Results: dupa

Query: 1a4mA

MOLECULE: ADENOSINE DEAMINASE;

Select neighbours (check boxes) for viewing as multiple structural alignment or 3D superimposition. The list of neighbours is sorted by Z-score. Similarities with a Z-score lower than 2 are spurious. Each neighbour has links to pairwise structural alignment with the query structure, and to the PDB format coordinate file where the neighbour is superimposed onto the query structure.

Expand gaps

Summary

    No:  Chain   Z    rmsd lali nres  %id PDB  Description
   1:  1a4m-A 67.0  0.0  349   349  100 PDB  MOLECULE: ADENOSINE DEAMINASE;                                       
   2:  3ls9-A 23.4  3.0  280   453   11 PDB  MOLECULE: TRIAZINE HYDROLASE;                                        
   3:  1k6w-A 21.8  3.1  269   423   13 PDB  MOLECULE: CYTOSINE DEAMINASE;                                        
   4:  4cqb-A 21.5  3.2  274   402   13 PDB  MOLECULE: N-ISOPROPYLAMMELIDE ISOPROPYL AMIDOHYDROLASE;              
   5:  2uz9-A 21.5  2.9  267   444   15 PDB  MOLECULE: GUANINE DEAMINASE;                                         
   6:  4rdv-B 21.3  3.0  266   451   12 PDB  MOLECULE: N-FORMIMINO-L-GLUTAMATE IMINOHYDROLASE;                    
   7:  1j6p-A 21.1  2.8  258   407   14 PDB  MOLECULE: METAL-DEPENDENT HYDROLASE OF                               
   8:  2paj-A 20.2  3.1  252   421   13 PDB  MOLECULE: PUTATIVE CYTOSINE/GUANINE DEAMINASE;                       
   9:  2oof-A 19.6  3.2  264   403   16 PDB  MOLECULE: 4-IMIDAZOLONE-5-PROPANOATE AMIDOHYDROLASE;                 
  10:  2a3l-A 19.3  2.9  293   616   16 PDB  MOLECULE: AMP DEAMINASE;                                             
  11:  3mkv-A 18.8  3.2  251   414   12 PDB  MOLECULE: PUTATIVE AMIDOHYDROLASE;                                   
  12:  3mtw-A 18.5  3.3  251   404   13 PDB  MOLECULE: L-ARGININE CARBOXYPEPTIDASE CC2672;                        
  13:  4c5y-A 18.0  3.2  247   436   10 PDB  MOLECULE: OCHRATOXINASE;                                             
  14:  3icj-A 17.7  3.4  264   468   15 PDB  MOLECULE: UNCHARACTERIZED METAL-DEPENDENT HYDROLASE;                 
  15:  2imr-A 17.6  3.1  245   380   11 PDB  MOLECULE: HYPOTHETICAL PROTEIN DR_0824;                              
  16:  3nqb-A 16.7  2.9  224   587   13 PDB  MOLECULE: ADENINE DEAMINASE 2;                                       
  17:  1yrr-B 15.8  3.8  229   334   11 PDB  MOLECULE: N-ACETYLGLUCOSAMINE-6-PHOSPHATE DEACETYLASE;               
  18:  1gkp-A 15.5  3.4  242   458   10 PDB  MOLECULE: HYDANTOINASE;                                              
  19:  1bf6-A 15.1  3.6  235   291   11 PDB  MOLECULE: PHOSPHOTRIESTERASE HOMOLOGY PROTEIN;                       
  20:  3k2g-B 15.0  3.9  245   358   10 PDB  MOLECULE: RESINIFERATOXIN-BINDING, PHOSPHOTRIESTERASE-               
  21:  2y1h-B 15.0  3.4  233   265   13 PDB  MOLECULE: PUTATIVE DEOXYRIBONUCLEASE TATDN3;                         
  22:  3gri-A 15.0  3.4  236   422   14 PDB  MOLECULE: DIHYDROOROTASE;                                            
  23:  3giq-A 15.0  3.6  239   475   13 PDB  MOLECULE: N-ACYL-D-GLUTAMATE DEACYLASE;                              
  24:  2ogj-A 15.0  3.1  224   379   16 PDB  MOLECULE: DIHYDROOROTASE;                                            
  25:  2ob3-A 14.9  4.2  237   329   13 PDB  MOLECULE: PARATHION HYDROLASE;                                       
  26:  3e74-A 14.7  3.4  230   429   14 PDB  MOLECULE: ALLANTOINASE;                                              
  27:  4b3z-D 14.5  3.4  236   477   12 PDB  MOLECULE: DIHYDROPYRIMIDINASE-RELATED PROTEIN 1;                     
  28:  3cjp-A 14.5  3.4  217   262   12 PDB  MOLECULE: PREDICTED AMIDOHYDROLASE, DIHYDROOROTASE FAMILY;           
  29:  1onx-A 14.4  3.4  232   390   12 PDB  MOLECULE: ISOASPARTYL DIPEPTIDASE;                                   
  30:  2vun-A 14.3  3.5  224   385   13 PDB  MOLECULE: ENAMIDASE;                                                 
  31:  2ffi-A 14.3  3.6  230   273   10 PDB  MOLECULE: 2-PYRONE-4,6-DICARBOXYLIC ACID HYDROLASE, PUTATIV          
  32:  2vc5-A 14.3  3.8  227   314   12 PDB  MOLECULE: ARYLDIALKYLPHOSPHATASE;                                    
  33:  4hk5-D 14.2  4.3  241   380   12 PDB  MOLECULE: URACIL-5-CARBOXYLATE DECARBOXYLASE;                        
  34:  4mup-B 13.8  3.5  228   286   11 PDB  MOLECULE: AMIDOHYDROLASE;                                            
  35:  3pnu-A 13.8  3.8  236   338   11 PDB  MOLECULE: DIHYDROOROTASE;                                            
  36:  4dlf-A 13.7  3.9  228   287   10 PDB  MOLECULE: AMIDOHYDROLASE 2;                                          
  37:  3irs-A 13.7  3.7  222   281    9 PDB  MOLECULE: UNCHARACTERIZED PROTEIN BB4693;                            
  38:  4ofc-A 13.5  4.1  230   335   11 PDB  MOLECULE: 2-AMINO-3-CARBOXYMUCONATE-6-SEMIALDEHYDE DECARBOX          
  39:  4qrn-A 13.5  3.8  230   352   10 PDB  MOLECULE: 5-CARBOXYVANILLATE DECARBOXYLASE;                          
  40:  2dvt-A 13.5  3.8  225   325   13 PDB  MOLECULE: THERMOPHILIC REVERSIBLE GAMMA-RESORCYLATE DECARBO          
  41:  3gg7-A 13.5  3.2  213   243   10 PDB  MOLECULE: UNCHARACTERIZED METALLOPROTEIN;                            
  42:  1itq-A 13.1  3.8  233   369   10 PDB  MOLECULE: RENAL DIPEPTIDASE;                                         
  43:  2gwg-A 12.9  4.1  229   329   12 PDB  MOLECULE: 4-OXALOMESACONATE HYDRATASE;                               
  44:  2qpx-A 12.6  4.0  228   376   13 PDB  MOLECULE: PREDICTED METAL-DEPENDENT HYDROLASE OF THE TIM-BA          
  45:  3ooq-A 12.5  3.2  201   384   16 PDB  MOLECULE: AMIDOHYDROLASE;                                            
  46:  1a5k-C 12.4  3.2  213   566   13 PDB  MOLECULE: UREASE (GAMMA SUBUNIT);                                    
  47:  4dzi-C 12.2  4.1  222   388   10 PDB  MOLECULE: PUTATIVE TIM-BARREL METAL-DEPENDENT HYDROLASE;             
  48:  1v77-A 11.8  3.4  181   202   12 PDB  MOLECULE: HYPOTHETICAL PROTEIN PH1877;                               
  49:  1j5s-A 10.8  3.8  222   451   13 PDB  MOLECULE: URONATE ISOMERASE;                                         
  50:  3qy6-A 10.4  4.1  197   247   12 PDB  MOLECULE: TYROSINE-PROTEIN PHOSPHATASE YWQE;                         
  51:  3iac-A  9.7  4.2  226   469   12 PDB  MOLECULE: GLUCURONATE ISOMERASE;                                     
  52:  3dcp-A  9.1  3.3  176   277   10 PDB  MOLECULE: HISTIDINOL-PHOSPHATASE;                                    
  53:  3au2-A  8.7  3.6  182   575   14 PDB  MOLECULE: DNA POLYMERASE BETA FAMILY (X FAMILY);                     
  54:  3f2b-A  8.7  3.5  172   994   15 PDB  MOLECULE: DNA-DIRECTED DNA POLYMERASE III ALPHA CHAIN;               
  55:  1bks-A  8.2  4.1  179   255    9 PDB  MOLECULE: TRYPTOPHAN SYNTHASE;                                       
  56:  1m65-A  7.6  3.5  174   234    8 PDB  MOLECULE: HYPOTHETICAL PROTEIN YCDX;                                 
  57:  3e38-A  6.9  3.6  163   342   13 PDB  MOLECULE: TWO-DOMAIN PROTEIN CONTAINING PREDICTED PHP-LIKE           
  58:  2anu-A  6.5  3.5  156   224   11 PDB  MOLECULE: HYPOTHETICAL PROTEIN TM0559;                               
  59:  2yb1-A  5.6  3.5  144   284   13 PDB  MOLECULE: AMIDOHYDROLASE;                                            


Pairwise Structural Alignments

Notation: three-state secondary structure definitions by DSSP (reduced to H=helix, E=sheet, L=coil) are shown above the amino acid sequence. Structurally equivalent residues are in uppercase, structurally non-equivalent residues (e.g. in loops) are in lowercase. Amino acid identities are marked by vertical bars.

No 1: Query=1a4mA Sbjct=1a4mA Z-score=67.0

back to top
DSSP  LLLLLLLEEEEEEEHHHLLLHHHHHHHHHHHLLLLLLLLHHHHHHHHLLLLLLLHHHHHL
Query TPAFNKPKVELHVHLDGAIKPETILYFGKKRGIALPADTVEELRNIIGMDKPLSLPGFLA   60
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct TPAFNKPKVELHVHLDGAIKPETILYFGKKRGIALPADTVEELRNIIGMDKPLSLPGFLA   60
DSSP  LLLLLLLEEEEEEEHHHLLLHHHHHHHHHHHLLLLLLLLHHHHHHHHLLLLLLLHHHHHL


DSSP  LHHHHHHHHLLLHHHHHHHHHHHHHHHHHLLEEEEEEEELLHHHLLLLLLLLHHHLLLLL
Query KFDYYMPVIAGCREAIKRIAYEFVEMKAKEGVVYVEVRYSPHLLANSKVDPMPWNQTEGD  120
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct KFDYYMPVIAGCREAIKRIAYEFVEMKAKEGVVYVEVRYSPHLLANSKVDPMPWNQTEGD  120
DSSP  LHHHHHHHHLLLHHHHHHHHHHHHHHHHHLLEEEEEEEELLHHHLLLLLLLLHHHLLLLL


DSSP  LLHHHHHHHHHHHHHHHHHHHLLEEEEEEEEELLLHHHHHHHHHHHHHLLLLLEEEEEEE
Query VTPDDVVDLVNQGLQEGEQAFGIKVRSILCCMRHQPSWSLEVLELCKKYNQKTVVAMDLA  180
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct VTPDDVVDLVNQGLQEGEQAFGIKVRSILCCMRHQPSWSLEVLELCKKYNQKTVVAMDLA  180
DSSP  LLHHHHHHHHHHHHHHHHHHHLLEEEEEEEEELLLHHHHHHHHHHHHHLLLLLEEEEEEE


DSSP  LLLLLLLHHHLHHHHHHHHHHHHHLLEEEEEELLLLLHHHHHHHHHLLLLLEEEELHHHH
Query GDETIEGSSLFPGHVEAYEGAVKNGIHRTVHAGEVGSPEVVREAVDILKTERVGHGYHTI  240
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct GDETIEGSSLFPGHVEAYEGAVKNGIHRTVHAGEVGSPEVVREAVDILKTERVGHGYHTI  240
DSSP  LLLLLLLHHHLHHHHHHHHHHHHHLLEEEEEELLLLLHHHHHHHHHLLLLLEEEELHHHH


DSSP  HLHHHHHHHHHLLLEEEELHHHHHHLLLLLLLLLLHHHHHHHLLLLEEELLLLLLLLLLL
Query EDEALYNRLLKENMHFEVCPWSSYLTGAWDPKTTHAVVRFKNDKANYSLNTDDPLIFKST  300
ident ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct EDEALYNRLLKENMHFEVCPWSSYLTGAWDPKTTHAVVRFKNDKANYSLNTDDPLIFKST  300
DSSP  HLHHHHHHHHHLLLEEEELHHHHHHLLLLLLLLLLHHHHHHHLLLLEEELLLLLLLLLLL


DSSP  HHHHHHHHHHLLLLLHHHHHHHHHHHHHLLLLLHHHHHHHHHHHHHHLL
Query LDTDYQMTKKDMGFTEEEFKRLNINAAKSSFLPEEEKKELLERLYREYQ  349
ident |||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct LDTDYQMTKKDMGFTEEEFKRLNINAAKSSFLPEEEKKELLERLYREYQ  349
DSSP  HHHHHHHHHHLLLLLHHHHHHHHHHHHHLLLLLHHHHHHHHHHHHHHLL


No 2: Query=1a4mA Sbjct=3ls9A Z-score=23.4

back to top
DSSP  ---------------------------------------------------llllLLLEE
Query ---------------------------------------------------tpafNKPKV    9
ident                                                             
Sbjct milirgltrvitfddqereledadilidgpkivavgkdlsdrsvsrtidgrgmiaLPGLI   60
DSSP  leeeeeeeeeellllllleeeeeeeeeelleeeeeellllllllleeeellleeeEELEE


DSSP  EEEEEHHHLLLHhhhhhhhhhhllllllllhhhHHHHHLLlllLLHHHHHLLHHHHHHHH
Query ELHVHLDGAIKPetilyfgkkrgialpadtveeLRNIIGMdkpLSLPGFLAKFDYYMPVI   69
ident   | ||                                           |          
Sbjct NSHQHLYEGAMR---------------------AIPQLER---VTMASWLEGVLTRSAGW   96
DSSP  EEEELHHHHHHL---------------------LLHHHLL---LLHHHHHHHHHHHHHHH


DSSP  L----LLHHHHHHHHHHHHHHHHHLLEEEEEEEELLHhhlLLLLlllhhhlllllllHHH
Query A----GCREAIKRIAYEFVEMKAKEGVVYVEVRYSPHllaNSKVdpmpwnqtegdvtPDD  125
ident           |   |          |   |                            | 
Sbjct WrdgkFGPDVIREVARAVLLESLLGGITTVADQHLFF---PGAT-------------ADS  140
DSSP  HhlllLLHHHHHHHHHHHHHHHHHLLEEEEEEEELLL---LLLL-------------LLL


DSSP  HHHHHHHHHHHHHhhhlLEEEEEEEEELL--------------LHHHHH-HHHHHHHHLL
Query VVDLVNQGLQEGEqafgIKVRSILCCMRH--------------QPSWSL-EVLELCKKYN  170
ident   |              |        |                         | |   | 
Sbjct YIDATIEAATDLG----IRFHAARSSMTLgkseggfcddlfvePVDRVVqHCLGLIDQYH  196
DSSP  HHHHHHHHHHHHL----LEEEEEELLLLLlhhhlllllhhhllLHHHHHhHHHHHHHHHL


DSSP  L-----lLEEEEEEElLLLLllHHHLhHHHHHHHHHHHHLLEEEEEELLLLLH-------
Query Q-----kTVVAMDLAgDETIegSSLFpGHVEAYEGAVKNGIHRTVHAGEVGSP-------  218
ident           |                        |         |  |           
Sbjct EpepfgmVRIALGPC-GVPY--DKPE-LFEAFAQMAADYDVRLHTHFYEPLDAgmsdhly  252
DSSP  LllllllEEEEELLL-LLLL--LLHH-HHHHHHHHHHHHLLEEEEEELLLLHHhhhhhhh


DSSP  --HHHHHHHHLLL---LLEEEELHHhHHLHhHHHHHHHLLLEEEELHHHHHHLLLLllll
Query --EVVREAVDILK---TERVGHGYHtIEDEaLYNRLLKENMHFEVCPWSSYLTGAWdpkt  273
ident      |               |       |                       |      
Sbjct gmTPWRFLEKHGWasdRVWLAHAVV-PPRE-EIPEFADAGVAIAHLIAPDLRMGWG----  306
DSSP  llLHHHHHHHLLLlllLEEEEELLL-LLHH-HHHHHHHHLLEEEELHHHHHHLLLL----


DSSP  lLHHHHHHHLLLLEEELLLLLLLLLL-LHHHHHHHHHHLL----------LLLHHHHHHH
Query tHAVVRFKNDKANYSLNTDDPLIFKS-TLDTDYQMTKKDM----------GFTEEEFKRL  322
ident                  |          |  |                       |  | 
Sbjct lAPIREYLDAGITVGFGTTGSASNDGgNLLGDLRLAALAHrpadpnepekWLSARELLRM  366
DSSP  lLLHHHHHHLLLEEEELLLLLLLLLLlLHHHHHHHHHHHLhhhllllhhhLLLHHHHHHH


DSSP  -HHHHHHLLLllhhhHHHHHhhHHHH----------------------------------
Query -NINAAKSSFlpeeeKKELLerLYRE----------------------------------  347
ident      |            |      |                                  
Sbjct aTRGSAECLG-----RPDLG--VLEEgraadiacwrldgvdrvgvhdpaiglimtglsdr  419
DSSP  lLHHHHHHLL-----LLLLL--LLLLllllleeeeelllhhhlllllhhhhhhhllllll


DSSP  --------------------------------ll
Query --------------------------------yq  349
ident                                   
Sbjct aslvvvngqvlvenerpvladlerivanttalip  453
DSSP  lleeeelleeeeelleellllhhhhhhhhhhhll


