------------------------------------------  505
ident                                                             
Sbjct dFHSIhdnllkldilghddptvirmlqdlsgidpktiptddpdvmgifssteplgvtpeq  695
DSSP  eHHHHllllleeeeeeehhhhhhhhhhhhhlllhhhlllllhhhhhlllllhhhlllhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  505
ident                                                             
Sbjct imcnvgtigipefgtrfvrqmleetrpktfselvqisglshgtdvwlgnaqeliqngtct  755
DSSP  hllllllllllllllhhhhhhhhhhllllhhhhhhhhhhllllllllllhhhhhhlllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  505
ident                                                             
Sbjct lsevigcrddimvyliyrglepslafkimesvrkgkgltpefeaemrkhdvpewyidsck  815
DSSP  hhhllllhhhhhhhhhhllllhhhhhhhhhhhlllllllhhhhhhhhhllllhhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  505
ident                                                             
Sbjct kikymfpkahaaayvlmavriayfkvhhpllyyasyftvraedfdldamikgsaairkri  875
DSSP  hllllllhhhhhhhhhhhhhhhhhhhhlhhhhhhhhhhhllllllhhhhhhlhhhhhhhh


DSSP  ----------------------------------------------------------ll
Query ----------------------------------------------------------lr  507
ident                                                             
Sbjct eeinakgiqatakekslltvlevalemcergfsfknidlyrsqatefvidgnslippfna  935
DSSP  hhhhhlhhhllhhhhhhhhhhhhhhhhhhllleellllllllllllleeelleeellhhh


DSSP  leeeellllllllhhhllllllllleeelllllleeelleellllllllllllllllll
Query saiavvkgcrtvqkadmvhnslqpnitvdaqtyevrvdgelitsepadvlpmaqryflf  566
ident                                                            
Sbjct ipglgtnvaqaivrareegeflskedlqqrgklsktlleylesrgcldslpdhnqlslf  994
DSSP  lllllhhhhhhhhhhhhllllllhhhhhhhhlllhhhhhhhhhllllllllllllllll


No 55: Query=1a5kC Sbjct=3dcpA Z-score=6.3

back to top
DSSP  leeehhhhhhhhlllllleeelllllleeelleellllllllllllllllllllllllll
Query snisrqayadmfgptvgdkvrladtelwieveddlttygeevkfgggkvirdgmgqgqml   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhhllleeeeeeeeeelleeeeeeeeeelleeeeeeleellllllllleellllleeeel
Query aadcvdlvltnalivdhwgivkadigvkdgrifaigkagnpdiqpnvtipigaateviaa  120
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  llleeeeLEEEEEEELL---------LLLHHHHHHHHLEEEEEEEL--------------
Query egkivtaGGIDTHIHWI---------CPQQAEEALVSGVTTMVGGG--------------  157
ident           | | |                  |                          
Sbjct -------XKRDGHTHTEfcphgthddVEEXVLKAIELDFDEYSIVEhaplssefxkntag   53
DSSP  -------LLEEEEELLLlllllllllHHHHHHHHHHLLLLEEEEEEellllhhhhhllll


DSSP  ---lllLHHHhhlllllHHHHHHHHHHHHLLL--LLEEEEEE-----ellLLLH-HHHHH
Query ---tgpAAGThattctpGPWYISRMLQAADSL--PVNIGLLG-----kgnVSQP-DALRE  206
ident        |          | |                |                 | | |
Sbjct dkeavtTASX---axsdLPYYFKKXNHIKKKYasDLLIHIGFevdyligyEDFTrDFLNE  110
DSSP  llhhhhLLLL---lhhhHHHHHHHHHHHHHHLllLLEEEEEEeeelllllHHHHhHHHHH


DSSP  HHHhLLLEEeeehhhlllhhhhhhhhhhhhhhlleeEEELLLLLL---------------
Query QVAaGVIGLeihedwgatpaaidcaltvademdiqvALHSDTLNE---------------  251
ident                                      |    |                 
Sbjct YGP-QTDDG---------------------------VLSLHFLEGqggfrsidfsaedyn  142
DSSP  HHH-HLLEE---------------------------EEELLEEEElleeeellllhhhhh