No 3: Query=1a4mA Sbjct=1k6wA Z-score=21.8

back to top
DSSP  ----------------------------------------------llllLLLEEEEEEE
Query ----------------------------------------------tpafNKPKVELHVH   14
ident                                                     | || | |
Sbjct alqtiinarlpgeeglwqihlqdgkisaidaqsgvmpitensldaeqglvIPPFVEPHIH   60
DSSP  llleeeeellllllleeeeeeelleeeeeeeellllllllleeelllleeELLEEEEEEL


DSSP  HHHLLLHHHhhhhhhhhllllllllhhhHHHHhlllllllhhHHHLLHHHHH--HHHLlL
Query LDGAIKPETilyfgkkrgialpadtveeLRNIigmdkplslpGFLAKFDYYM--PVIAgC   72
ident ||                            |                             
Sbjct LDTTQTAGQ------------------pNWNQ--------sgTLFEGIERWAerKALL-T   93
DSSP  LLLLLLLLL------------------lLLLL--------llLHHHHHHHHHllHHHL-L


DSSP  HHHHHHHHHHHHHHHHHLLEEEEEEEELLHHhllllllllhhhllllllLHHHHHHHHHH
Query REAIKRIAYEFVEMKAKEGVVYVEVRYSPHLlanskvdpmpwnqtegdvTPDDVVDLVNQ  132
ident     |  |          |   |                                     
Sbjct HDDVKQRAWQTLKWQIANGIQHVRTHVDVSD------------------ATLTALKAMLE  135
DSSP  HHHHHHHHHHHHHHHHHLLEEEEEEEEELLL------------------LLLHHHHHHHH


DSSP  HHHHHHHhhLLEEEEEEEEELLLH---HHHHHHHHHHHHLllllEEEEEEEllLLLL--L
Query GLQEGEQafGIKVRSILCCMRHQP---SWSLEVLELCKKYnqktVVAMDLAgdETIE--G  187
ident   ||      |                       |                         
Sbjct VKQEVAP--WIDLQIVAFPQEGILsypNGEALLEEALRLG----ADVVGAI-pHFEFtrE  188
DSSP  HHHHHLL--LLEEEEEEELLLLLLlllLHHHHHHHHHHLL----LLEEEEL-hHHLLlhH


DSSP  HHHLhhHHHHHHHHHHHLLEEEEEELLL--lLHHHHHHHHHL------lllLEEEELHHH
Query SSLFpgHVEAYEGAVKNGIHRTVHAGEV--gSPEVVREAVDI------lktERVGHGYHT  239
ident              | |      ||  |        |                   |    
Sbjct YGVE-sLHKTFALAQKYDRLIDVHCDEIddeQSRFVETVAALahhegmgarVTASHTTAM  247
DSSP  HHHH-hHHHHHHHHHHHLLEEEEEELLLlllLLLHHHHHHHHhhhhllhhhEEEEELHHH


DSSP  HH-----LHHHHHHHHHLLLEEEELHHHHHHLL---llllLLLL--HHHHHHHLLLLEEE
Query IE-----DEALYNRLLKENMHFEVCPWSSYLTG---awdpKTTH--AVVRFKNDKANYSL  289
ident           |   |      |   |              |      |        |   
Sbjct HSyngayTSRLFRLLKMSGINFVANPLVNIHLQgrfdtypKRRGitRVKEMLESGINVCF  307
DSSP  HHllhhhHHHHHHHHHHHLLEEEELHHHHHHHLlllllllLLLLllLHHHHHHLLLLEEE


DSSP  LLLLLL---LLLL--LHHHHHHHHHHLLLL----LHHHHHHH-HHHHHHLLLllhhhHHH
Query NTDDPL---IFKS--TLDTDYQMTKKDMGF----TEEEFKRL-NINAAKSSFlpeeeKKE  339
ident   ||                  |                  |     |            
Sbjct GHDDVFdpwYPLGtaNMLQVLHMGLHVCQLmgygQINDGLNLiTHHSARTLN-----LQD  362
DSSP  LLLLLLlllLLLLllLHHHHHHHHHHHLLLllhhHHHHHHHHhLHHHHHHLL-----LLL


DSSP  HhhhHHHH----------------------------------------------------
Query LlerLYRE----------------------------------------------------  347
ident                                                             
Sbjct Y---GIAAgnsanliilpaengfdalrrqvpvrysvrggkviastqpaqttvyleqpeai  419
DSSP  L---LLLLllllleeeellllhhhhhhhllllleeeelleeeeellllleeeellleeee


DSSP  --ll
Query --yq  349
ident     
Sbjct dykr  423
DSSP  llll


No 4: Query=1a4mA Sbjct=4cqbA Z-score=21.5

back to top
DSSP  -----------------------------------------------llllLLLEEEEEE
Query -----------------------------------------------tpafNKPKVELHV   13
ident                                                        |  | 
Sbjct skdfdliirnaylsekdsvydigivgdriikieakiegtvkdeidakgnlvSPGFVDAHT   60
DSSP  llleeeeeeeeeelllleeeeeeeelleeeeeelllllleeeeeellllleEELEEEEEE


DSSP  EHHHLLLHHhhhhhhhhhllllllllHHHHHHHHlllLLLLHHHHHLLHHHHHHHHllLH
Query HLDGAIKPEtilyfgkkrgialpadtVEELRNIIgmdKPLSLPGFLAKFDYYMPVIagCR   73
ident | |                        | |        |            |        
Sbjct HMDKSFTST-----------------GERLPKFW--sRPYTRDAAIEDGLKYYKNA--TH   99
DSSP  LHHHLLLLL-----------------LLLLLLLL--lLLLLHHHHHHHHHHHHHHL--LH


DSSP  HHHHHHHHHHHHHHHHLLEEEEEEEELLHHHLlllllllhhhlllllllHHHHHHHHHHH
Query EAIKRIAYEFVEMKAKEGVVYVEVRYSPHLLAnskvdpmpwnqtegdvtPDDVVDLVNQG  133
ident | |||   |   |    |  |          |                     |  |   
Sbjct EEIKRHVIEHAHMQVLHGTLYTRTHVDVDSVA-----------------KTKAVEAVLEA  142
DSSP  HHHHHHHHHHHHHHHHLLEEEEEEEEELLLLL-----------------LLHHHHHHHHH


DSSP  HHHHHHhhLLEEEEEEEE--ELLLHH-HHHHHHHHHHHLllllEEEEEEELLLLLLLHHH
Query LQEGEQafGIKVRSILCC--MRHQPS-WSLEVLELCKKYnqktVVAMDLAGDETIEGSSL  190
ident   |      |                                           | |    
Sbjct KEELKD--LIDIQVVAFAqsGFFVDLeSESLIRKSLDMG----CDLVGGVDPATRENNVE  196
DSSP  HHHLLL--LLEEEEEEELllLLLLLLlHHHHHHHHHHHL----LLEEELLLLLLLLLLHH


DSSP  LhhHHHHHHHHHHHLLEEEEEeLLLL---LHHHHHHHHHL------llLLEEEELHHH--
Query FpgHVEAYEGAVKNGIHRTVHaGEVG---SPEVVREAVDI------lkTERVGHGYHT--  239
ident           |         |                                |      
Sbjct G-sLDLCFKLAKEYDVDIDYH-IHDIgtvGVYSINRLAQKtiengykgRVTTSHAWCFad  254
DSSP  H-hHHHHHHHHHHLLLEEEEE-ELLLhhhHHHHHHHHHHHhhhlllllLEEEEELLHHhh


DSSP  ---hHLHHHHHHHHHLLLEEEELHHHHhhllllllllLLHHHHHHHLLLLEEELLLLLL-
Query ---iEDEALYNRLLKENMHFEVCPWSSyltgawdpktTHAVVRFKNDKANYSLNTDDPL-  295
ident                  | |  |  |           |  |        |     |    
Sbjct apseWLDEAIPLYKDSGMKFVTCFSST--------ppTMPVIKLLEAGINLGCASDNIRd  306
DSSP  llhhHHHHHHHHHHHHLLEEEEELLLL--------llLLLHHHHHHLLLEEEEELLLLLl


DSSP  -LLLLL---HHHHHHHHHHLLLL----LHHHHHHH-HHHHHHLLLllhhHHHHhhhHHHH
Query -IFKST---LDTDYQMTKKDMGF----TEEEFKRL-NINAAKSSFlpeeEKKElleRLYR  346
ident                                         |          |        
Sbjct fWVPFGngdMVQGALIETQRLELktnrDLGLIWKMiTSEGARVLG----IEKN---YGIE  359
DSSP  lLLLLLlllHHHHHHHHHHHHLLllhhHHHHHHHHhLHHHHHHHL----LHHH---LLLL


DSSP  ----------------------------------------hll
Query ----------------------------------------eyq  349
ident                                            
Sbjct vgkkadlvvlnslspqwaiidqakrlcvikngriivkdeviva  402
DSSP  lllllleeeellllhhhhhhhllleeeeeelleeeeelleell


No 5: Query=1a4mA Sbjct=2uz9A Z-score=21.5

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct plahifrgtfvhstwtcpmevlrdhllgvsdsgkivfleeasqqeklakewcfkpceire   60
DSSP  llleeeeeeeeellllllleeeeeeeeeellllleeeeeehhhhhhhhhhhlllhhheee


DSSP  ---llllLLLEEEEEEEHHHLLLhhhhhhhhhhhllllllllhhhhhhhhLLLLlLLHHH
Query ---tpafNKPKVELHVHLDGAIKpetilyfgkkrgialpadtveelrniiGMDKpLSLPG   57
ident            |  | |                                      | |  
Sbjct lshheffMPGLVDTHIHASQYSF-------------------------agSSID-LPLLE   94
DSSP  llllleeEELEEEEEEEHHHHHH-------------------------llLLLL-LLHHH


DSSP  HHL-LHHHHHHhHLLLHHHHHHHHHHHHHHHHHLLEEEEEEEELLHhhllllllllhhhl
Query FLA-KFDYYMPvIAGCREAIKRIAYEFVEMKAKEGVVYVEVRYSPHllanskvdpmpwnq  116
ident  |                         |    | |          |              
Sbjct WLTkYTFPAEH-RFQNIDFAEEVYTRVVRRTLKNGTTTACYFATIH--------------  139
DSSP  HHHhLHHHHHH-HHHLHHHHHHHHHHHHHHHHHLLEEEEEEELLLL--------------


DSSP  llllllhHHHHHHHHHHHHHHHhhhlLEEEEEEEEELL---------LHHHHH-HHHHHH
Query tegdvtpDDVVDLVNQGLQEGEqafgIKVRSILCCMRH---------QPSWSL-EVLELC  166
ident         |   |                     ||               |  |     
Sbjct -------TDSSLLLADITDKFG----QRAFVGKVCMDLndtfpeykeTTEESIkETERFV  188
DSSP  -------HHHHHHHHHHHHHHL----LEEEEELEELLLlllllllllLHHHHHhHHHHHH


DSSP  HHLL----llLEEEEEEELLLllllHHHLHHHHHHHHHHHHHLLEEEEEELLLL------
Query KKYN----qkTVVAMDLAGDEtiegSSLFPGHVEAYEGAVKNGIHRTVHAGEVG------  216
ident                          |       |    |     |   |  |        
Sbjct SEMLqknysrVKPIVTPRFSL----SCSETLMGELGNIAKTRDLHIQSHISENRdeveav  244
DSSP  HHHHhhllllEEEEEEELLHH----HLLHHHHHHHHHHHHHHLLEEEEEELLLHhhhhhh


DSSP  ------lhHHHHHHHHLLLL---LEEEELHHHHhlHHHHHHHHHLLLEEEELHHHHHHLL
Query ------spEVVREAVDILKT---ERVGHGYHTIedEALYNRLLKENMHFEVCPWSSYLTG  267
ident                            ||          |           || |     
Sbjct knlypsykNYTSVYDKNNLLtnkTVMAHGCYLS--AEELNVFHERGASIAHCPNSNLSLS  302
DSSP  hhhlllllLHHHHHHHLLLLlllEEEEELLLLL--HHHHHHHHHHLLEEEELHHHHHHLL


DSSP  LLlllllLHHHHHHHLLLLEEELLLLLlLLLL-LHHHHHHHHHHLL-----------LLL
Query AWdpkttHAVVRFKNDKANYSLNTDDPlIFKS-TLDTDYQMTKKDM-----------GFT  315
ident          |           | ||      |                           |
Sbjct SG----fLNVLEVLKHEVKIGLGTDVA-GGYSySMLDAIRRAVMVSnillinkvnekSLT  357
DSSP  LL----lLLHHHHHHLLLEEEELLLLL-LLLLlLHHHHHHHHHHHHhhhhhllllllLLL


DSSP  HHHHHHH-HHHHHHLLLLlhhhHHHHHhhHHHH---------------------------
Query EEEFKRL-NINAAKSSFLpeeeKKELLerLYRE---------------------------  347
ident   |  ||          |      |                                   
Sbjct LKEVFRLaTLGGSQALGL----DGEIG--NFEVgkefdailinpkasdspidlfygdffg  411
DSSP  HHHHHHHhLHHHHHHLLL----LLLLL--LLLLllllleeeelllllllllllllhhhhl


DSSP  -------------------------------ll
Query -------------------------------yq  349
ident                                  
Sbjct diseaviqkflylgddrnieevyvggkqvvpfs  444
DSSP  llllhhhhhhhhhllhhheeeeeelleeeelll


No 6: Query=1a4mA Sbjct=4rdvB Z-score=21.3

back to top
DSSP  -------------------------------------------llllLLLEEEEEEEHHH
Query -------------------------------------------tpafNKPKVELHVHLDG   17
ident                                                      || |   
Sbjct saifaerallpegwarnvrfeisadgvlaeirpdanadgaerlggavLPGMPNLHSHAFQ   60
DSSP  leeeeeeeeelleeeeeeeeeellllleeeeelllllllleelllleEELEEEEEELHHH


DSSP  LLLhhhhhhhhhhhllllllllhhhhhhhHLLL---llLLHHHHHLLHHHHHHHHllLHH
Query AIKpetilyfgkkrgialpadtveelrniIGMD---kpLSLPGFLAKFDYYMPVIagCRE   74
ident                                        |                   |
Sbjct RAM------------------------agLAEVagnpnDSFWTWRELMYRMVARL--SPE   94
DSSP  HHH------------------------llLLLLlllllLLHHHHHHHHHHHHLLL--LHH


DSSP  HHHHHHHHHHHHHHHLLEEEEEEEELlhHHLLllllllhHHLLllLLLHHHHHHHHHHHH
Query AIKRIAYEFVEMKAKEGVVYVEVRYSphLLANskvdpmpWNQTegDVTPDDVVDLVNQGL  134
ident  |  ||        | |   |                           |           
Sbjct QIEVIACQLYIEMLKAGYTAVAEFHY--VHHD-------LDGR-sYADPAELSLRISRAA  144
DSSP  HHHHHHHHHHHHHHHHLEEEEEEEEL--LLLL-------LLLL-lLLLLLHHHHHHHHHH


DSSP  HHHHhhhlLEEEEEEEEELLL--------------hhHHHHHHHHHHHLL-----lLLEE
Query QEGEqafgIKVRSILCCMRHQ--------------psWSLEVLELCKKYN-----qKTVV  175
ident         |          |                  |   |||               
Sbjct SAAG----IGLTLLPVLYSHAgfggqpasegqrrfinGSEAYLELLQRLRapleaaGHSL  200
DSSP  HHHL----LEEEEEELLLLEEellleellhhhlllllLHHHHHHHHHHHHhhhhhhLLEE


DSSP  EEEEELlllllLHHHLHHHHHHHHHhhHHLLE-EEEEELLLL----------lhHHHHHH
Query AMDLAGdetieGSSLFPGHVEAYEGavKNGIH-RTVHAGEVG----------spEVVREA  224
ident                                     |  |                    
Sbjct GLCFHS----lRAVTPQQIATVLAA--GHDDLpVHIHIAEQQkevddcqawsgrRPLQWL  254
DSSP  LEEELL----lLLLLHHHHHHHHLL--LLLLLlEEEEELLLHhhhhhhhhhhllLHHHHH


DSSP  HHLLLL---LEEEELHHHhhLHHHHHHHHHLLLEEEELHHHHHHLLLLlllllLHHHHHH
Query VDILKT---ERVGHGYHTieDEALYNRLLKENMHFEVCPWSSYLTGAWdpkttHAVVRFK  281
ident              |  |   | |              |       |            | 
Sbjct YENVAVdqrWCLVHATHA--DPAEVAAMARSGAVAGLCLSTEANLGDG----iFPATDFL  308
DSSP  HHHLLLlllEEEEELLLL--LHHHHHHHHHHLLEEEELHHHHHHLLLL----lLLHHHHH


DSSP  HLLLLEEELLLLLlllLLLH-HHHHHHHHHLLL----------------LLHHHHHHHHH
Query NDKANYSLNTDDPlifKSTL-DTDYQMTKKDMG----------------FTEEEFKRLNI  324
ident           |      |                                          
Sbjct AQGGRLGIGSDSH---VSLSvVEELRWLEYGQRlrdrkrnrlyrddqpmIGRTLYDAALA  365
DSSP  HLLLEEEELLLLL---LLLLhHHHHHHHHHHHHhhhlllllllllllllHHHHHHHHHHH


DSSP  HHHHLLLLLhhhhhhHHHH-----------------------------------------
Query NAAKSSFLPeeekkeLLER-----------------------------------------  343
ident   |     |                                                   
Sbjct GGAQALGQP-----iGSLAvgrradllvldgndpylasaegdallnrwlfaggdrqvrdv  420
DSSP  HHHHHHLLL-----lLLLLlllllleeeellllhhhhllllhhhhhhhhhhllhhheeee


DSSP  -------------------------hhhhll
Query -------------------------lyreyq  349
ident                                
Sbjct mvagrwvvrdgrhageersarafvqvlgell  451
DSSP  eelleeeelllllllhhhhhhhhhhhhhhhl


No 7: Query=1a4mA Sbjct=1j6pA Z-score=21.1

back to top
DSSP  ---------------------------------------------llllLLLEEEEEEEH
Query ---------------------------------------------tpafNKPKVELHVHL   15
ident                                                         | | 
Sbjct hhxiignclilkdfssepfwgaveiengtikrvlqgevkvdldlsgklvXPALFNTHTHA   60
DSSP  leeeeeeeeelllllllleeeeeeeelleeeeeeelllllleellleeeEELEEEEEELH


DSSP  HHLLLHhhhhhhhhhhllllllllhhhhhhhHLLLllLLHHHHHL-LHHHHHHHHLllHH
Query DGAIKPetilyfgkkrgialpadtveelrniIGMDkpLSLPGFLA-KFDYYMPVIAgcRE   74
ident                                   |  ||    |  |             
Sbjct PXTLLR------------------------gVAED--LSFEEWLFsKVLPIEDRLT--EK   92
DSSP  HHHHHL------------------------lLLLL--LLHHHHHHlLHHHHHLLLL--HH


DSSP  HHHHHHHHHHHHHHHLLEEEEEEEELlhhhllllllllhhhlllllllhhhHHHHHHHHH
Query AIKRIAYEFVEMKAKEGVVYVEVRYSphllanskvdpmpwnqtegdvtpddVVDLVNQGL  134
ident              |  |       |                                   
Sbjct XAYYGTILAQXEXARHGIAGFVDXYF-------------------------HEEWIAKAV  127
DSSP  HHHHHHHHHHHHHHLLLEEEEEEEEL-------------------------LHHHHHHHH


DSSP  HHHHhhhlLEEEEEEEEELLLHHHhhHHHHHHHH----LLLL---LEEEEEEEllllllL
Query QEGEqafgIKVRSILCCMRHQPSWslEVLELCKK----YNQK---TVVAMDLAgdetieG  187
ident                             ||   |     |       |            
Sbjct RDFG----XRALLTRGLVDSNGDD-gGRLEENLKlyneWNGFegrIFVGFGPH----spY  178
DSSP  HHHL----LEEEEEEEELLLLLLL-lLHHHHHHHhhhhHLLHhhlEEEEEEEL----llL


DSSP  HHHLHHHHHHHHHHHHHLLEEEEEELLL--LLHHhHHHHHHLLL---lLEEEELHHHHHL
Query SSLFPGHVEAYEGAVKNGIHRTVHAGEV--GSPEvVREAVDILK---tERVGHGYHTIED  242
ident              |       | |  |              |          |  |  | 
Sbjct LCSEEYLKRVFDTAKSLNAPVTIHLYETskEEYD-LEDILNIGLkevkTIAAHCVHLPER  237
DSSP  LLLHHHHHHHHHHHHHHLLLEEEEELLLllLLLL-LHHHHLLLLllllEEEEELLLLLHH


DSSP  hhHHHHHHHLLLEEEELHHHHHHLLLLlllllLHHHHHHHLLLLEEELLLLLLLLLL-LH
Query eaLYNRLLKENMHFEVCPWSSYLTGAWdpkttHAVVRFKNDKANYSLNTDDPLIFKS-TL  301
ident       |          | |    |         | |         | ||      |  |
Sbjct --YFGVLKDIPFFVSHNPASNLKLGNG----iAPVQRXIEHGXKVTLGTDGAASNNSlNL  291
DSSP  --HHHHHLLLLEEEEELHHHHHHLLLL----lLLHHHHHHLLLEEEELLLLLLLLLLlLH


DSSP  HHHHHHHHHLLL------LLHHHHHHHH-HHHHHLLLLlhhhhhHHHHH-----------
Query DTDYQMTKKDMG------FTEEEFKRLN-INAAKSSFLpeeekkELLER-----------  343
ident                                 |                           
Sbjct FFEXRLASLLQKaqnprnLDVNTCLKXVtYDGAQAXGF------KSGKIeegwnadlvvi  345
DSSP  HHHHHHHHHHHHllllllLLHHHHHHHHlHHHHHHHLL------LLLLLllllllleeee


DSSP  --------------------------------------------------------hhhh
Query --------------------------------------------------------lyre  347
ident                                                             
Sbjct dldlpexfpvqniknhlvhafsgevfatxvagkwiyfdgeyptidseevkrelariekel  405
DSSP  elllhhhllhhhhhhhhhhllllllleeeelleeeeellllllllhhhhhhhhhhhhhhh


DSSP  ll
Query yq  349
ident   
Sbjct ys  407
DSSP  hl


No 8: Query=1a4mA Sbjct=2pajA Z-score=20.2

back to top
DSSP  -------------------------------------------------------llllL
Query -------------------------------------------------------tpafN    5
ident                                                             
Sbjct pstlirnaaaimtggrgtaddpsrvpgpdirivgdtidaigalaprpgetivdatdcviY   60
DSSP  leeeeellleelllllllllllllllllleeeelleeeeellllllllleeeelllleeE


DSSP  LLEEEEEEEHHHLLLhhhhhhhhhhhllllllllhhhhhhHHLLlllllhhhhhllhhhH
Query KPKVELHVHLDGAIKpetilyfgkkrgialpadtveelrnIIGMdkplslpgflakfdyY   65
ident    |  | ||                                                  
Sbjct PAWVNTHHHLFQSLL-------------------------KGEP---------------F   80
DSSP  ELEELLLLLHHHHHL-------------------------LLLL---------------L


DSSP  HHHHllLHHHHHHHHHHHHHHHHHLLEEEEEEEELLHHhllllllLLHHhlllllllhhH
Query MPVIagCREAIKRIAYEFVEMKAKEGVVYVEVRYSPHLlanskvdPMPWnqtegdvtpdD  125
ident               |       |  |   |               |             |
Sbjct RALF--DERRFRLAARIGLIELARSGCATVADHNYVYY-------PGMP---------fD  122
DSSP  HHHL--LHHHHHHHHHHHHHHHHLLLEEEEEELLLLLL-------LLLL---------lL


DSSP  HHHHHHHHHHHHHhhhlLEEEEEEEEELL---------------LHHHHHHHHHHHH-HL
Query VVDLVNQGLQEGEqafgIKVRSILCCMRH---------------QPSWSLEVLELCK-KY  169
ident                                                      |     |
Sbjct SSAILFEEAEKLG----LRFVLLRGGATQtrqleadlptalrpeTLDAYVADIERLAaRY  178
DSSP  HHHHHHHHHHHLL----LEEEEEELLLLLlllllllllhhhlllLHHHHHHHHHHHHhHL


DSSP  LL-----lLEEEEEEELLLLlllHHHLHhHHHHHHHHHHHLLEEEEEELllllhHHHHHH
Query NQ-----kTVVAMDLAGDETiegSSLFPgHVEAYEGAVKNGIHRTVHAGevgspEVVREA  224
ident           | |           |      |    |   |     |         |   
Sbjct HDaspramRRVVMAPTTVLY--sISPRE-MRETAAVARRLGLRMHSHLS---gkSPVAFC  232
DSSP  LLllllllEEEEELLLLLLL--lLLHHH-HHHHHHHHHHLLLEEEEELL---llLHHHHH


DSSP  HHLLLL---LEEEELHHHhhLHHHHHHHHHLLLEEEELHHHHHHLlllllllllHHHHHH
Query VDILKT---ERVGHGYHTieDEALYNRLLKENMHFEVCPWSSYLTgawdpktthAVVRFK  281
ident              |      |      |         || |              |    
Sbjct GEHDWLgsdVWYAHLVKV--DADEIALLAQTGTGVAHCPQSNGRL---------PVREMA  281
DSSP  HHLLLLlllEEEELLLLL--LHHHHHHHHHHLLEEEELHHHHHLL---------LLLLHH


DSSP  HLLLLEEELLLLLLLLLL-LHHHHHHHHHHLLL---LLHHHHHHH-HHHHHHLLLllhhh
Query NDKANYSLNTDDPLIFKS-TLDTDYQMTKKDMG---FTEEEFKRL-NINAAKSSFlpeee  336
ident       |   |               ||            |         |         
Sbjct DAGVPVSIGVDGAASNEAaDMISEVHMTWLAQRarlASIAEVIHWgTAGGARVMG-----  336
DSSP  HHLLLEEELLLHHHHLLLlLHHHHHHHHHHHHHhllLLHHHHHHHhLHHHHHHHL-----


DSSP  HHHHHhhHHHH-------------------------------------------------
Query KKELLerLYRE-------------------------------------------------  347
ident   |                                                         
Sbjct LDEVG--KVAVgyaadiavyrlddpryfglhdpaigpvasggrpsvmalfsagkrvvvdd  394
DSSP  LLLLL--LLLLllllleeeeelllhhhlllllhhhhhhhllllleeeeeeelleeeeell


DSSP  -------------------------ll
Query -------------------------yq  349
ident                            
Sbjct liegvdikelggearrvvrellrevvv  421
DSSP  llllllhhhhhhhhhhhhhhhhhhhhl


No 9: Query=1a4mA Sbjct=2oofA Z-score=19.6

back to top
DSSP  --------------------------------------------------------llll
Query --------------------------------------------------------tpaf    4
ident                                                             
Sbjct lncervwlnvtpatlrsdladygllephalgvhegrihalvpxqdlkypahwqdxkgklv   60
DSSP  lllleeeeeeeellllllllllllllleeeeeelleeeeeeehhhllllllleellllee


DSSP  LLLEEEEEEEHHhlllhhhhhhhhhhhllllllllhhhHHHHH----lllllllhhhhhL
Query NKPKVELHVHLDgaikpetilyfgkkrgialpadtveeLRNII----gmdkplslpgflA   60
ident        | ||                                                 
Sbjct TPGLIDCHTHLI----------------------fagsRAEEFelrqkgvpyaeiarkgG   98
DSSP  EELEEEEEELLL----------------------llllLHHHHhhhhhlllhhhhhhllL


DSSP  LHHHHHHHHL-LLHHHHHHHHHHHHHHHHHLLEEEEEEEELLHHhllllllllhhhllll
Query KFDYYMPVIA-GCREAIKRIAYEFVEMKAKEGVVYVEVRYSPHLlanskvdpmpwnqteg  119
ident                     |   |     |||  ||      |                
Sbjct GIISTVRATRaASEDQLFELALPRVKSLIREGVTTVEIKSGYGL---------------t  143
DSSP  LHHHHHHHHHhLLHHHHHHHHHHHHHHHHHHLEEEEEEELLLLL---------------l


DSSP  llLHHHHHHHHHHHHHHHhhhhLLEEEEEEE-EELL----------LHHHHH-HHHHHHH
Query dvTPDDVVDLVNQGLQEGeqafGIKVRSILC-CMRH----------QPSWSL-EVLELCK  167
ident                        | |   |                       |      
Sbjct leDELKXLRVARRLGEAL----PIRVKTTLLaAHAVppeyrddpdsWVETICqEIIPAAA  199
DSSP  hhHHHHHHHHHHHHHHHL----LLEEEEEEEeELLLlhhhlllhhhHHHHHHhLHHHHHH


DSSP  HLLLllEEEEEEEllLLLLlHHHLhhHHHHHHHHHHHLLEEEEEELLLLLHHHHHHHHHl
Query KYNQktVVAMDLAgdETIEgSSLFpgHVEAYEGAVKNGIHRTVHAGEVGSPEVVREAVDi  227
ident         | |    | |  |         |  |   |     |            |   
Sbjct EAGL--ADAVDVF-cEHIGfSLAQ--TEQVYLAADQYGLAVKGHXDQLSNLGGSTLAAN-  253
DSSP  HLLL--LLEEEEE-eLLLLlLHHH--HHHHHHHHHHLLLEEEEEELLLLLLLHHHHHHH-


DSSP  LLLLEEEELHHHHhlHHHHHHHHHLLLEEEELHHHHHHLLLLLlllLLHHHHHHHLLLLE
Query LKTERVGHGYHTIedEALYNRLLKENMHFEVCPWSSYLTGAWDpktTHAVVRFKNDKANY  287
ident      | |             |          |   |            ||         
Sbjct FGALSVDHLEYLD--PEGIQALAHRGVVATLLPTAFYFLKETK---LPPVVALRKAGVPX  308
DSSP  LLLLEEEELLLLL--HHHHHHHHHHLLEEEELHHHHHHLLLLL---LLLHHHHHHLLLLE


DSSP  EELLLLLL-LLLL-LHHHHHHHHHHLLLLLHHHHHHH-HHHHHHLLLLlhhhHHHHHhhH
Query SLNTDDPL-IFKS-TLDTDYQMTKKDMGFTEEEFKRL-NINAAKSSFLpeeeKKELLerL  344
ident     |          |           | |  |        ||            |    
Sbjct AVSSDINPgTAPIvSLRXAXNXACTLFGLTPVEAXAGvTRHAARALGE----QEQLG--Q  362
DSSP  EELLLLLLlLLLLlLHHHHHHHHHHHHLLLHHHHHHHlLHHHHHHLLL----LLLLL--L


DSSP  HHH------------------------------------ll
Query YRE------------------------------------yq  349
ident  |                                       
Sbjct LRVgxladflvwncghpaelsyligvdqlvsrvvngeetlh  403
DSSP  LLLllllleeeellllllhhhhlllllleeeeeelleelll


No 10: Query=1a4mA Sbjct=2a3lA Z-score=19.3

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct qpdpiaadilrkepeqetfvrlnvplevptsdeveaykclqeclelrkryvfqetvapwe   60
DSSP  llllllllllllllllllllllllllllllllllllhhhhhhhhhhhhllllllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct keepfahypqgksdhcfemqdgvvhvfankdakedlfpvadatafftdlhhvlkviaagn  120
DSSP  lllllllllllllllllllllllllllllllllllllllllhhhhhhhhhhhhhhlllhh


DSSP  -----------------------------------lllLLLL-EEEEEEEHHHLL----L
Query -----------------------------------tpaFNKP-KVELHVHLDGAI----K   20
ident                                       |    ||  |||          
Sbjct irtlchrrlvlleqkfnlhlmlnadkeflaqksaphrdFYNVrKVDTHVHHSACMnqkhL  180
DSSP  hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhlllllLLLLlEEEEEEELLLLLlhhhH


DSSP  HHHHHHH-----hhHHLL---------------lllLLLHhhHHHH---hlllllllhhH
Query PETILYF-----gkKRGI---------------alpADTVeeLRNI---igmdkplslpG   57
ident    |                                                        
Sbjct LRFIKSKlrkepdeVVIFrdgtyltlrevfesldltGYDL--NVDLldvhadkstfhrfD  238
DSSP  HHHHHHHhhlllllLLEEelleeelhhhhhhhhlllLLLL--LLLLlllllllllllllL


DSSP  HHLLH------HHHHH-HHLL----LHHHHHHHHHHHHHHHH-HLLEeEEEEEELLHhhl
Query FLAKF------DYYMP-VIAG----CREAIKRIAYEFVEMKA-KEGVvYVEVRYSPHlla  105
ident                                 |                 | | |     
Sbjct KFNLKynpcgqSRLREiFLKQdnliQGRFLGEITKQVFSDLEaSKYQ-MAEYRISIY---  294
DSSP  LLHHHhlllllLHHHHhHLLLllllLLLLHHHHHHHHHHHHLlLLLE-EEEEEEELL---


DSSP  llLLLLlhhhllllllLHHHHHHHH--hHHHHhhhhhhlLEEEEEEEEELLL--------
Query nsKVDPmpwnqtegdvTPDDVVDLV--nQGLQegeqafgIKVRSILCCMRHQ--------  155
ident                   |                      |       |          
Sbjct -gRKMS----------EWDQLASWIvnnDLYS-------ENVVWLIQLPRLYniykdmgi  336
DSSP  -lLLLL----------HHHHHHHHHhllLLLL-------LLEEEEEEEELLHhhhlllll


DSSP  ----hHHHHHHHH-------------hhhHLLLlLEEEEEEELLLLLLL-----------
Query ----pSWSLEVLE-------------lckKYNQkTVVAMDLAGDETIEG-----------  187
ident                                    ||  ||  ||               
Sbjct vtsfqNILDNIFIplfeatvdpdshpqlhVFLK-QVVGFDLVDDESKPErrptkhmptpa  395
DSSP  llllhHHHHHHLLhhhhhhhlhhhllllhHHHL-LEEEEEEELLLLLLLlllllllllll


DSSP  --------HHHLhHHHHHHHHHHHHL----------LEEEEEELLLLLHHHHHHHHHllL
Query --------SSLFpGHVEAYEGAVKNG----------IHRTVHAGEVGSPEVVREAVDilK  229
ident                   |                 |    | || |             
Sbjct qwtnafnpAFSY-YVYYCYANLYVLNklreskgmttITLRPHSGEAGDIDHLAATFL--T  452
DSSP  llllllllLHHH-HHHHHHHHHHHHHhhhlllllllLEELLLLLLLLLLHHHHHHHH--H


DSSP  LLEEEELHHHHHLHHHHHHHHHLLLEEEELHHHHHHlLLLLLlLLLHHHHHHHLLLLEEE
Query TERVGHGYHTIEDEALYNRLLKENMHFEVCPWSSYLtGAWDPkTTHAVVRFKNDKANYSL  289
ident      ||        |              | |       |         |     | ||
Sbjct CHSIAHGINLRKSPVLQYLYYLAQIGLAMSPLSNNS-LFLDY-HRNPFPVFFLRGLNVSL  510
DSSP  LLLLLLLHHHHHLHHHHHHHHHHLLLEEELHHHHLL-LLLLL-LLLLHHHHHHLLLLEEE


DSSP  LLLLLLLLLL---LHHHHHHHHHHLLLLLHHHHHHHHHHHHHLLLLLHHHHHHHHH----
Query NTDDPLIFKS---TLDTDYQMTKKDMGFTEEEFKRLNINAAKSSFLPEEEKKELLE----  342
ident  |||||        |   |                   |    |      |         
Sbjct STDDPLQIHLtkePLVEEYSIAASVWKLSACDLCEIARNSVYQSGFSHALKSHWIGkdyy  570
DSSP  LLLLHHHHLLlllHHHHHHHHHHHHHLLLHHHHHHHHHHHHHHLLLLHHHHHHHLLllll


DSSP  ------hhHHHLL---------------------------------
Query ------rlYREYQ---------------------------------  349
ident                                               
Sbjct krgpdgndIHKTNvphirvefrdtiwkeemqqvylgkavisdevvp  616
DSSP  lllhhhllHHHHLllhhhhhhhhhhhhhhhhhhlllllllllllll