DSSP  -------------llLHHHHHHHHLLL------lEEELLLLLL--------------lll
Query -------------sgFVEDTLAAIGGR------tIHTFHTEGA--------------ggg  278
ident                                       |                     
Sbjct egivqfyggfeqaqlAYLEGVKQSIEAdlglfkpRRXGHISLCqkfqqffgedtsdfsee  202
DSSP  hhlhhhhllhhhhhhHHHHHHHHHHHLlllllllLEELLLLHHhllhhhhlllhhhllhh


DSSP  llllhhhHHHL---LLEEEEEEHHHLlllllhhhhHHHHhhhhhllllllhhhhhlllll
Query hapdiitACAH---PNILPSSTNPTLpytlntideHLDMlmvchhldpdiaedvafaesr  335
ident          |               |                                  
Sbjct vxekfrvILALvkkRDYELDFNTAGL--------fKPLC---------------------  233
DSSP  hhhhhhhHHHHhhhHLLEEEEELHHH--------hLLLL---------------------


DSSP  llhhhhhhHHHHHHLLL----lLEEELLLLlllLLLLHHHHHHHHHHhhhhhhlllllll
Query irretiaaEDVLHDLGA----fSLTSSDSQamgRVGEVILRTWQVAHrmkvqrgalaeet  391
ident               |           |||      |       |                
Sbjct ---getypPKKIVTLASelqipFVYGSDSHgvqDIGRGYSTYCQKLE-------------  277
DSSP  ---lllllLHHHHHHHHhllllEEEELLLLlhhHLLLLHHHHHHHLL-------------


DSSP  llllhhhhhhhhhlllhhhhhhllllllllllllllllleeeelhhhlllllleeeelle
Query gdndnfrvkryiakytinpalthgiahevgsievgkladlvvwspaffgvkpatvikggm  451
ident                                                             
Sbjct ------------------------------------------------------------  277
DSSP  ------------------------------------------------------------


DSSP  eeeeeellllllllllllleeeelhhhlhhhhhhhleeeelhhhhhhlhhhhllllleee
Query iaiapmgdinasiptpqpvhyrpmfgalgsarhhcrltflsqaaaangvaerlnlrsaia  511
ident                                                             
Sbjct ------------------------------------------------------------  277
DSSP  ------------------------------------------------------------


DSSP  ellllllllhhhllllllllleeelllllleeelleellllllllllllllllll
Query vvkgcrtvqkadmvhnslqpnitvdaqtyevrvdgelitsepadvlpmaqryflf  566
ident                                                        
Sbjct -------------------------------------------------------  277
DSSP  -------------------------------------------------------


No 56: Query=1a5kC Sbjct=1bksA Z-score=5.4

back to top
DSSP  leeehhhhhhhhlllllleeelllllleeelleellllllllllllllllllllllllll
Query snisrqayadmfgptvgdkvrladtelwieveddlttygeevkfgggkvirdgmgqgqml   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhhllleeeeeeeeEELLeeeeeeeeeelleeeeeeleellllllllleellllleeeel
Query aadcvdlvltnaliVDHWgivkadigvkdgrifaigkagnpdiqpnvtipigaateviaa  120
ident                                                             
Sbjct -----meryenlfaQLND------------------------------------------   13
DSSP  -----lhhhhhhhhHHHH------------------------------------------


DSSP  llleeeelEEEEeEELL------LLLHHHHHHHHLEEEEEEELLlLLHH--------hhh
Query egkivtagGIDThIHWI------CPQQAEEALVSGVTTMVGGGTgPAAG--------tha  166
ident                                   |      |                  
Sbjct ---rregaFVPF-VTLGdpgieqSLKIIDTLIDAGADALELGVP-FSDPladgptiqnan   68
DSSP  ---lllleEEEE-EELLlllhhhHHHHHHHHHHLLLLLEEEELL-LLLLllllhhhhhhh


DSSP  lllllhhhHHHHHHHHHLLL-----lleEEEEEElllllhhHHHHHHHHL----LLEEEE
Query ttctpgpwYISRMLQAADSL-----pvnIGLLGKgnvsqpdALREQVAAG----VIGLEI  217
ident                             ||||               |      |     
Sbjct lrafaagvTPAQCFEMLALIrekhptipIGLLMYanlvfnnGIDAFYARCeqvgVDSVLV  128
DSSP  hhhhhhllLHHHHHHHHHHHhhhlllllEEEEELhhhhhllLHHHHHHHHhhhlLLEEEE