No 11: Query=1a4mA Sbjct=3mkvA Z-score=18.8

back to top
DSSP  ---------------------------------------------------llllLLLEE
Query ---------------------------------------------------tpafNKPKV    9
ident                                                             
Sbjct lttflfrngalldpdhpdllqgfeiliedgfirevsdkpikssnahvidvkgktiMPGLI   60
DSSP  lleeeeeeeeelllllllleeeeeeeeelleeeeeellllllllleeeelllleeEELEE


DSSP  EEEEEHHhLLLHhhhhhhhhhhllllllllhhhhhhhhlllllllhhhhhlLHHHHHHHh
Query ELHVHLDgAIKPetilyfgkkrgialpadtveelrniigmdkplslpgflaKFDYYMPVi   69
ident  ||||   ||                                                  
Sbjct DLHVHVV-AIEF---------------------------------------NLPRVATL-   79
DSSP  EEEELLL-LLLL---------------------------------------LHHHHLLL-


DSSP  llLHHHHHHHHHHHHHHHHHLLEEEEEEEELlhhhllllllllhhhlllllllhhhhhhh
Query agCREAIKRIAYEFVEMKAKEGVVYVEVRYSphllanskvdpmpwnqtegdvtpddvvdl  129
ident           |          |   |                                  
Sbjct --PNVLVTLRAVPIMRAMLRRGFTTVRDAGG----------------------------a  109
DSSP  --LHHHHHHHHHHHHHHHHHLLEEEEEELLL----------------------------l


DSSP  HHHHHHHHHH--HHLLEEEEE-EEEEL-------------------------------LL
Query VNQGLQEGEQ--AFGIKVRSI-LCCMR-------------------------------HQ  155
ident      |  |     |                                             
Sbjct GYPFKQAVESglVEGPRLFVSgRALSQtgghadprarsdymppdspcgccvrvgalgrVA  169
DSSP  LHHHHHHHHLllLLLLEEEELlLEEELllllllllllllllllllllllllllllleeEL


DSSP  HH--HHHHHHHHHHHLLlllEEEEEEELLL--------LLLLHHHLHHHHHHHHHHHHHL
Query PS--WSLEVLELCKKYNqktVVAMDLAGDE--------TIEGSSLFPGHVEAYEGAVKNG  205
ident                                                        |   |
Sbjct DGvdEVRRAVREELQMG---ADQIXIMASGgvasptdpVGVFGYSEDEIRAIVAEAQGRG  226
DSSP  LLhhHHHHHHHHHHHHL---LLLEEEELLLllllllllLLLLLLLHHHHHHHHHHHHLLL


DSSP  LEEEEEELlllLHHHHHHHHHLlLLLEEEELHHHHhlHHHHHHHHHLLLEEEELHHHHHH
Query IHRTVHAGevgSPEVVREAVDIlKTERVGHGYHTIedEALYNRLLKENMHFEVCPWSSYL  265
ident      ||     |     ||         ||                             
Sbjct TYVLAHAY---TPAAIARAVRC-GVRTIEHGNLID--DETARLVAEHGAYVVPTLVTYDA  280
DSSP  LLEEEEEL---LHHHHHHHHHL-LLLEEEELLLLL--HHHHHHHHHHLLEEELLHHHHHH


DSSP  L------------------LLLLlllLLHHHHHHHLLLLEEELLLLLLLLLLLHHHHHHH
Query T------------------GAWDpktTHAVVRFKNDKANYSLNTDDPLIFKSTLDTDYQM  307
ident                            |     |         ||               
Sbjct LasegekyglppesiakiaDVHG-agLHSIEIMKRAGVKMGFGTDLLGEAQRLQSDEFRI  339
DSSP  HhhhlllllllhhhhllhhHHHL-lhHHHHHHHHHHLLLLLLLLLLLHHHHHHLLHHHHH


DSSP  HHhlLLLLHHHHHHHH-HHHHHLLLLlhhhHHHHHhhHHHH-------------------
Query TKkdMGFTEEEFKRLN-INAAKSSFLpeeeKKELLerLYRE-------------------  347
ident           |      |  |            |                          
Sbjct LA--EVLSPAEVIASAtIVSAEVLGM----QDKLG--RIVPgahadvlvvdgnplksvdc  391
DSSP  HH--LLLLHHHHHHHLlHHHHHHLLL----LLLLL--LLLLllllleeeellllllllll


DSSP  ---------------------ll
Query ---------------------yq  349
ident                        
Sbjct llgqgehiplvmkdgrlfvnele  414
DSSP  llllllllleeeelleeeeelll


No 12: Query=1a4mA Sbjct=3mtwA Z-score=18.5

back to top
DSSP  ----------------------------------------------------llllLLLE
Query ----------------------------------------------------tpafNKPK    8
ident                                                             
Sbjct aeikavsaarlldvasgkyvdnplvivtdgritsigkkgdavpagatavdlpgvtlLPGL   60
DSSP  lleeeeeeeeeeelllleeeeleeeeeelleeeeeeellllllllleeeeeeeeeeEELE


DSSP  EEEEEEHHhLLLHhhhhhhhhhhllllllllhhhhhhhhlllllllhhhhhllHHHHHHH
Query VELHVHLDgAIKPetilyfgkkrgialpadtveelrniigmdkplslpgflakFDYYMPV   68
ident    |||||                                               |    
Sbjct IDMHVHLD-SLAE---------------------------------------vGGYNSLE   80
DSSP  EEEEELLL-LLLL---------------------------------------lLHHHHHH


DSSP  HllLHHHHHHHHHHHHHHHHHLLEEEEEEEELLhhhllllllllhhhlllllllhhhhHH
Query IagCREAIKRIAYEFVEMKAKEGVVYVEVRYSPhllanskvdpmpwnqtegdvtpddvVD  128
ident                       |   |                                 
Sbjct Y--SDRFWSVVQTANAKKTLEAGFTTVRNVGAA-------------------------DY  113
DSSP  L--LHHHHHHHHHHHHHHHHHLLEEEEEELLLL-------------------------LL


DSSP  HHHHHHHHHHH--HHLLEEEEE-EEEEL--------------------LLHH--HHHHHH
Query LVNQGLQEGEQ--AFGIKVRSI-LCCMR--------------------HQPS--WSLEVL  163
ident                |                                   |        
Sbjct DDVGLREAIDAgyVPGPRIVTAaISFGAtgghcdstffppsmdqknpfNSDSpdEARKAV  173
DSSP  HHHHHHHHHHLllLLLLEEEELlLLEELlllllllllllhhhllllllLLLLhhHHHHHH


DSSP  HHHHHLLlllEEEEEEE-LLLL-------lLLHHHLHHHHHHHHHHHHHLLEEEEEELll
Query ELCKKYNqktVVAMDLA-GDET-------iEGSSLFPGHVEAYEGAVKNGIHRTVHAGev  215
ident    |||                                       |   ||    ||   
Sbjct RTLKKYG---AQVIXICaTGGVfsrgnepgQQQLTYEEMKAVVDEAHMAGIKVAAHAH--  228
DSSP  HHHHHLL---LLEEEEElLLLLllllllllLLLLLHHHHHHHHHHHHHLLLEEEEEEL--


DSSP  lLHHHHHHHHHLlLLLEEEELHHHHhlHHHHHHHHHLLLEEEELHHHHH-----------
Query gSPEVVREAVDIlKTERVGHGYHTIedEALYNRLLKENMHFEVCPWSSY-----------  264
ident       ||||         |                    |                   
Sbjct -GASGIREAVRA-GVDTIEHASLVD--DEGIKLAVQKGAYFSMDIYNTDytqaegkkngv  284
DSSP  -LHHHHHHHHHL-LLLEEEELLLLL--HHHHHHHHHHLLEEELLLLLHHhhhhhhhhhll


DSSP  -------HLLLLLllllLHHHHHHHLLLLEEELLLLlLLLL-lLHHHHHHHHHhLLLLLH
Query -------LTGAWDpkttHAVVRFKNDKANYSLNTDDpLIFK-sTLDTDYQMTKkDMGFTE  316
ident                                  ||   |                 | | 
Sbjct lednlrkDRDIGE-lqrENFRKALKAGVKMVYGTDA-GIYPhgDNAKQFAVMV-RYGATP  341
DSSP  lhhhhhhHHHHHH-hhhHHHHHHHHHLLEEELLLLL-LLLLllLHHHHHHHHH-HLLLLH


DSSP  HHHHHH-HHHHHHLLLLlhhhHHHHhhHHHH-----------------------------
Query EEFKRL-NINAAKSSFLpeeeKKELleRLYR-----------------------------  346
ident           ||          |                                     
Sbjct LQAIQSaTLTAAEALGR----SKDV--GQVAvgrygdmiavagdpladvttlekpvfvmk  395
DSSP  HHHHHHlLHHHHHHHLL----LLLL--LLLLlllllleeeelllllllhhhhhllleeee


DSSP  ------hll
Query ------eyq  349
ident          
Sbjct ggavvkapx  404
DSSP  lleeeelll


No 13: Query=1a4mA Sbjct=4c5yA Z-score=18.0

back to top
DSSP  -------------------------------------------------------lllll
Query -------------------------------------------------------tpafn    5
ident                                                             
Sbjct deakvtiiyagllipgdgeplrnaalvisdkiiafvgseadipkkylrstqsthrvpvlm   60
DSSP  lllleeeeeeeeellllllleeeeeeeeelleeeeeeehhhllhhhhhhllleeeeeeee


DSSP  LLEEEEEEEHHhlLLHHhhhhhhhhhllllllllhhhhhhhhlllllllhhhhhLLHHhH
Query KPKVELHVHLDgaIKPEtilyfgkkrgialpadtveelrniigmdkplslpgflAKFDyY   65
ident       | |                                                   
Sbjct PGLWDCHMHFG--GDDD-----------------------------------yyNDYT-S   82
DSSP  ELEEEEEELLL--LLLL-----------------------------------llLLLH-H


DSSP  HHHHllLHHHHHHHHHHHHHHHHHLLEEEEEEEEllhhhllllllllhhhlllllllhhh
Query MPVIagCREAIKRIAYEFVEMKAKEGVVYVEVRYsphllanskvdpmpwnqtegdvtpdd  125
ident                          |                                  
Sbjct GLAT--HPASSGARLARGCWEALQNGYTSYRDLA--------------------------  114
DSSP  HHHL--LHHHHHHHHHHHHHHHHHLLEEEEEELL--------------------------


DSSP  hhhhhHHHHHHHHH--HHLLEEEEE-EEEEL-----------------------------
Query vvdlvNQGLQEGEQ--AFGIKVRSI-LCCMR-----------------------------  153
ident                   |  | |                                    
Sbjct --gygCEVAKAINDgtIVGPNVYSSgAALSQtaghgdifalpagevlgsygvmnprpgyw  172
DSSP  --llhHHHHHHHHLllLLLLEEEELlLEEELlllllllllllhhhhhhhhllllllllll


DSSP  ------LLHH--HHHHHHHHHHHLLlllEEEEEEE-LLLL-------lLLHHHLHHHHHH
Query ------HQPS--WSLEVLELCKKYNqktVVAMDLA-GDET-------iEGSSLFPGHVEA  197
ident                    |                                        
Sbjct gagplcIADGveEVRRAVRLQIRRG---AKVIXVMaSGGVmsrddnpnFAQFSPEELKVI  229
DSSP  lllleeELLLhhHHHHHHHHHHHHL---LLLEEEElLLLLllllllllLLLLLHHHHHHH


DSSP  HHHHHHHLLEEEEEELlllLHHHHHHHHHlLLLLEEEELHHHHhlHHHHHHHHHLLLEEE
Query YEGAVKNGIHRTVHAGevgSPEVVREAVDiLKTERVGHGYHTIedEALYNRLLKENMHFE  257
ident  | |         |            |          |       |              
Sbjct VEEAARQNRIVSAHVH---GKAGIMAAIK-AGCKSLEHVSYAD--EEVWELMKEKGILYV  283
DSSP  HHHHHHLLLLEEEEEL---LHHHHHHHHH-HLLLEEEELLLLL--HHHHHHHHHHLLEEE


DSSP  ELHHHHHHL-----------------LLLLlllLLHHHHHHHLLLLEEELLLLLllllLL
Query VCPWSSYLT-----------------GAWDpktTHAVVRFKNDKANYSLNTDDPlifkST  300
ident                              |     |            | ||        
Sbjct ATRSVIEIFlasngeglvkeswaklqALAD-shLKAYQGAIKAGVTIALGTDTA--pgGP  340
DSSP  LLHHHHHHHhhhllllllllhhhlllHHHH-hhHHHHHHHHHLLLLEELLLLLL--llLL


DSSP  HHHHHHHHHHLLLLLHHHHHHH-HHHHhHLLL--LLHHhhhHHHH----hhhHHLL----
Query LDTDYQMTKKDMGFTEEEFKRL-NINAaKSSF--LPEEekkELLE----rlyREYQ----  349
ident      |      | |  |       ||   |                             
Sbjct TALELQFAVERGGMTPLEAIKAaTANA-PLSVgpQAPL---TGQLregyeadVIALeenp  396
DSSP  LHHHHHHHHHLLLLLHHHHHHHhLLLH-HHHHhhHLLL---LLLLlllllllEEEEllll


DSSP  ----------------------------------------
Query ----------------------------------------  349
ident                                         
Sbjct ledikvfqepkavthvwkggklfkgpgigpwgedarnpfl  436
DSSP  lllhhhhhlhhheeeeeelleeeellllllllllllllll


No 14: Query=1a4mA Sbjct=3icjA Z-score=17.7

back to top
DSSP  ------------------------------------------------------llllLL
Query ------------------------------------------------------tpafNK    6
ident                                                             
Sbjct cmkalingtiytsfspvkkvsglvisnervlyagdsstalriaelaggeiidlkgkfvMP   60
DSSP  leeeeelleeeeeelleeeeleeeeelleeeeeelhhhhhhhhhhhlleeeelllleeEE


DSSP  LEEEEEEEHHHL--LLHH-----------------hhhHHHH------------------
Query PKVELHVHLDGA--IKPE-----------------tilYFGK------------------   29
ident      | |||                                                  
Sbjct AFFDSHLHLDELgmSLEMvdlrgvksmeelvervkkgrGRIIfgfgwdqdelgrwptred  120
DSSP  LEEEEEELHHHHhhHHHLeellllllhhhhhhhhhlllLLLEeeeeelhhhhlllllhhh


DSSP  ---hhLLLLLLllhhhHHHH------------------hlllllllhhhhhllHHHHHHH
Query ---krGIALPAdtveeLRNI------------------igmdkplslpgflakFDYYMPV   68
ident                  |                                          
Sbjct ldvidRPVFLY-----RRCFhvavmnskmidllnlkpskdfdestgivreralEESRKII  175
DSSP  hllllLLEEEE-----ELLLleeeelhhhhhhhllllllleelllleeehhhhHHHHHHH


DSSP  HL--LLHHHHHHHHHHHHHHHHHLLEEEEEEEELLHhhllllllllhhhlllllllhhHH
Query IA--GCREAIKRIAYEFVEMKAKEGVVYVEVRYSPHllanskvdpmpwnqtegdvtpdDV  126
ident           |       |     ||  |                               
Sbjct NEkiLTVKDYKHYIESAQEHLLSLGVHSVGFMSVGE----------------------KA  213
DSSP  HHllLLHHHHHHHHHHHHHHHHHLLEEEEEEEEELH----------------------HH


DSSP  HHHHHHHH--HHHHhhhlLEEEEEEEEelllhhhhhHHHHHHH---HLLLL----LEEEE
Query VDLVNQGL--QEGEqafgIKVRSILCCmrhqpswslEVLELCK---KYNQK----TVVAM  177
ident                     |   |           | |                     
Sbjct LKALFELEreGRLK----MNVFAYLSP---------ELLDKLEelnLGKFEgrrlRIWGV  260
DSSP  HHHHHHHHhlLLLL----LEEEEEELH---------HHHHHHHhhlLLLEEllleEEEEE


DSSP  EEELLLL-------------------LLLHHHLHHHHHHHHHHHHHLLEEEEEELlllLH
Query DLAGDET-------------------IEGSSLFPGHVEAYEGAVKNGIHRTVHAGevgSP  218
ident  |  |                      |        ||  | |   |    |||      
Sbjct XLFVDGSlgartallsepytdnpttsGELVMNKDEIVEVIERAKPLGLDVAVHAI---GD  317
DSSP  EEELLLLlllllllllllllllllllLLLLLLHHHHHHHHHHHLLLLLEEEEEEL---LH


DSSP  HHHHHHHHLL----LLLEEEELHHHhhLHHHHHHHHHLLLEEEELHHHHHHLLllLLLL-
Query EVVREAVDIL----KTERVGHGYHTieDEALYNRLLKENMHFEVCPWSSYLTGawDPKT-  273
ident   |  | |         |  |            |           |              
Sbjct KAVDVALDAFeeaeFSGRIEHASLV--RDDQLERIKELKVRISAQPHFIVSDW-wIVNRv  374
DSSP  HHHHHHHHHHhhhlLLLEEEELLLL--LHHHHHHHHHHLLEEEELLLHHHHLL-lHHHHh


DSSP  -------lLHHHHHHhLLLLEEELLLLLllLLLL-HHHHHHHHHHLL------LLLHHHH
Query -------tHAVVRFKnDKANYSLNTDDPliFKST-LDTDYQMTKKDM------GFTEEEF  319
ident                         || |                             || 
Sbjct geerakwaYRLKTLS-SITKLGFSTDSP--IEPAdPWVSIDAAVNRYvvdpgeRVSREEA  431
DSSP  hhhhhhhlLLHHHHH-HHLLEEELLLLL--LLLLlHHHHHHHHHHLLlllhhhLLLHHHH


DSSP  HHH-HHHHHHLLLllhhhHHHHhhHHHH-------------hll
Query KRL-NINAAKSSFlpeeeKKELleRLYR-------------eyq  349
ident   |     |            |                      
Sbjct LHLyTHGSAQVTL-----AEDL--GKLErgfraeyiildrdplk  468
DSSP  HHHlLHHHHHHLL-----LLLL--LLLLlllllleeeellllll


No 15: Query=1a4mA Sbjct=2imrA Z-score=17.6

back to top
DSSP  -------------------------------------------------LLLLLLLEEEE
Query -------------------------------------------------TPAFNKPKVEL   11
ident                                                        | |  
Sbjct htprlltcdvlytgaqspggvvvvgetvaaaghpdelrrqyphaaeeraGAVIAPPPVNA   60
DSSP  lleeeeeeleeelleelleeeeeelleeeeeelhhhhhhhlllleeeelLLEELLLLLEE


DSSP  EEEHHHlllhhhhhhhhhhhllllllllhhhhhhhhllllllLHHH---HHLLHHHhhhh
Query HVHLDGaikpetilyfgkkrgialpadtveelrniigmdkplSLPG---FLAKFDYympv   68
ident | |||                                                       
Sbjct HTHLDM---------------------------sayefqalpYFQWipeVVIRGRH----   89
DSSP  EEELLL---------------------------lhhhhhhlhHHHLlhhHHHHHLL----


DSSP  hlllhhhHHHHHHHHHHHHHHLLEEEEEEEELLhhhllllllllhhhlllllllhHHHHH
Query iagcreaIKRIAYEFVEMKAKEGVVYVEVRYSPhllanskvdpmpwnqtegdvtpDDVVD  128
ident            |          |   |                              | |
Sbjct -----lrGVAAAQAGADTLTRLGAGGVGDIVWA----------------------PEVMD  122
DSSP  -----llHHHHHHHHHHHHHHLLLLLEEEEELL----------------------HHHHH


DSSP  HHHHhhHHHHhhhllEEEEEEEEELL----LHHHHHHHHHHHHHLLLL----LEEEEEEE
Query LVNQglQEGEqafgiKVRSILCCMRH----QPSWSLEVLELCKKYNQK----TVVAMDLA  180
ident        |                                                    
Sbjct ALLA--REDL-----SGTLYFEVLNPfpdkADEVFAAARTHLERWRRLerpgLRLGLSPH  175
DSSP  HHHL--LLLL-----LEEEEEEELLLlhhhHHHHHHHHHHHHHHHHLLllllEEEEEEEL


DSSP  llllllLHHHLHHHHHHHHHHHHHLLEEEEEELLLLL-----------------------
Query gdetieGSSLFPGHVEAYEGAVKNGIHRTVHAGEVGS-----------------------  217
ident                     |   |     |  |                          
Sbjct ----tpFTVSHRLMRLLSDYAAGEGLPLQIHVAEHPTelemfrtgggplwdnrmpalyph  231
DSSP  ----llLLLLHHHHHHHHHHHHHHLLLLEEEELLLHHhhhhhhhlllllhhhllhhhlll


DSSP  -------------hHHHHHHH-HLLL--LLEEEELHHHhhLHHHHHHHHHLLLEEEELHH
Query -------------pEVVREAV-DILK--TERVGHGYHTieDEALYNRLLKENMHFEVCPW  261
ident                 ||               |            |          || 
Sbjct tlaevigrepgpdlTPVRYLDeLGVLaaRPTLVHMVNV--TPDDIARVARAGCAVVTCPR  289
DSSP  lhhhhhllllllllLHHHHHHhHLLHhhLLEEEELLLL--LHHHHHHHHHHLLLEEELHH


DSSP  HHHHLLLLlllllLHHHHHHHLLLLEEELLLLLLLLLL-LHHHHHHHHHHLLL-LLHHHH
Query SSYLTGAWdpkttHAVVRFKNDKANYSLNTDDPLIFKS-TLDTDYQMTKKDMG-FTEEEF  319
ident |                 |        | ||                             
Sbjct SNHHLECG----tFDWPAFAAAGVEVALGTDSVASGETlNVREEVTFARQLYPgLDPRVL  345
DSSP  HHHHLLLL----lLLHHHHHHLLLLEEELLLLHHHHLLlLLHHHHHHHHHHLLlLLHHHH


DSSP  HHH-HHHHHHLLLllhhhhhhhhhhHHHH----------------ll
Query KRL-NINAAKSSFlpeeekkellerLYRE----------------yq  349
ident  |                                             
Sbjct VRAaVKGGQRVVG------------TPFLrrgetwqegfrwelsrdl  380
DSSP  HHHhHHHHHHHHL------------LLLLlllllllhhhlhhhllll


No 16: Query=1a4mA Sbjct=3nqbA Z-score=16.7

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct epadlnddtlraravaaargdqrfdvlitggtlvdvvtgelrpadigivgaliasvhepa   60
DSSP  llhhhllhhhhhhhhhhhhlllleeeeeelleeelllllleeeleeeeelleeeeeelll


DSSP  ------------llllLLLEEEEEEEHHHLLLhhhhhhhhhhhllllllllhhhhhhhhl
Query ------------tpafNKPKVELHVHLDGAIKpetilyfgkkrgialpadtveelrniig   48
ident                        | |                                  
Sbjct srrdaaqvidaggayvSPGLIDTHXHIESSXI----------------------------   92
DSSP  lllleeeeeelllleeEELEEEEEELHHHHLL----------------------------


DSSP  llllllhhhhhllhhhhhhhhlllhhhhhhHHHHHHHHHHHLLEEEEEEEEL-LHHHLll
Query mdkplslpgflakfdyympviagcreaikrIAYEFVEMKAKEGVVYVEVRYS-PHLLAns  107
ident                                           ||                
Sbjct ------------------------------TPAAYAAAVVARGVTTIVWDPHeFGNVH--  120
DSSP  ------------------------------LHHHHHHHHHLLLEEEEEELLHhHHHHH--


DSSP  lllllhhhlllllllHHHHHHHHHHHHHHHhhhhLLEEEEEEEEE--------lllhHHH
Query kvdpmpwnqtegdvtPDDVVDLVNQGLQEGeqafGIKVRSILCCM--------rhqpSWS  159
ident                  | |                                        
Sbjct ---------------GVDGVRWAAKAIENL----PLRAILLAPSCvpsapglerggaDFD  161
DSSP  ---------------LHHHHHHHHHHHLLL----LLEEEEEELLLllllllllllllLLL


DSSP  H-HHHHHHhHLLLllEEEE-EEELlllllLHHH--LHHHHHHHHHHHHHLLEEEEEElLL
Query L-EVLELCkKYNQktVVAM-DLAGdetieGSSL--FPGHVEAYEGAVKNGIHRTVHAgEV  215
ident       |                             |                  ||   
Sbjct AaILADLL-SWPE--IGGIaEIXN----xRGVIerDPRXSGIVQAGLAAEKLVCGHA-RG  213
DSSP  HhHHHHHH-LLLL--EEEEeEELL----hHHHHllLHHHHHHHHHHHHHLLEEEELL-LL


DSSP  LLHHHHHHHHHLlLLLEEEELH---HHHHlhhhhhhHHHLLLEEEELHhHHHHlllllll
Query GSPEVVREAVDIlKTERVGHGY---HTIEdealynrLLKENMHFEVCPwSSYLtgawdpk  272
ident                                      |      |    |          
Sbjct LKNADLNAFXAA-GVSSDHELVsgeDLXA-------KLRAGLTIELRG-SHDH------l  258
DSSP  LLHHHHHHHHHL-LLLEELLLLlhhHHHH-------HHHLLLEEEEEL-LLHH------h


DSSP  lLLHHHHHH--HLLL-LEEELLLLLLLLLL----LHHHHHHHHHHlLLLLHHHHHHH-HH
Query tTHAVVRFK--NDKA-NYSLNTDDPLIFKS----TLDTDYQMTKKdMGFTEEEFKRL-NI  324
ident     |              | |||           ||          |   |   |    
Sbjct lPEFVAALNtlGHLPqTVTLCTDDVFPDDLlqggGLDDVVRRLVR-YGLKPEWALRAaTL  317
DSSP  hHHHHHHHHhhLLLLlLEEEELLLLLHHHHhhllLHHHHHHHHHH-LLLLHHHHHHHhLH


DSSP  HHHHLLlllhhhHHHHhhHHHH--------------------------------------
Query NAAKSSflpeeeKKELleRLYR--------------------------------------  346
ident |||            |   |                                        
Sbjct NAAQRL-----gRSDL--GLIAagrradivvfedlngfsarhvlasgravaeggrxlvdi  370
DSSP  HHHHHH-----lLLLL--LLLLlllllleeeellllllleeeeeelleeeeelleellll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  346
ident                                                             
Sbjct ptcdttvlkgsxklplrxandflvksqgakvrlatidrprftqwgeteadvkdgfvvppe  430
DSSP  lllllhhhllllllllllhhhhllllllleeeeeeeellllleeeeeeeeeelleellll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  346
ident                                                             
Sbjct gatxisvthrhgxaepttktgfltgwgrwngafattvshdshnltvfggnagdxalaana  490
DSSP  leeeeeeellllllllleeeeeeellllllleeeelllllllleeeeellhhhhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  346
ident                                                             
Sbjct vigtgggxavasegkvtailplplsglvsdapleevarafedlreavgkvvewqppylvf  550
DSSP  hhhllleeeeeelleeeeeeelllllllllllhhhhhhhhhhhhhhhhhhlllllllllh


DSSP  ----------------------------------hll
Query ----------------------------------eyq  349
ident                                      
Sbjct kacfgatlacnigphqtdxgiadvltgkvxespviev  587
DSSP  hhhhlllllllllleelllleeelllleeellleeel


No 17: Query=1a4mA Sbjct=1yrrB Z-score=15.8

back to top
DSSP  ----------------------------------------------llllLLLEEEEEEE
Query ----------------------------------------------tpafNKPKVELHVH   14
ident                                                             
Sbjct yaltqgriftgheflddhavviadgliksvcpvaelppeieqrslngailSPGFIDVQLN   60
DSSP  leeelleeelllleelleeeeeelleeeeeeehhhlllllleeelllleeEELEEEEEEL


DSSP  hhHLLLhhhhhhhhhhhllllllllhhhhhhhhlllllllhhhhhllhhhhhhhHLLLhh
Query ldGAIKpetilyfgkkrgialpadtveelrniigmdkplslpgflakfdyympvIAGCre   74
ident   |                                                         
Sbjct --GCGG--------------------------------------------vqfnDTAE--   72
DSSP  --EELL--------------------------------------------eellLLLL--


DSSP  HHHH-HHHHHHHHHHHLLEEEEEEEELLHHhllllllllhhhlllllllhHHHHHHHHHH
Query AIKR-IAYEFVEMKAKEGVVYVEVRYSPHLlanskvdpmpwnqtegdvtpDDVVDLVNQG  133
ident |              | |                                |         
Sbjct AVSVeTLEIMQKANEKSGCTNYLPTLITTS--------------------DELMKQGVRV  112
DSSP  LLLHhHHHHHHHHHHLLLEEEEEEEELLLL--------------------HHHHHHHHHH


DSSP  HHHHHHHHLLEE-EEEEE-EELLlhhhhHHHHHHHHHLLLlLEEEEEEelllllllhHHL
Query LQEGEQAFGIKV-RSILC-CMRHqpswsLEVLELCKKYNQkTVVAMDLagdetiegsSLF  191
ident   |             |                              |            
Sbjct MREYLAKHPNQAlGLHLEgPWLN-----AALVDFLCENAD-VITKVTL-------apEMV  159
DSSP  HHHHHHHLLLLLlLEEEElLLLL-----LHHHHHHHHLHH-HEEEEEE-------lhHHL


DSSP  HhhHHHHHHHHHHLLEEEEEelllLLHHHHHHHHHlLLLLEEEELHhhhHLHH-----hH
Query PghVEAYEGAVKNGIHRTVHagevGSPEVVREAVDiLKTERVGHGYhtiEDEA-----lY  246
ident |   |        ||                            | |              
Sbjct P--AEVISKLANAGIVVSAG-hsnATLKEAKAGFR-AGITFATHLYnamPYITgrepglA  215
DSSP  L--HHHHHHHHHHLLEEEEL-lllLLHHHHHHHHH-HLEEEELLLLlllLLLLllllhhH


DSSP  HHHHH-LLLEEEELHhHHHHllllllllLLHHHHHHHL-LLLEEELLLLLlLLLLLHHHH
Query NRLLK-ENMHFEVCPwSSYLtgawdpktTHAVVRFKND-KANYSLNTDDPlIFKSTLDTD  304
ident    |                               |        | ||       |    
Sbjct GAILDeADIYCGIIA-DGLH------vdYANIRNAKRLkGDKLCLVTDATsGSSLTMIEG  268
DSSP  HHHHHlLLLEEEEEL-LLLL------llHHHHHHHHHHhHHHEEEELLLLlLLLLLHHHH


DSSP  HHHHHHLLLLLHHHHHHH-HHHHHHLLLLlhhhHHHHHhhHHHH----------------
Query YQMTKKDMGFTEEEFKRL-NINAAKSSFLpeeeKKELLerLYRE----------------  347
ident         |    |  |      |          | |                       
Sbjct VRNLVEHCGIALDEVLRMaTLYPARAIGV----EKRLG--TLAAgkvanltaftpdfkit  322
DSSP  HHHHHHHHLLLHHHHHHHhLHHHHHHLLL----LLLLL--LLLLllllleeeelllllee


DSSP  ----------ll
Query ----------yq  349
ident             
Sbjct ktivngnevvtq  334
DSSP  eeeelleeeeel


No 18: Query=1a4mA Sbjct=1gkpA Z-score=15.5

back to top
DSSP  ----------------------------------------------lllllLLEEEEEEE
Query ----------------------------------------------tpafnKPKVELHVH   14
ident                                                          |||
Sbjct pllikngeiitadsrykadiyaegetitrigqnleappgtevidatgkyvfPGFIDPHVH   60
DSSP  leeeelleeeelleeeeleeeelllllleeellllllllleeeelllleeeELEEEEEEL


DSSP  HHHlllhhhhhhhhhhhllllllllhhhhhhhhlllllllhhhhhllHHHHHhhhlllhh
Query LDGaikpetilyfgkkrgialpadtveelrniigmdkplslpgflakFDYYMpviagcre   74
ident                                                |            
Sbjct IYL-------------------------------------------pFMATF--------   69
DSSP  LLL-------------------------------------------eELLEE--------


DSSP  hhhhhhhHHHHHHHHLL---EEEEEEEELLHHHLlllllllhhhllllllLHHHHHHHHH
Query aikriayEFVEMKAKEG---VVYVEVRYSPHLLAnskvdpmpwnqtegdvTPDDVVDLVN  131
ident                              |                           |  
Sbjct ----akdTHETGSKAALmggTTTYIEMCCPSRND----------------DALEGYQLWK  109
DSSP  ----lllLHHHHHHHHHhllEEEEEEEELLLLLL----------------LHHHHHHHHH


DSSP  HHHHHHHhhhLLEEEEEEEEEllLHHHhhHHHHHHHHLLLLLEEEEEEElLLLL-llHHH
Query QGLQEGEqafGIKVRSILCCMrhQPSWslEVLELCKKYNQKTVVAMDLAgDETI-egSSL  190
ident                                                             
Sbjct SKAEGNS---YCDYTFHMAVS--KFDE--KTEGQLREIVADGISSFXIF-LSYKnffGVD  161
DSSP  HHHLLLL---LLEEEEEEELL--LLLL--LHHHHHHHHHHLLLLEEEEE-ELLLlllLLL


DSSP  LHHHHHHHHHHHHHLLEEEEEEL----------------------------llLLHHHHH
Query FPGHVEAYEGAVKNGIHRTVHAG----------------------------evGSPEVVR  222
ident           |   |   | |                                   |   
Sbjct DGEMYQTLRLAKELGVIVTAHCEnaelvgrlqqkllsegktgpewhepsrpeaVEAEGTA  221
DSSP  HHHHHHHHHHHHHHLLEEEEEELlhhhhhhhhhhhhhlllllhhhllllllhhHHHHHHH


DSSP  HHHHLL----LLLEEEELH--HHHHlhhHHHHHHHL--lLEEEELHH-------------
Query EAVDIL----KTERVGHGY--HTIEdeaLYNRLLKE--nMHFEVCPW-------------  261
ident      |     |  | |                         |                 
Sbjct RFATFLettgATGYVVHLSckPALD---AAMAAKARgvpIYIESVIPhflldktyaergg  278
DSSP  HHHHHHhhhlLEEEELLLLlhHHHH---HHHHHHHLlllEEEEEEHHhhhllhhhhhllh


DSSP  ---hhhHLLL-LLLLLLL-HHHHHHHLLLLEEELLLLLLL-----------------LLL
Query ---ssyLTGA-WDPKTTH-AVVRFKNDKANYSLNTDDPLI-----------------FKS  299
ident               |                   ||                        
Sbjct veamkyIMSPpLRDKRNQkVLWDALAQGFIDTVGTDHCPFdteqkllgkeaftaipnGIP  338
DSSP  hhhhllLLLLlLLLLHHHhHHHHHHHLLLLLEEELLLLLLlhhhhhhhlllhhhlllLLL


DSSP  LHHHHHHHHHHLLL----LLHHHHHHH-HHHHHHLLLLlhhhHHHHHhhHHHH-------
Query TLDTDYQMTKKDMG----FTEEEFKRL-NINAAKSSFLpeeeKKELLerLYRE-------  347
ident                        |       |||   |                      
Sbjct AIEDRVNLLYTYGVsrgrLDIHRFVDAaSTKAAKLFGL----FPRKG--TIAVgsdadlv  392
DSSP  LLLLHHHHHHHHHLllllLLHHHHHHHhLHHHHHHLLL----LLLLL--LLLLlllllee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  347
ident                                                             
Sbjct vydpqyrgtisvktqhvnndyngfegfeidgrpsvvtvrgkvavrdgqfvgekgwgkllr  452
DSSP  eeelllleellhhhllllllllllllleelleeeeeeelleeeeelleelllllllllll


DSSP  ----ll
Query ----yq  349
ident       
Sbjct repmyf  458
DSSP  llllll


No 19: Query=1a4mA Sbjct=1bf6A Z-score=15.1

back to top
DSSP  lllllLLEEEEEEEHHHlllhhhhhhhhhhhllllllllhhhhhhhhlllllllhhhhhL
Query tpafnKPKVELHVHLDGaikpetilyfgkkrgialpadtveelrniigmdkplslpgflA   60
ident            | ||                                             
Sbjct -sfdpTGYTLAHEHLHI----------------------------------------dlS   19
DSSP  -llllLLEEEEEELLLE----------------------------------------elH