DSSP  EhhHLLLHHHhhhhHHHHHHHLLEEEEELLLLllllLHHHHHHHHlLLLE-EELLLllll
Query HedWGATPAAidcaLTVADEMDIQVALHSDTLnesgFVEDTLAAIgGRTI-HTFHTegag  276
ident                  |    |                | |          |       
Sbjct A--DVPVEES-apfRQAALRHNIAPIFICPPN----ADDDLLRQVaSYGRgYTYLL----  177
DSSP  L--LLLHHHL-hhhHHHHHHLLLEEEEEELLL----LLHHHHHHHhHHLLlLEEEL----


DSSP  llllLLHH-HHHH----LLLEEEEEE--HHHLLllllhhhhhhhhhhhhhllllllhhhh
Query gghaPDII-TACA----HPNILPSST--NPTLPytlntidehldmlmvchhldpdiaedv  329
ident                                                             
Sbjct ----ALPLhHLIEklkeYHAAPALQGfgISSPE---------------------------  206
DSSP  ----LLLHhHHHHhhhhHLLLLEEELllLLLHH---------------------------


DSSP  hlllllllhhhhhhhHHHHHlLLLLEEELLlllLLLL------------------lLHHH
Query afaesrirretiaaeDVLHDlGAFSLTSSDsqaMGRV------------------gEVIL  371
ident                             |       |                    |  
Sbjct -------------qvSAAVR-AGAAGAISG---SAIVkiieknlaspkqmlaelrsFVSA  249
DSSP  -------------hhHHHHH-HLLLEEEEL---LHHHhhhhhllllhhhhhhhhhhHHHH


DSSP  HHHHHHhhhhhhhlllllllllllhhhhhhhhhlllhhhhhhllllllllllllllllle
Query RTWQVAhrmkvqrgalaeetgdndnfrvkryiakytinpalthgiahevgsievgkladl  431
ident                                                             
Sbjct MKAASR------------------------------------------------------  255
DSSP  HHHLLL------------------------------------------------------


DSSP  eeelhhhlllllleeeelleeeeeeellllllllllllleeeelhhhlhhhhhhhleeee
Query vvwspaffgvkpatvikggmiaiapmgdinasiptpqpvhyrpmfgalgsarhhcrltfl  491
ident                                                             
Sbjct ------------------------------------------------------------  255
DSSP  ------------------------------------------------------------


DSSP  lhhhhhhlhhhhllllleeeellllllllhhhllllllllleeelllllleeelleelll
Query sqaaaangvaerlnlrsaiavvkgcrtvqkadmvhnslqpnitvdaqtyevrvdgelits  551
ident                                                             
Sbjct ------------------------------------------------------------  255
DSSP  ------------------------------------------------------------


DSSP  lllllllllllllll
Query epadvlpmaqryflf  566
ident                
Sbjct ---------------  255
DSSP  ---------------


No 57: Query=1a5kC Sbjct=2anuA Z-score=4.9

back to top
DSSP  leeehhhhhhhhlllllleeelllllleeelleellllllllllllllllllllllllll
Query snisrqayadmfgptvgdkvrladtelwieveddlttygeevkfgggkvirdgmgqgqml   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhhllleeeeeeeeeelleeeeeeeeeelleeeeeeleellllllllleellllleeeel
Query aadcvdlvltnalivdhwgivkadigvkdgrifaigkagnpdiqpnvtipigaateviaa  120
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  llleeEELEEEEEEELL-------LLLHHHHHHHHLEEEEEEEL----------------
Query egkivTAGGIDTHIHWI-------CPQQAEEALVSGVTTMVGGG----------------  157
ident           | | |                    ||                       
Sbjct ----tEWLLCDFHVHTNxsdghlpLGEVVDLFGKHGVDVVSITDhivdrrtleqrkrnge   56
DSSP  ----lEEEEEEEEELLLlllllllHHHHHHHHHHLLLLEEEEEEeeelhhhhhhhhhlll


DSSP  llLLHHhhhlllllHHHHHHHHHHHHLLL----LLEEEEEEelllllhhhhhhhhhhlll
Query tgPAAGthattctpGPWYISRMLQAADSL----PVNIGLLGkgnvsqpdalreqvaagvi  213
ident    |             |  |                                       
Sbjct plGAIT-----edkFQDYLKRLWREQKRAweeyGXILIPGV-------------------   92
DSSP  llLLLL-----lllHHHHHHHHHHHHHHHhhhhLLEEEEEE-------------------