DSSP  LHHHHHhhhlllhhhhhHHHHHHHHHHHHLL---EEEEEEEELLHHHllllllllhhhll
Query KFDYYMpviagcreaikRIAYEFVEMKAKEG---VVYVEVRYSPHLLanskvdpmpwnqt  117
ident  |                                |  |                      
Sbjct GFKNNV-------dcrlDQYAFICQEMNDLMtrgVRNVIEMTNRYMG-------------   59
DSSP  HHHLLH-------hheeLLHHHHHHHHHHHHhllEEEEEELLLHHHL-------------


DSSP  lllllhhhhhhhHHHHHHHHHHHHLLEEEEEEEEELLL-----------hHHHHHHHHHH
Query egdvtpddvvdlVNQGLQEGEQAFGIKVRSILCCMRHQ-----------pSWSLEVLELC  166
ident               |         || |                          |     
Sbjct -----------rNAQFMLDVMRETGINVVACTGYYQDAffpehvatrsvqELAQEMVDEI  108
DSSP  -----------lLHHHHHHHHHHHLLEEEEEELLLLHHhlllhhhhllhhHHHHHHHHHH


DSSP  HHL---llLLEEEEE-EELLLLLLL-HHHLhHHHHHHHHHHHHLLEEEEEElLLLLhhHH
Query KKY---nqKTVVAMD-LAGDETIEG-SSLFpGHVEAYEGAVKNGIHRTVHAgEVGSpeVV  221
ident                     |              |       |     |          
Sbjct EQGidgteLKAGIIAeIGTSEGKITpLEEK-VFIAAALAHNQTGRPISTHT-SFST--MG  164
DSSP  HLLlllllLLEEEEEeEELLLLLLLhHHHH-HHHHHHHHHHHHLLLEEEEL-HHHL--LH


DSSP  HHHHHLLL-------LLEEEELH--HHHHlhhHHHHHHHLLLEEE-ELHHhhHHLLlLLL
Query REAVDILK-------TERVGHGY--HTIEdeaLYNRLLKENMHFE-VCPWssYLTGaWDP  271
ident  |    |           |||                                       
Sbjct LEQLALLQahgvdlsRVTVGHCDlkDNLD---NILKMIDLGAYVQfDTIG--KNSY-YPD  218
DSSP  HHHHHHHHhllllhhHEEELLLLllLLHH---HHHHHHHLLLEEEeLLLL--LLLL-LLH


DSSP  LL-LLHHHHHHHLLL--LEEELLLL-LLLL-----LLLHHHHH-HHHHHL--LLLLHHHH
Query KT-THAVVRFKNDKA--NYSLNTDD-PLIF-----KSTLDTDY-QMTKKD--MGFTEEEF  319
ident                     |  |               |             ||     
Sbjct EKrIAMLHALRDRGLlnRVMLSMDItRRSHlkangGYGYDYLLtTFIPQLrqSGFSQADV  278
DSSP  HHhHHHHHHHHHLLLhhHEEELLLLlLHHHlhhhlLLLLLHHHhLHHHHHhhLLLLHHHH


DSSP  HHHH-HHHHHLLLllhhhhhhhhhhhhhhll
Query KRLN-INAAKSSFlpeeekkellerlyreyq  349
ident       |                        
Sbjct DVMLrENPSQFFQ------------------  291
DSSP  HHHHlHHHHHHLL------------------


No 20: Query=1a4mA Sbjct=3k2gB Z-score=15.0

back to top
DSSP  ---------------------llllllLEEEEEEEHHH-lllhhhhhhhhhhhllLLLLl
Query ---------------------tpafnkPKVELHVHLDG-aikpetilyfgkkrgiALPAd   38
ident                                 | ||                   |    
Sbjct slselspchvrsgrixtvdgpipssalGHTLXHEHLQNdcrcwwnppqeperqylAEAP-   59
DSSP  llllllllllllleeeelleeeehhhlLLEELLLLLLEelhhhllllllhhhhhhHHLL-


DSSP  lHHHHHhhhlLLLLllhhhhhllhHHHHhhhlllhhhhhhhHHHHHHHHHHLL---EEEE
Query tVEELRniigMDKPlslpgflakfDYYMpviagcreaikriAYEFVEMKAKEG---VVYV   95
ident    |                                                        
Sbjct iSIEIL--seLRQD------pfvnKHNI---------alddLDLAIAEVKQFAavgGRSI  102
DSSP  lLHHHH--hhHHLL------hhhlLLLL---------eellHHHHHHHHHHHHhllLLEE


DSSP  EEEELLHHHllllllllhhhlllllllhhhhhhhHHHHHHHHHHHHLLEEEEEEEEELLL
Query EVRYSPHLLanskvdpmpwnqtegdvtpddvvdlVNQGLQEGEQAFGIKVRSILCCMRHQ  155
ident                                       |       |  |          
Sbjct VDPTCRGIG------------------------rDPVKLRRISAETGVQVVXGAGYYLAS  138
DSSP  EELLLLLLL------------------------lLHHHHHHHHHHHLLEEEELLLLLLHH


DSSP  -----------hHHHHHHHHHHHHLL---lLLEEEEE-EELLllLLLH-hHLHHHHHHHH
Query -----------pSWSLEVLELCKKYN---qKTVVAMD-LAGDetIEGS-sLFPGHVEAYE  199
ident                 |                                        |  
Sbjct sxpetaarlsadDIADEIVAEALEGTdgtdARIGLIGeIGVS--SDFTaeEEKSLRGAAR  196
DSSP  hllhhhhlllhhHHHHHHHHHHHLLLllllLLLLLEEeELLL--LLLLhhHHHHHHHHHH


DSSP  HHHHHLLEEEEEELLLLLhhHHHHHHHLLL-------lLEEEELHHHHHLHHHHHHHHHL
Query GAVKNGIHRTVHAGEVGSpeVVREAVDILK-------tERVGHGYHTIEDEALYNRLLKE  252
ident   |  |    ||              |               |      |      |   
Sbjct AQVRTGLPLXVHLPGWFR--LAHRVLDLVEeegadlrhTVLCHXNPSHXDPVYQATLAQR  254
DSSP  HHHHHLLLEEELLLLLLL--LHHHHHHHHHhllllhhhEEELLLHHHLLLHHHHHHHHHH


DSSP  LLEEE-ELHHhHHHL------LLLLlllLLHHHHHHHLL-----LLEEELLLL-LLLL--
Query NMHFE-VCPWsSYLT------GAWDpktTHAVVRFKNDK-----ANYSLNTDD-PLIF--  297
ident     |                                           |  |        
Sbjct GAFLEfDXIG-XDFFyadqgvQCPS--dDEVARAILGLAdhgylDRILLSHDVfVKXXlt  311
DSSP  LLEEEeLLLL-LLLEelllleELLL--hHHHHHHHHHHHhlllhHHEEELLLLlLHHHlh


DSSP  ---LLLHHHHHHHHHHLLL---LLHHHHHHHH-HHHHHLlLLLHhhhhhhhhhhhhhll
Query ---KSTLDTDYQMTKKDMG---FTEEEFKRLN-INAAKSsFLPEeekkellerlyreyq  349
ident                               |   |     |                  
Sbjct rygGNGYAFVTKHFLPRLRrhgLDDAALETLXvTNPRRV-FDAS-----------iegh  358
DSSP  hhlLLLLLHHHHLHHHHHHhllLLHHHHHHHHlHHHHHH-HLLL-----------llll


No 21: Query=1a4mA Sbjct=2y1hB Z-score=15.0

back to top
DSSP  llllLLLEEEEEEEHHH-LLLHhhhhhhhhhhllllllllhhhhhhhhlllllllhhhhh
Query tpafNKPKVELHVHLDG-AIKPetilyfgkkrgialpadtveelrniigmdkplslpgfl   59
ident         |  | ||                                             
Sbjct ----GVGLVDCHCHLSApDFDR--------------------------------------   18
DSSP  ----LLLEEEEEELLLLhHHLL--------------------------------------


DSSP  llhhhhhhhhlllhhhhhhHHHHHHHHHHHLLEEEEEEEELLHHhllllllllhhhllll
Query akfdyympviagcreaikrIAYEFVEMKAKEGVVYVEVRYSPHLlanskvdpmpwnqteg  119
ident                          |   |  ||                          
Sbjct -------------------DLDDVLEKAKKANVVALVAVAEHSG----------------   43
DSSP  -------------------LHHHHHHHHHHLLEEEEEELLLLHH----------------


DSSP  lllhhhHHHHHHHHHHHHHhhhlLEEEEEEEEEL-------LLHH-HHHHHHHHHHHLLL
Query dvtpddVVDLVNQGLQEGEqafgIKVRSILCCMR-------HQPS-WSLEVLELCKKYNQ  171
ident             |            |   |                     |     |  
Sbjct ------EFEKIMQLSERYN----GFVLPCLGVHPvqgldqrSVTLkDLDVALPIIENYKD   93
DSSP  ------HHHHHHHHHHHLL----LLEEEEELLLLeelllleELLHhHHHHHHHHHHHHLL


DSSP  LlEEEE-EEELlLLLL---------LHHHLhHHHHHHHHHHHHLLEEEEEElLLLLHHHH
Query KtVVAM-DLAGdETIE---------GSSLFpGHVEAYEGAVKNGIHRTVHAgEVGSPEVV  221
ident     |                                  |        ||          
Sbjct R-LLAIgEVGL-DFSPrfagtgeqkEEQRQ-VLIRQIQLAKRLNLPVNVHS-RSAGRPTI  149
DSSP  L-LLEEeEEEE-ELLLlllllhhhhHHHHH-HHHHHHHHHHHHLLLEEEEE-ELLHHHHH


DSSP  HHHHHLLL-lLEEEELHHHHHlhhHHHHHHHLLLEEEELhHHHHhlLLLLlllLLHHHHH
Query REAVDILK-tERVGHGYHTIEdeaLYNRLLKENMHFEVCpWSSYltGAWDpktTHAVVRF  280
ident                                    |     |              |   
Sbjct NLLQEQGAekVLLHAFDGRPS---VAMEGVRAGYFFSIP-PSII--RSGQ--kQKLVKQL  201
DSSP  HHHHHLLLllEEEELLLLLHH---HHHHHHHLLLEEEEL-HHHH--LLHH--hHHHHHHL


DSSP  HhlLLLEEELLLLLL------LLLL--LHHHHHHHHHHLLLLL-HHHHHHHHHHHHHLL-
Query KndKANYSLNTDDPL------IFKS--TLDTDYQMTKKDMGFT-EEEFKRLNINAAKSS-  330
ident         | || |                          |   ||       || |   
Sbjct P--LTSICLETDSPAlgpekqVRNEpwNISISAEYIAQVKGISvEEVIEVTTQNALKLFp  259
DSSP  L--HHHEEELLLLLLllllllLLLLhhHHHHHHHHHHHHHLLLhHHHHHHHHHHHHHHLl


DSSP  LLLHHHhhhhhhhhhhhll
Query FLPEEEkkellerlyreyq  349
ident  |                 
Sbjct KLRHLL-------------  265
DSSP  LHHHHL-------------


No 22: Query=1a4mA Sbjct=3griA Z-score=15.0

back to top
DSSP  ----------------------------------------------llllLLLEEEEEEE
Query ----------------------------------------------tpafNKPKVELHVH   14
ident                                                       |  |||
Sbjct xklikngkvlqngelqqadilidgkvikqiapaiepsngvdiidakghfvSPGFVDVHVH   60
DSSP  leeeelleeeelleeeeleeeeelleeeeeellllllllleeeelllleeEELEEEEEEL


DSSP  HH-hlLLHHhhhhhhhhhllllllllhhhhhhhhlllllllhhhhhllhhhhhhhhlllh
Query LD-gaIKPEtilyfgkkrgialpadtveelrniigmdkplslpgflakfdyympviagcr   73
ident |                                                           
Sbjct LRepgGEYK---------------------------------------------------   69
DSSP  LLlllLLLL---------------------------------------------------


DSSP  hhhhhHHHHHHHHHHHLLEEEEEEEELLHHHllllllllhhhlllllllHHHHHHHHHHH
Query eaikrIAYEFVEMKAKEGVVYVEVRYSPHLLanskvdpmpwnqtegdvtPDDVVDLVNQG  133
ident               |  |   |                                      
Sbjct ----eTIETGTKAAARGGFTTVCPXPNTRPV----------------pdSVEHFEALQKL  109
DSSP  ----lLHHHHHHHHHHLLEEEEEELLLLLLL----------------llLHHHHHHHHHH


DSSP  HHHHHhhhLLEEEEEEEEE--LLLHhHHHHhHHHHHHLLlllEEEEEEELLlllllHHHL
Query LQEGEqafGIKVRSILCCM--RHQPsWSLEvLELCKKYNqktVVAMDLAGDetiegSSLF  191
ident            |                        |       |    |          
Sbjct IDDNA---QVRVLPYASITtrQLGK-ELVD-FPALVKEG---AFAFTDDGV---gvQTAS  158
DSSP  HHHHL---LLEELLLEELLhhHLLL-LLLL-HHHHHLLL---LLLEEELLL---llLLHH


DSSP  hHHHHHHHHHHHHLLEEEEEE-------------------------lllLLHHHHHHHHH
Query pGHVEAYEGAVKNGIHRTVHA-------------------------gevGSPEVVREAVD  226
ident     |    | |       |                                      | 
Sbjct -XXYEGXIEAAKVNKAIVAHCednsliyggaxhegkrskelgipgipniCESVQIARDVL  217
DSSP  -HHHHHHHHHHHHLLLEEELLllhhhllllleellhhhhhhllleellhHHHHHHHHHHH


DSSP  LL----LLLEEEELH--HHHHlhhHHHHHHHL--lLEEEELHH--------------hhh
Query IL----KTERVGHGY--HTIEdeaLYNRLLKE--nMHFEVCPW--------------ssy  264
ident           | |                         || |                  
Sbjct LAeaagCHYHVCHVStkESVR---VIRDAKRAgihVTAEVTPHhlllteddipgnnaiyk  274
DSSP  HHhhhlLLEEELLLLlhHHHH---HHHHHHHLlllEEEEELHHhhhllhhhlllllhhhl


DSSP  HLLLLLLLLLL-HHHHHHHLLLLEEELLLLLLL--------------LLLLHHHHHHHHH
Query LTGAWDPKTTH-AVVRFKNDKANYSLNTDDPLI--------------FKSTLDTDYQMTK  309
ident             |      |       ||                        |      
Sbjct XNPPLRSTEDReALLEGLLDGTIDCIATDHAPHardekaqpxekapfGIVGSETAFPLLY  334
DSSP  LLLLLLLHHHHhHHHHHHHLLLLLEELLLLLLLlhhhhlllllllllLLLLLLLHHHHHH


DSSP  HLLL----LLHHHHHHHH-HHHHHLLLLlhhhhhHHHHhhHHHL----------------
Query KDMG----FTEEEFKRLN-INAAKSSFLpeeekkELLErlYREY----------------  348
ident          |         |       |      |       |                 
Sbjct THFVkngdWTLQQLVDYLtIKPCETFNL------EYGT--LKENgyadltiidldseqei  386
DSSP  HHHLllllLLHHHHHHHHlHHHHHHLLL------LLLL--LLLLlllleeeeelllleel


DSSP  -----------------------------------l
Query -----------------------------------q  349
ident                                     
Sbjct kgedflskadntpfigykvygnpiltxvegevkfeg  422
DSSP  lhhhllllllllllllleelleeeeeeelleeeeel


No 23: Query=1a4mA Sbjct=3giqA Z-score=15.0

back to top
DSSP  --------------------------------------------------lllllLLEEE
Query --------------------------------------------------tpafnKPKVE   10
ident                                                             
Sbjct ekldfkitggwiidgtgaprrradlgvrdgriaaigelgahparhawdasgkivaPGFID   60
DSSP  lleeeeeelleelllllllleeleeeeelleeeeeelllllleeeeeelllleeeELEEE


DSSP  EEEEHHhlllhhhhhhhhhhhllllllllhhhhhhhhlllllllhhhhhllhhhhhhhhl
Query LHVHLDgaikpetilyfgkkrgialpadtveelrniigmdkplslpgflakfdyympvia   70
ident  | | |                                                      
Sbjct VHGHDD------------------------------------------------------   66
DSSP  LLLLLL------------------------------------------------------


DSSP  llhhhhhhHHHH---hHHHHHHLLEEEEEEE----ELLHhHLLLlllLLHH--hllllll
Query gcreaikrIAYE---fVEMKAKEGVVYVEVR----YSPHlLANSkvdPMPW--nqtegdv  121
ident                    |   |   | |                              
Sbjct --------LMFVekpdLRWKTSQGITTVVVGncgvSAAP-APLP---GNTAaalallget  114
DSSP  --------LHHHhlllLHHHHLLLEEEEEELllllLLLL-LLLL---LLLLhhhhhhlll


DSSP  lhHHHHHHHHHHHH-HHHHhhlLEEEEEEEEE---------------lllHHHHHHHHHH
Query tpDDVVDLVNQGLQ-EGEQafgIKVRSILCCM---------------rhqPSWSLEVLEL  165
ident      |      |         | |                                |  
Sbjct plFADVPAYFAALDaQRPM---INVAALVGHAnlrlaamrdpqaaptaaeQQAMQDMLQA  171
DSSP  llLLLHHHHHHHHHhLLLL---LEEEEEEEHHhhhhhhlllllllllhhhHHHHHHHHHH


DSSP  HHHLLlllEEEEEEElLLLL-lLHHHLHHHHHHHHHHHHHLLEEEEEELLLL--LHHHHH
Query CKKYNqktVVAMDLAgDETI-eGSSLFPGHVEAYEGAVKNGIHRTVHAGEVG--SPEVVR  222
ident          |                          |       | |           | 
Sbjct ALEAG---AVGFSTG-LAYQpgAVAQAAELEGLARVAAERRRLHTSHIRNEAdgVEAAVE  227
DSSP  HHHHL---LLEEEEE-LLLLlhHHLLHHHHHHHHHHHHHLLLEEEEELLLLLllHHHHHH