DSSP  eeEEEHHHLL-------------lhHHHHHHHHHHHHHLLEEEEE---lllLLLLllHHH
Query glEIHEDWGA-------------tpAAIDCALTVADEMDIQVALH---sdtLNESgfVED  257
ident   ||                                |    |         |        
Sbjct --EITNNTDLyhivavdvkeyvdpsLPVEEIVEKLKEQNALVIAAhpdrkkLSWY-lWAN  149
DSSP  --EEEELLLLeeeeeelllllllllLLHHHHHHHHHHLLLEEEELllllllLLLH-hHHL


DSSP  HHHhHLLLLEEELllllllllllllhhhhhhllleeeEEEHHHLlllllhhhhhhhhhhh
Query TLAaIGGRTIHTFhtegaggghapdiitacahpnilpSSTNPTLpytlntidehldmlmv  317
ident                                            |                
Sbjct XER-FKDTFDAWE------------------------IANRDDL----------------  168
DSSP  LLL-LLLLLLEEE------------------------EEELLEE----------------


DSSP  hhllllllhhhhhlllllllhhhhhhhhhhHHLLllLEEELLLLLllLLLLHhhhhhhhh
Query chhldpdiaedvafaesrirretiaaedvlHDLGafSLTSSDSQAmgRVGEVilrtwqva  377
ident                                         ||      |           
Sbjct --------------------------fnsvGVKKyrYVANSDFHElwHVYSW--------  194
DSSP  --------------------------lhhhHHLLllEEEELLLLLhhHHLLE--------


DSSP  hhhhhhhlllllllllllhhhhhhhhhLLLHhhhhhllLLLLllllllllllleeeelhh
Query hrmkvqrgalaeetgdndnfrvkryiaKYTInpalthgIAHEvgsievgkladlvvwspa  437
ident                            |          |                     
Sbjct ---------------------------KTLV--kseknIEAI------------------  207
DSSP  ---------------------------EEEE--eelllHHHH------------------


DSSP  hlllllleeeelleeeeeeellllllllllllleeeelhhhlhhhhhhhleeeelhhhhh
Query ffgvkpatvikggmiaiapmgdinasiptpqpvhyrpmfgalgsarhhcrltflsqaaaa  497
ident                                                             
Sbjct ------------------------------------------------------------  207
DSSP  ------------------------------------------------------------


DSSP  hlhhhhllllleeeellllllLLHHHLlllllllleeelllllleeelleelllllllll
Query ngvaerlnlrsaiavvkgcrtVQKADMvhnslqpnitvdaqtyevrvdgelitsepadvl  557
ident                          |                                  
Sbjct -----------------keaiRKNTDV---------------------------------  217
DSSP  -----------------hhhhHHLLLE---------------------------------


DSSP  lllllllll
Query pmaqryflf  566
ident          
Sbjct --aiylxrk  224
DSSP  --eeeelll


No 58: Query=1a5kC Sbjct=2yb1A Z-score=4.3

back to top
DSSP  leeehhhhhhhhlllllleeelllllleeelleellllllllllllllllllllllllll
Query snisrqayadmfgptvgdkvrladtelwieveddlttygeevkfgggkvirdgmgqgqml   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhhllleeeeeeeeeelleeeeeeeeeelleeeeeeleellllllllleellllleeeel
Query aadcvdlvltnalivdhwgivkadigvkdgrifaigkagnpdiqpnvtipigaateviaa  120
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  llleeeelEEEEEEE-----LLLL--LHHHHHHHHLEEEEEEElllllhhhhhlLLLLhh
Query egkivtagGIDTHIH-----WICP--QQAEEALVSGVTTMVGGgtgpaagthatTCTPgp  173
ident          || | |                |                            
Sbjct -------aNIDLHFHsrtsdGALTptEVIDRAAARAPALLALT-----------DHDC--   40
DSSP  -------lLEELLLLlllllLLLLhhHHHHHHHLLLLLEEEEL-----------LLLL--


DSSP  hhhhHHHHH-HLLL---LLEEEEEEelllllhhhhhhhhhhllleeEEEHhhLLLH----
Query wyisRMLQA-ADSL---PVNIGLLGkgnvsqpdalreqvaagviglEIHEdwGATP----  225
ident       |   |                                   |             
Sbjct ---tGGLAEaAAAAarrGIPFLNGV---------------------EVSV--SWGRhtvh   74
DSSP  ---lLLHHHhHHHHhhlLLLEEEEE---------------------EEEE--EELLeeee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  225
ident                                                             
Sbjct ivglgidpaepalaaglksiregrlerarqmgasleaagiagcfdgamrwcdnpemisrt  134
DSSP  eeeellllllhhhhhhhhhhhllhhhhhhhhhhhhhhlllllhhhhhhlllllhhhllhh


DSSP  -----------------------------------hHHHHHHHHHHHHLLEEeeelllll
Query -----------------------------------aAIDCALTVADEMDIQValhsdtln  250
ident                                         |                   
Sbjct hfarhlvdsgavkdmrtvfrkyltpgkpgyvshqwaSLEDAVGWIVGAGGMA--------  186
DSSP  hhhhhhhhllllllhhhhhhhlllllllllllllllLHHHHHHHHHHLLLEE--------


DSSP  llllhhhhhhhhlllleEELLLLLlllLLLLLhhhhhHLLL------EEEE-EEHHHLLl
Query esgfvedtlaaiggrtiHTFHTEGaggGHAPDiitacAHPN------ILPS-STNPTLPy  303
ident                     |                                       
Sbjct -----------------VIAHPGR---YDMGRtlierLILDfqaaggQGIEvASGSHSL-  225
DSSP  -----------------EELLHHH---LLLLHhhhhhHHHHhhhlllLEEEeEELLLLH-


DSSP  lllhhhhhhhhhhhhhllllllhhhhhlllllllhhhhhHHHHHHHLLL-----lLEEEL
Query tlntidehldmlmvchhldpdiaedvafaesrirretiaAEDVLHDLGA-----fSLTSS  358
ident                                               | |          |
Sbjct ---------------------------------------DDMHKFALHAdrhglyASSGS  246
DSSP  ---------------------------------------HHHHHHHHHHhhhlleEEEEL


DSSP  LLLL-llLLLLHHhhhhhhhhhhhhhhlllllllllllhhhHHHHhhlllhHHHHhlLLL
Query DSQA-mgRVGEVIlrtwqvahrmkvqrgalaeetgdndnfrVKRYiakytiNPALthGIA  417
ident |  |    ||                                                  
Sbjct DFHApgeDVGHTE--------------------------dlPPIC-----rPIWR--ELE  273
DSSP  LLLLlllLLLLLL--------------------------llLLLL-----lLHHH--HLH


DSSP  LLLlllllllllleeeelhhhlllllleeeELLEeeeeeellllllllllllleeeelhh
Query HEVgsievgkladlvvwspaffgvkpatviKGGMiaiapmgdinasiptpqpvhyrpmfg  477
ident                                                             
Sbjct ARI-------------------------lrPADA--------------------------  282
DSSP  HHL-------------------------llLLHH--------------------------


DSSP  hlhhhhhhhleeeelhhhhhhlhhhhllllleeeellllllllhhhllllllllleeell
Query algsarhhcrltflsqaaaangvaerlnlrsaiavvkgcrtvqkadmvhnslqpnitvda  537
ident                                                             
Sbjct ------------------------------------------------------------  282
DSSP  ------------------------------------------------------------


DSSP  lllleeelleellllllllllllllllll
Query qtyevrvdgelitsepadvlpmaqryflf  566
ident                              
Sbjct ---------------------------en  284
DSSP  ---------------------------hl


No 59: Query=1a5kC Sbjct=3e38A Z-score=4.2

back to top
DSSP  leeehhhhhhhhlllllleeelllllleeelleellllllllllllllllllllllllll
Query snisrqayadmfgptvgdkvrladtelwieveddlttygeevkfgggkvirdgmgqgqml   60
ident                                                             
Sbjct ------------------------------------------------------------    0
DSSP  ------------------------------------------------------------


DSSP  hhhllleeeeeeeeEELLEeeeeeeeeelleeeeeeleellllllllleellllleeeel
Query aadcvdlvltnaliVDHWGivkadigvkdgrifaigkagnpdiqpnvtipigaateviaa  120
ident                |  |                                         
Sbjct -----aqrrneiqvPDLDG-----------------------------------------   14
DSSP  -----lllllllllLLLLL-----------------------------------------