DSSP  HHHHLL----LLLEEEELHH-----hhHLHHHHHHHHHLL-----LEEEELHhhHHHL--
Query EAVDIL----KTERVGHGYH-----tiEDEALYNRLLKEN-----MHFEVCPwsSYLT--  266
ident |   |         | |             |                    |        
Sbjct EVLAIGrgtgCATVVSHHKCmmpqnwgRSRATLANIDRAReqgveVALDIYP--YPGSst  285
DSSP  HHHHHHhhhlLEEEELLLLLllhhhllLHHHHHHHHHHHHhllllEEEEELL--LLEEee


DSSP  ------------------------------------------------------LLLLLl
Query ------------------------------------------------------GAWDPk  272
ident                                                        | |  
Sbjct iliperaetiddiritwstphpecsgeyladiaarwgcdkttaarrlapagaiyFAMDE-  344
DSSP  ellhhhllllllleeeeelllhhhllllhhhhhhhhlllhhhhhhhhlleeeeeELLLH-


DSSP  lLLHHHHHHhlLLLEEELLLLLL----LLLLL---HHHHHHHHH-HLLLLLHHHHHHHH-
Query tTHAVVRFKndKANYSLNTDDPL----IFKST---LDTDYQMTK-KDMGFTEEEFKRLN-  323
ident        |           |                              | |       
Sbjct -DEVKRIFQ--HPCCMVGSDGLPndarPHPRLwgsFTRVLGRYVrEARLMTLEQAVARMt  401
DSSP  -HHHHHHHH--LLLEEELLLLLLllllLLLHHhhhHHHHHHHHHhHLLLLLHHHHHHHHl


DSSP  HHHHHLLLllhhhHHHHhhHHHH-------------------------------------
Query INAAKSSFlpeeeKKELleRLYR-------------------------------------  346
ident    |           |                                            
Sbjct ALPARVFG-----FAER--GVLQpgawadvvvfdpdtvadratwdeptlasvgiagvlvn  454
DSSP  HHHHHHHL-----LLLL--LLLLlllllleeeelllllllllllllllllllleeeeeel


DSSP  ------------------hll
Query ------------------eyq  349
ident                      
Sbjct gaevfpqppadgrpgqvlrax  475
DSSP  leeeellllllllllllllll


No 24: Query=1a4mA Sbjct=2ogjA Z-score=15.0

back to top
DSSP  --------------------------------------------------llllLLLEEE
Query --------------------------------------------------tpafNKPKVE   10
ident                                                           | 
Sbjct qapilltnvkpvgfgkgasqsstdiliggdgkiaavgsalqapadtqridaafiSPGWVD   60
DSSP  llleeeeeeeellllllllllleeeeellllleeeeelllllllleeelllleeEELEEE


DSSP  EEEEH-----HHLLlhhhhhhhhhhhllllllllhhhhhhhhlllllllhhhhhllhhhh
Query LHVHL-----DGAIkpetilyfgkkrgialpadtveelrniigmdkplslpgflakfdyy   65
ident ||||      |  |                                              
Sbjct LHVHIwhggtDISI----------------------------------------------   74
DSSP  EEELLlllllLLLL----------------------------------------------


DSSP  hhhhlllhhhhhhhhhhHHHH-HHHLLEEEEEEE--ELLHhhllllllllhhhlllllll
Query mpviagcreaikriayeFVEM-KAKEGVVYVEVR--YSPHllanskvdpmpwnqtegdvt  122
ident                        |  ||                                
Sbjct -----------------RPSEcGAERGVTTLVDAgsAGEA--------------------   97
DSSP  -----------------LHHHlLHHHLEEEEEEEllLLLL--------------------


DSSP  hhhHHHHHHHH-HHHHhhhhLLEEEEEEEEE------------LLLHHHHHH--HHHHHH
Query pddVVDLVNQG-LQEGeqafGIKVRSILCCM------------RHQPSWSLE--VLELCK  167
ident                            |                           ||   
Sbjct ---NFHGFREYiIEPS----RERIKAFLNLGsiglvacnrvpeLRDIKDIDLdrILECYA  150
DSSP  ---LHHHHHHHlLLLL----LLEEEEEEELLllllllllllllLLLHHHLLHhhHHHHHH


DSSP  HLLLlLEEEEEEElLLLL---LLHHHLhhHHHHHHHHHHHLLEEEEEElLLLLhhHHHHH
Query KYNQkTVVAMDLAgDETI---EGSSLFpgHVEAYEGAVKNGIHRTVHAgEVGSpeVVREA  224
ident        |                            |        ||           | 
Sbjct ENSE-HIVGLXVR-ASHVitgSWGVTP--VKLGKKIAKILKVPXXVHV-GEPP-aLYDEV  204
DSSP  LLLL-LEEEEEEE-ELHHhhlLLLLHH--HHHHHHHHHHHLLLEEEEE-LLLL-lLHHHH


DSSP  HHLLL-lLEEEELH------HHHHLHHHHHHHHHLL-LEEEELHHHHHhllllllllLLH
Query VDILK-tERVGHGY------HTIEDEALYNRLLKEN-MHFEVCPWSSYltgawdpktTHA  276
ident   ||     | |           ||| | |                              
Sbjct LEILGpgDVVTHCFngksgsSIXEDEDLFNLAERCEgIRLDIGHGGAS-------fsFKV  257
DSSP  HHHLLllLEEELLLllllllLLLLLHHHHHHHHHLLlLEEELLLLLLL-------llHHH


DSSP  HHHHHH-LLLLEEELLLLLLLLL----LLHHHHHHHHHhLLLLLHHHHHHH-HHHHHHlL
Query VVRFKN-DKANYSLNTDDPLIFK----STLDTDYQMTKkDMGFTEEEFKRL-NINAAKsS  330
ident             |  ||            | |             |        | |   
Sbjct AEAAIArGLLPFSISTDLHGHSXnfpvWDLATTXSKLL-SVDXPFENVVEAvTRNPAS-V  315
DSSP  HHHHHHlLLLLLLLLLLLLLLLLllllLLHHHHHHHHH-HLLLLHHHHHHLlLHHHHH-H


DSSP  LLLhhhhhhHHHH-----------------------------------------------
Query FLPeeekkeLLER-----------------------------------------------  343
ident            |                                                
Sbjct IRL------DXENrldvgqradftvfdlvdadleatdsngdvsrlkrlfepryavigaea  369
DSSP  LLL------LLLLlllllllleeeeeeeeeeeeeeellllleeeeeeeeeeeeeeellee


DSSP  ----hhhhll
Query ----lyreyq  349
ident           
Sbjct iaasryipra  379
DSSP  eellllllll


No 25: Query=1a4mA Sbjct=2ob3A Z-score=14.9

back to top
DSSP  ---------llllllLEEEEEEEHHHlllhhhhhhhhhhhllllllllhhhhhhhhllll
Query ---------tpafnkPKVELHVHLDGaikpetilyfgkkrgialpadtveelrniigmdk   51
ident                     | |  |                                  
Sbjct drintvrgpitiseaGFTLTHEHICG----------------------------------   26
DSSP  lleeelleeelhhhhLLEEEEELLEE----------------------------------


DSSP  lllhhhhhllhhhHHHHHLL---LHHHHHHHHHHHHHHHHHLLEEEEEEEELLHhhllll
Query plslpgflakfdyYMPVIAG---CREAIKRIAYEFVEMKAKEGVVYVEVRYSPHllansk  108
ident                         | |    |          ||                
Sbjct ---------ssagFLRAWPEffgSRKALAEKAVRGLRRARAAGVRTIVDVSTFD------   71
DSSP  ---------llllHHHHLHHhhlLHHHHHHHHHHHHHHHHHLLLLEEEELLLHH------


DSSP  llllhhhlllllllhhhhhhhHHHHHHHHHHHHLLEEEEEEEEELLL---------hHHH
Query vdpmpwnqtegdvtpddvvdlVNQGLQEGEQAFGIKVRSILCCMRHQ---------pSWS  159
ident                          | |   |                            
Sbjct ------------------igrDVSLLAEVSRAADVHIVAATGLWFDPplsmrlrsveELT  113
DSSP  ------------------hllLHHHHHHHHHHHLLEEELEEELLLLLlhhhhlllhhHHH


DSSP  HHHHHHHHHLL---lLLEEEEEEEllLLLLL-HHHLhHHHHHHHHHHHHLLEEEEEELlL
Query LEVLELCKKYN---qKTVVAMDLAgdETIEG-SSLFpGHVEAYEGAVKNGIHRTVHAGeV  215
ident    |                   |                 |       |   | |    
Sbjct QFFLREIQYGIedtgIRAGIIXVA-tTGKATpFQEL-VLKAAARASLATGVPVTTHTA-A  170
DSSP  HHHHHHHHLLLllllLLLLEEEEE-lLLLLLhHHHH-HHHHHHHHHHHHLLLEEEELL-H


DSSP  LLHhHHHHHHHLLL-------lLEEEELHHHHHlHHHHHHHHHLLLEEEE-LHHH-----
Query GSPeVVREAVDILK-------tERVGHGYHTIEdEALYNRLLKENMHFEV-CPWS-----  262
ident            |             ||   |         |                   
Sbjct SQR-DGEQQAAIFEseglspsrVCIGHSDDTDD-LSYLTALAARGYLIGLdHIPYsaigl  228
DSSP  HHL-HHHHHHHHHHhllllhhhEEELLHHHLLL-HHHHHHHHHLLLEEEElLLLLlllll


DSSP  ------hHHLLllLLLLL--LHHHHHHHLLL--LEEELLLL---------------llLL
Query ------sYLTGawDPKTT--HAVVRFKNDKA--NYSLNTDD---------------plIF  297
ident         | |      |                     |                    
Sbjct ednasasALLG-iRSWQTraLLIKALIDQGYmkQILVSNDWtfgfssyvtnimdvmdrVN  287
DSSP  lllhhhhHHHL-lLLHHHhhHHHHHHHHLLLhhHEEELLLLlleellllllhhhhhhhHL


DSSP  LL---LHHH-HHHHHHHLlLLLHHHHHHHH-HHHHHlLLLLhhhhhhhhhhhhhhll
Query KS---TLDT-DYQMTKKDmGFTEEEFKRLN-INAAKsSFLPeeekkellerlyreyq  349
ident                    |   |        | |     |                
Sbjct PDgmaFIPLrVIPFLREK-GVPQETLAGITvTNPAR-FLSP-------------tlr  329
DSSP  LLhhhHHHHlHHHHHHHL-LLLHHHHHHHHlHHHHH-HHLL-------------lll


No 26: Query=1a4mA Sbjct=3e74A Z-score=14.7

back to top
DSSP  ----------------------------------------------llllLLLEEEEEEE
Query ----------------------------------------------tpafNKPKVELHVH   14
ident                                                       |  | |
Sbjct sfdliikngtvilenearvvdiavkggkiaaigqdlgdakevxdasglvvSPGXVDAHTH   60
DSSP  leeeeeelleeelllleeeleeeeelleeeeeellllleeeeeelllleeEELEEEEEEL


DSSP  Hhhlllhhhhhhhhhhhllllllllhhhhhhhhlllllllhhhhhllhhhhhhhhlllhh
Query Ldgaikpetilyfgkkrgialpadtveelrniigmdkplslpgflakfdyympviagcre   74
ident                                                             
Sbjct I-----------------------------------------------------------   61
DSSP  L-----------------------------------------------------------


DSSP  hhhhhHHHHHHHHHHLLEEEEEEEELlHHHLlllllllhhhlllllllHHHHHHHHHHHH
Query aikriAYEFVEMKAKEGVVYVEVRYSpHLLAnskvdpmpwnqtegdvtPDDVVDLVNQGL  134
ident              || |            |                        |     
Sbjct ----gYETGTRAAAKGGITTXIEXPL-NQLP--------------atvDRASIELKFDAA  102
DSSP  ----lHHHHHHHHHHLLEEEEEELLL-LLLL--------------lllLHHHHHHHHHHH


DSSP  HHHHhhhLLEEEEEEEEElllHHHHHHhHHHHHHLLlllEEEEEEElllllllHHHLHHH
Query QEGEqafGIKVRSILCCMrhqPSWSLEvLELCKKYNqktVVAMDLAgdetiegSSLFPGH  194
ident         |                   |          ||                   
Sbjct KGKL---TIDAAQLGGLV---SYNIDR-LHELDEVG---VVGFXCF-----vrDVNDWQF  147
DSSP  LLLL---LLEEEELEELL---LLLLLL-HHHHHHHL---LLLEEEE-----llLLLHHHH


DSSP  HHHHHHHHHHLLEEEEEEL----------------------------llLLHHHHHHHHH
Query VEAYEGAVKNGIHRTVHAG----------------------------evGSPEVVREAVD  226
ident           |    ||                                   |  |    
Sbjct FKGAQKLGELGQPVLVHCEnalicdelgeeakregrvtahdyvasrpvfTEVEAIRRVLY  207
DSSP  HHHHHHHHHHLLLEEEELLlhhhhhhhhhhhhhhllllhhhhhhlllhhHHHHHHHHHHH


DSSP  LL----LLLEEEELH--HHHHlhhHHHHHHH--LLLEEEELHH-------------hhHH
Query IL----KTERVGHGY--HTIEdeaLYNRLLK--ENMHFEVCPW-------------ssYL  265
ident           | |       |      |          | ||                  
Sbjct LAkvagCRLHVCHVSspEGVE---EVTRARQegQDITCESCPHyfvldtdqfeeigtlAK  264
DSSP  HHhhhlLLEEELLLLlhHHHH---HHHHHHHllLLEEEEELLHhhhllhhhhhhhlhhHL


DSSP  LL-LLLLLLLL-HHHHHHHLLLLEEELLLLLL---------------LLLL--LHHHHHH
Query TG-AWDPKTTH-AVVRFKNDKANYSLNTDDPL---------------IFKS--TLDTDYQ  306
ident                          |  |                               
Sbjct CSpPIRDLENQkGXWEKLFNGEIDCLVSDHSPcppexkagnixkawgGIAGlqSCXDVXF  324
DSSP  LLlLLLLHHHHhHHHHHHHLLLLLEELLLLLLlllllllllllllllLLLLhhHHHHHHH


DSSP  -HHHHLLLLLHHHHHHH-HHHHHHLLLLlhhhhHHHHhhHHHH-----------------
Query -MTKKDMGFTEEEFKRL-NINAAKSSFLpeeekKELLerLYRE-----------------  347
ident        |     |  |   |||    |                                
Sbjct dEAVQKRGXSLPXFGKLxATNAADIFGL-----QQKG--RIAPgkdadfvfiqpnssyvl  377
DSSP  hHHLLLLLLLHHHHHHHhLHHHHHHLLL-----LLLL--LLLLllllleeeeelllleel


DSSP  --------------------------------------------------ll
Query --------------------------------------------------yq  349
ident                                                     
Sbjct tnddleyrhkvspyvgrtigaritktilrgdviydieqgfpvapkgqfilkh  429
DSSP  lhhhllllllllllllleelleeeeeeelleeeeelllllllllllleelll


No 27: Query=1a4mA Sbjct=4b3zD Z-score=14.5

back to top
DSSP  -----------------------------------------------lllllLLEEEEEE
Query -----------------------------------------------tpafnKPKVELHV   13
ident                                                             
Sbjct drllikggriinddqslyadvyledglikqigenlivpggvktieangrmviPGGIDVNT   60
DSSP  leeeeeeeeeelllleeeeeeeeelleeeeeellllllllleeeelllleeeELEEEEEE


DSSP  EHHhlLLHHhhhhhhhhhllllllllhhhhhhhhlllllllhhhhhllhhhhhhhhlllh
Query HLDgaIKPEtilyfgkkrgialpadtveelrniigmdkplslpgflakfdyympviagcr   73
ident  |                                                          
Sbjct YLQ--KTAA---------------------------------------------------   67
DSSP  LLL--LLLL---------------------------------------------------


DSSP  hhhhhhhhHHHHHHHHLL---EEEEEEEELLHHhllllllllhhhllllllLHHHHHHHH
Query eaikriayEFVEMKAKEG---VVYVEVRYSPHLlanskvdpmpwnqtegdvTPDDVVDLV  130
ident          |                    |                             
Sbjct -------dDFFQGTRAALvggTTMIIDHVVPEP----------------gsSLLTSFEKW  104
DSSP  -------lLHHHHHHHHHhllEEEEEEEELLLL----------------llLHHHHHHHH


DSSP  HHHHHHHHhhhLLEEEEEEEEEllLHHHhhHHHHHHHHLL-lLLEEEEEEEllLLLL-lH
Query NQGLQEGEqafGIKVRSILCCMrhQPSWslEVLELCKKYN-qKTVVAMDLAgdETIE-gS  188
ident                                | |        | |               
Sbjct HEAADTKS---CCDYSLHVDIT--SWYD--GVREELEVLVqdKGVNSFQVY-mAYKDvyQ  156
DSSP  HHHHHLLL---LLEEEEEEELL--LLLL--LHHHHHHHHHhlLLLLEEEEE-lLLLLllL


DSSP  HHLHHHHHHHHHHHHHLLEEEEEEL----------------------------llLLHHH
Query SLFPGHVEAYEGAVKNGIHRTVHAG----------------------------evGSPEV  220
ident        ||       |    |||                                  | 
Sbjct MSDSQLYEAFTFLKGLGAVILVHAEngdliaqeqkrilemgitgpeghalsrpeeLEAEA  216
DSSP  LLHHHHHHHHHHHHHHLLEEEEELLlhhhhhhhhhhhhhllllllhhhhhhllhhHHHHH


DSSP  HHHHHHLL----LLLEEEELH--HHHHlhhHHHHHHH--LLLEEEELHH-----------
Query VREAVDIL----KTERVGHGY--HTIEdeaLYNRLLK--ENMHFEVCPW-----------  261
ident |  |  |                             |       |               
Sbjct VFRAITIAgrinCPVYITKVMskSAAD---IIALARKkgPLVFGEPIAAslgtdgthyws  273
DSSP  HHHHHHHHhhhlLLEEEEEELlhHHHH---HHHHHHHhlLLEEEEELHHhhhlllhhhhl