DSSP  llleeEELEEEEEEELL-------LLLHHHHHHHHLEEEEEEElllllhhhhhlLLLL--
Query egkivTAGGIDTHIHWI-------CPQQAEEALVSGVTTMVGGgtgpaagthatTCTP--  171
ident      |    | | |               ||   |                        
Sbjct ----yTTLKCDFHXHSVfsdglvwPTVRVDEAYRDGLDAISLT-----------EHIEyr   59
DSSP  ----lEEEEEELLLLLLlllllllHHHHHHHHHHLLLLEELLE-----------EELLll


DSSP  -----hhHHHHHHHHHHLLLL----LEEE-EEEELLlllhhhhhhhhhhllleeeeehhh
Query -----gpWYISRMLQAADSLP----VNIG-LLGKGNvsqpdalreqvaagvigleihedw  221
ident            |                                                
Sbjct phkqdvvSDHNRSFDLCREQAeklgILLIkGSEITR------------------------   95
DSSP  lllllllLLLLHHHHHHHHHHhhhlLEELlEEEEEL------------------------


DSSP  LLLH----------------hhhHHHHHHHHHHLLEEEE-ELLL---LLLLlLHHHHHHH
Query GATP----------------aaiDCALTVADEMDIQVAL-HSDT---LNESgFVEDTLAA  261
ident    |                     |   |          |                  |
Sbjct AXAPghfnaiflsdsnpleqkdyKDAFREAKKQGAFXFWnHPGWdsqQPDTtKWWPEHTA  155
DSSP  LLLLleeeeelllllhhhllllhHHHHHHHHHLLLEEEElLLLLlllLLLLlLLLHHHHH


DSSP  HLLL--LEEELL--lLLLLllllllhHHHHHLLlEEEEeehhhllllllhhhhhhhhhhh
Query IGGR--TIHTFH--tEGAGgghapdiITACAHPnILPSstnptlpytlntidehldmlmv  317
ident                                                             
Sbjct LYQEgcXHGIEVangHLYX---peaiQWCLDKN-LTXI----------------------  189
DSSP  HHHLllLLEEEEeelLEEL---lhhhHHHHHHL-LEEE----------------------


DSSP  hhllllllhhhhhlllllllhhhhhhhhhhhhllllleEELLLLLllllllhhhhhhhhh
Query chhldpdiaedvafaesrirretiaaedvlhdlgafslTSSDSQAmgrvgevilrtwqva  377
ident                                         ||                  
Sbjct --------------------------------------GTSDIHQ---------------  196
DSSP  --------------------------------------EELLLLL---------------


DSSP  hhhhhhhlllllllllllhhhhhhhhhLLLHhhhhhllLLLLLlllllllllleeeelhh
Query hrmkvqrgalaeetgdndnfrvkryiaKYTInpalthgIAHEVgsievgkladlvvwspa  437
ident                                                             
Sbjct -----------piqtdydfekgehrtxTFVF---akerSLQGI-----------------  225
DSSP  -----------lhhhhllhhhllllleEEEE---elllLHHHH-----------------


DSSP  hlllllleeeelleeeeeeellllllllllllleeeelhhhlhhhhhhhleeeelhhhhh
Query ffgvkpatvikggmiaiapmgdinasiptpqpvhyrpmfgalgsarhhcrltflsqaaaa  497
ident                                                             
Sbjct ------------------------------------------------------------  225
DSSP  ------------------------------------------------------------


DSSP  hlhhhhllllleeeellllllllhhhlllLLLL---------------------------
Query ngvaerlnlrsaiavvkgcrtvqkadmvhNSLQ---------------------------  530
ident                                                             
Sbjct -----------realdnrrtaayfhelliGREDllrpffekcvkieevsrneqgvtlsit  274
DSSP  -----------hhhhhllleeeeelleeeLLHHhhhhhhhhheeeeeeeeelleeeeeee


DSSP  --------------------------------lleeelllllleeellEELLLlllllll
Query --------------------------------pnitvdaqtyevrvdgELITSepadvlp  558
ident                                                    |        
Sbjct nvtdlvlklkktahdtllvyfrdxtlkphtrytvrigfkqgikggdvnFEVTNfivapdk  334
DSSP  ellllleeeeelllllleellleeeellleeeeeeeeellllllleeeEEEEEeeeelle


DSSP  llllllll
Query maqryflf  566
ident         
Sbjct glkytisl  342
DSSP  eeeeeeel