DSSP  --------hhhhLLLLLLLLLL-HHHHHHHLLLLEEELLLLLL-----------------
Query --------ssylTGAWDPKTTH-AVVRFKNDKANYSLNTDDPL-----------------  295
ident                    ||                                       
Sbjct knwakaaafvtsPPLSPDPTTPdYLTSLLACGDLQVTGSGHCPystaqkavgkdnftlip  333
DSSP  llhhhhhhllllLLLLLLLLHHhHHHHHHHHLLLLLLLLLLLLllhhhhhhhlllhhhll


DSSP  LLLLLHHHHHHHHHhLLLL-----LHHHHHHH-HHHHHHLLLLlhhhHHHHHhhHHHH--
Query IFKSTLDTDYQMTKkDMGF-----TEEEFKRL-NINAAKSSFLpeeeKKELLerLYRE--  347
ident                |         |  |      ||||   |                 
Sbjct EGVNGIEERMTVVW-DKAVatgkmDENQFVAVtSTNAAKIFNL----YPRKG--RIAVgs  386
DSSP  LLLLLLLLHHHHHH-HHHLlllllLHHHHHHHhLHHHHHHHLL----LLLLL--LLLLll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  347
ident                                                             
Sbjct dadvviwdpdklktitakshksaveynifegmechgsplvvisqgkivfedgninvnkgm  446
DSSP  llleeeeeeeeeeelllllllllllllllllleeeeeeeeeeelleeeeelleellllll


DSSP  -----------------------------ll
Query -----------------------------yq  349
ident                                
Sbjct grfiprkafpehlyqrvkirnkvfglqgvsr  477
DSSP  llllllllllhhhhhhhhhhhhhllllllll


No 28: Query=1a4mA Sbjct=3cjpA Z-score=14.5

back to top
DSSP  llllllLEEEEEEEHhhlllhhhhhhhhhhhllllllllhhhhhhhhlllllllhhhhhl
Query tpafnkPKVELHVHLdgaikpetilyfgkkrgialpadtveelrniigmdkplslpgfla   60
ident            | |                                              
Sbjct ------LIIDGHTHV---------------------------------------------    9
DSSP  ------LLEEEEEEL---------------------------------------------


DSSP  lhhhhhhhhlllhhhhhHHHHHHHHHHHHLLEEEEEEEEL--------------------
Query kfdyympviagcreaikRIAYEFVEMKAKEGVVYVEVRYS--------------------  100
ident                               ||                            
Sbjct ----------------iLPVEKHIKIMDEAGVDKTILFSTsihpetavnlrdvkkemkkl   53
DSSP  ----------------lLLHHHHHHHHHHHLLLEEEEELLlllhhhlllhhhhhhhhhhh


DSSP  ---------lHHHLlllllllhhhlllllllHHHHHHHHHHHHHHHHhhhlLEEEEEEEE
Query ---------pHLLAnskvdpmpwnqtegdvtPDDVVDLVNQGLQEGEqafgIKVRSILCC  151
ident                                            |                
Sbjct ndvvngktnsMIDV-----------------RRNSIKELTNVIQAYP----SRYVGFGNV   92
DSSP  hhhhllllllLHHH-----------------HHHHHHHHHHHHHHLL----LLEEEEELL


DSSP  ElLLHH--HHHHHHH-HHHHLLlllEEEEEEELLLLllLHHHLhhHHHHHHHHHHHL-LE
Query MrHQPS--WSLEVLE-LCKKYNqktVVAMDLAGDETieGSSLFpgHVEAYEGAVKNG-IH  207
ident      |        |           |           |                 |   
Sbjct P-VGLSenDTNSYIEeNIVNNK---LVGIGELTPAS--GQIKS--LKPIFKYSMDSGsLP  144
DSSP  L-LLLLhhHHHHHHHhHLLLLL---LLEEEEELLLL--LLHHH--HHHHHHHHHHLLlLL


DSSP  EEEEELLLLLHHHHHHHHHL-----lLLLEEEE-LHHHHHLhhHHHHHHHLL-LEEEELh
Query RTVHAGEVGSPEVVREAVDI-----lKTERVGH-GYHTIEDeaLYNRLLKEN-MHFEVCp  260
ident    ||          |               || |                         
Sbjct IWIHAFNPLVLQDIKEIAELckafpkVPVILGHmGGSNWMT--AVELAKEIQnLYLDTS-  201
DSSP  EEELLLLLLLHHHHHHHHHHhhhlllLLEEEHHhHHHHHHH--HHHHHHHLLlEEEELL-


DSSP  hHHHHllllllllLLHHHHHHHLLL-LEEELLLLLLlllLLHHHHHHHHHhLLLLLHHHH
Query wSSYLtgawdpktTHAVVRFKNDKA-NYSLNTDDPLifkSTLDTDYQMTKkDMGFTEEEF  319
ident              |       |         || |      |       |  |       
Sbjct -AYFS--------TFVLKIVINELPlKCIFGTDMPF---GDLQLSIEAIK-KMSNDSYVA  248
DSSP  -LLLL--------HHHHHHHHHHLLlLEELLLLLLL---LLHHHHHHHHH-HHLLLHHHH


DSSP  HHH-HHHHHHLLLLlhhhhhhhhhhhhhhll
Query KRL-NINAAKSSFLpeeekkellerlyreyq  349
ident       |                        
Sbjct NAVlGDNISRLLNI-----------------  262
DSSP  HHHhLHHHHHHHLL-----------------


No 29: Query=1a4mA Sbjct=1onxA Z-score=14.4

back to top
DSSP  --------------------------------------------------------llll
Query --------------------------------------------------------tpaf    4
ident                                                             
Sbjct midytaagftllqgahlyapedrgicdvlvangkiiavasnipsdivpnctvvdlsgqil   60
DSSP  llllhhhlleeeeeeeeellleeeeeeeeeelleeeeeellllllllllleeeellllee


DSSP  LLLEEEEEEEHHHlllhhhhhhhhhhhllllllllhhhhhhhhlllllllhhhhHLLHHH
Query NKPKVELHVHLDGaikpetilyfgkkrgialpadtveelrniigmdkplslpgfLAKFDY   64
ident        |||| |                                               
Sbjct CPGFIDQHVHLIG---------------------------------------ggGEAGPT   81
DSSP  EELEEEEEELLLL---------------------------------------llLLLLHH


DSSP  HHhhhlllhhhhhhhhhHHHHHHHHLLEEEEEEEEL-lHHHLlllllllhhhlllllllh
Query YMpviagcreaikriayEFVEMKAKEGVVYVEVRYS-pHLLAnskvdpmpwnqtegdvtp  123
ident                           ||  |                             
Sbjct TR------------tpeVALSRLTEAGVTSVVGLLGtdSISR------------------  111
DSSP  HL------------lllLLHHHHHHLLEEEEEELLLllLLLL------------------


DSSP  hhHHHHHHHHHHHHHHHhLLEEEEEEEEELlLHHH--hhHHHHHHHHLllLLEEEEEEEl
Query ddVVDLVNQGLQEGEQAfGIKVRSILCCMRhQPSW--slEVLELCKKYnqKTVVAMDLAg  181
ident                   ||            ||      |           |     | 
Sbjct --HPESLLAKTRALNEE-GISAWMLTGAYH-VPSRtitgSVEKDVAII--DRVIGVXCAi  165
DSSP  --LHHHHHHHHHHHHHH-LLEEEEEEELLL-LLLLllllLHHHHHHHL--LLEEEEEEEe


DSSP  lLLLLlHHHLHHHHHHHHHHHHHL------LEEEEEElLLLLhHHHHHHHHL-------l
Query dETIEgSSLFPGHVEAYEGAVKNG------IHRTVHAgEVGSpEVVREAVDI-------l  228
ident                        |           |              |         
Sbjct sDHRSaAPDVYHLANMAAESRVGGllggkpGVTVFHM-GDSK-KALQPIYDLlencdvpi  223
DSSP  lLLLLlLLLHHHHHHHHHHHHHHHhhhlllLEEEEEE-LLLL-LLLHHHHHHhhlllllh


DSSP  lLLEEEELH----HHHHlhhhHHHHHHLLLEEEELHhHHHHlllllllllLHHHHHH--H
Query kTERVGHGY----HTIEdealYNRLLKENMHFEVCPwSSYLtgawdpkttHAVVRFK--N  282
ident       |                              |                |     
Sbjct sKLLPTHVNrnvpLFEQ----ALEFARKGGTIDITS-SIDE----pvapaEGIARAVqaG  274
DSSP  hHEEEELHHhlhhHHHH----HHHHHHLLLLEEEEL-LLLL----lllhhHHHHHHHhlL


DSSP  LLL-LEEELLLLLLLL-------------LLLHHHHHHHHHH---LLLLLHHHHHHH-HH
Query DKA-NYSLNTDDPLIF-------------KSTLDTDYQMTKK---DMGFTEEEFKRL-NI  324
ident        |  |                       |          |  |      |    
Sbjct IPLaRVTLSSDGNGSQpffddegnlthigVAGFETLLETVQVlvkDYDFSISDALRPlTS  334
DSSP  LLHhHEEEELLLLLEEeeellllleeeeeELLLHHHHHHHHHhhhHHLLLHHHHHHHhLH


DSSP  HHHHLLLllhhhHHHHHhhHHHH-------------------------------------
Query NAAKSSFlpeeeKKELLerLYRE-------------------------------------  347
ident   |                                                         
Sbjct SVAGFLN-----LTGKG--EILPgndadllvmtpelrieqvyargklmvkdgkacvkgtf  387
DSSP  HHHHHLL-----LLLLL--LLLLllllleeeellllleeeeeelleeeeelleellllll


DSSP  -ll
Query -yq  349
ident    
Sbjct etd  390
DSSP  lll


No 30: Query=1a4mA Sbjct=2vunA Z-score=14.3

back to top
DSSP  ------------------------------------------------------llllLL
Query ------------------------------------------------------tpafNK    6
ident                                                             
Sbjct sktiiknigkivsgdikspvlqadtivvedgliaaiggeelmkdagdatiidaagstvTP   60
DSSP  leeeeellleeellllllleellleeeeelleeeeeelhhhhlllllleeeelllleeEE


DSSP  LEEEEEEEHHhlllhhhhhhhhhhhllllllllhhhhhhhhlllllllhhhhhllhhhhh
Query PKVELHVHLDgaikpetilyfgkkrgialpadtveelrniigmdkplslpgflakfdyym   66
ident      |||                                                    
Sbjct GLLDTHVHVS--------------------------------------------------   70
DSSP  LEEEEEELLL--------------------------------------------------


DSSP  hhhlllhhhhhhhHHHH---------HHHHHHLLEEEEEEEEL--lhHHLLllllllhhh
Query pviagcreaikriAYEF---------VEMKAKEGVVYVEVRYS--phLLANskvdpmpwn  115
ident                                  ||       |                 
Sbjct -------------GGDYaprqktmdfISSALHGGVTTMISAGSphfpGRPK---------  108
DSSP  -------------LLLEehhhleelhHHHHHLLLEEEEEELLLllllLLLL---------


DSSP  llllllLHHHHHHHHHHHHHHHHHhHLLEEEE-EEEEellLHHHHHHHHHHHHHLLlllE
Query qtegdvTPDDVVDLVNQGLQEGEQaFGIKVRS-ILCCmrhQPSWSLEVLELCKKYNqktV  174
ident                           | ||                |     ||     |
Sbjct ---daaGTKALAITLSKSYYNARP-AGVKVHGgAVIL---EKGLTEEDFIEMKKEG---V  158
DSSP  ---lhhHHHHHHHHHHHHHHHLLH-HHLEEELlEELL---LLLLLHHHHHHHHHLL---L


DSSP  EEE-EEELllllllHHHLhhHHHHHHHHHHHLLEEEEEELLL-----LLHHhHHHHHHlL
Query VAM-DLAGdetiegSSLFpgHVEAYEGAVKNGIHRTVHAGEV-----GSPEvVREAVDiL  228
ident                          | | | |     | |                    
Sbjct WIVgEVGL--gtikNPED--AAPMVEWAHKHGFKVQMHTGGTsipgsSTVT-ADDVIK-T  212
DSSP  LEEeEELL--llllLHHH--HHHHHHHHHHLLLEEEEELLLLlllllLLLL-HHHHHH-H


DSSP  LLLEEEELH----HHHHLhhHHHHHHH-LLLEEEELhHHHHhlllllllllLHHHHHHHL
Query KTERVGHGY----HTIEDeaLYNRLLK-ENMHFEVCpWSSYltgawdpkttHAVVRFKND  283
ident |   | |                |         |                          
Sbjct KPDVVSHINggptAISVQ--EVDRIMDeTDFAMEIV-QCGN---------pKIADYVARR  260
DSSP  LLLEEELLLllllLLLHH--HHHHHHHhLLLEEEEE-LLLL---------hHHHHHHHHH


DSSP  L------lLEEELLLLLLLLLLL---HHHHHHHHHHLLLLLHHHHHHH-HHHHHHLLlll
Query K------aNYSLNTDDPLIFKST---LDTDYQMTKKDMGFTEEEFKRL-NINAAKSSflp  333
ident               | |                         |        |        
Sbjct AaekgqlgRVIFGNDAPSGTGLIplgILRNMCQIASMSDIDPEVAVCMaTGNSTAVY---  317
DSSP  HhhhllhhHEEEELLLLLLLLLLllhHHHHHHHHHHHLLLLHHHHHHHhLHHHHHHH---


DSSP  hhhHHHHHhhHHHH----------------------------------------------
Query eeeKKELLerLYRE----------------------------------------------  347
ident                                                             
Sbjct ---GLNTG--VIAPgkeadliimdtplgsvaedamgaiaagdipgisvvlidgeavvtks  372
DSSP  ---LLLLL--LLLLllllleeeeelllllllllhhhhhhhlllleeeeeeelleeeelll


DSSP  -----------ll
Query -----------yq  349
ident              
Sbjct rntppakraakil  385
DSSP  lllllllllleel


No 31: Query=1a4mA Sbjct=2ffiA Z-score=14.3

back to top
DSSP  llllllLEEEEEEEHHhlllhhHHHHHHHHHllllllllhhhhhhhhlllllllhhhhhl
Query tpafnkPKVELHVHLDgaikpeTILYFGKKRgialpadtveelrniigmdkplslpgfla   60
ident            | |                                              
Sbjct ---lhlTAIDSHAHVF------SRGLNLASQ-----------------------------   22
DSSP  ---lllLLEELLLLLL------LHHHHHHLL-----------------------------


DSSP  lhHHHHhhhlllhhhhhhHHHHHHHHHHHLLEEEEEEEE----LLHHHllllllllhhhl
Query kfDYYMpviagcreaikrIAYEFVEMKAKEGVVYVEVRY----SPHLLanskvdpmpwnq  116
ident                               |                             
Sbjct rrYAPN---------ydaPLGDYLGQLRAHGFSHGVLVQpsflGTDNR------------   61
DSSP  llLLLL---------lllLHHHHHHHHHHLLLLEELLLLlhhhLLLLH------------


DSSP  llllllhhhHHHHHHHHHHhhhhhhllEEEEEEEEelllhhHHHHhhHHHHHLLLLLEEE
Query tegdvtpddVVDLVNQGLQegeqafgiKVRSILCCmrhqpsWSLEvlELCKKYNQKTVVA  176
ident                |             |                           |  
Sbjct ---------YLLSALQTVP-------gQLRGVVXL------ERDVeqATLAEXARLGVRG   99
DSSP  ---------HHHHHHHHLL-------lLLLLLLLL------LLLLlhHHHHHHHLLLLLE


DSSP  EEEElLLLLLLHHH-LHHHHHHHHHHHHHLLEEEEEElllLLHHhHHHHHHLL----LLL
Query MDLAgDETIEGSSL-FPGHVEAYEGAVKNGIHRTVHAgevGSPEvVREAVDIL----KTE  231
ident   |          |         |     | |   |             |  |       
Sbjct VRLN-LXGQDXPDLtGAQWRPLLERIGEQGWHVELHR---QVAD-IPVLVRALqpygLDI  154
DSSP  EELL-LLLLLLLLLlLLLLHHHHHHHHHHLLEEEELL---LLLL-HHHHHHHHllllLLE


DSSP  EEE-ELHH---------HHHLhhHHHHHhHLLLEEEELhhHHHHllLLLL-LLLL-HHHH
Query RVG-HGYH---------TIEDeaLYNRLlKENMHFEVCpwSSYLtgAWDP-KTTH-AVVR  279
ident      |                 |            |     |                 
Sbjct VIDhFGRPdarrglgqpGFAE--LLTLSgRGKVWVKVS--GIYR--LQGSpEENLaFARQ  208
DSSP  EELhHHLLlllllllllLHHH--HLLLLlLLLEEEEEE--LHHH--LLLLhHHHHhHHHH


DSSP  HHHLLL------LEEELLLL-LLLLL--LLHHHHHHHHHhLLLLLHHHHHHHH-HHHHhL
Query FKNDKA------NYSLNTDD-PLIFK--STLDTDYQMTKkDMGFTEEEFKRLN-INAAkS  329
ident                   |                       |        |    |   
Sbjct ALCALEahygaeRLXWGSDWpHTQHEseVSFGSAVEQFE-ALGCSAQLRQALLlDTAR-A  266
DSSP  HHHHHHhhllhhHEEEELLLlLLLLLllLLHHHHHHHHH-HHLLLHHHHHHHHlHHHH-H


DSSP  LLLlhhHHHHhhhhhhhhll
Query SFLpeeEKKEllerlyreyq  349
ident  |       |          
Sbjct LFG---FELE----------  273
DSSP  HLL---LLLL----------


No 32: Query=1a4mA Sbjct=2vc5A Z-score=14.3

back to top
DSSP  ----------llllllLEEEEEEEHHHlllhhhhhhhhhhhllllllllhhhhhhhhlll
Query ----------tpafnkPKVELHVHLDGaikpetilyfgkkrgialpadtveelrniigmd   50
ident                      | ||                                   
Sbjct mriplvgkdsieskdiGFTLIHEHLRV---------------------------------   27
DSSP  llllllllllllhhhlLLEELLLLLLL---------------------------------


DSSP  llllhhhhhllhhhhHHHHL---lLHHHhhhhhhHHHHHHHHLL---EEEEEEEELLHHH
Query kplslpgflakfdyyMPVIA---gCREAikriayEFVEMKAKEG---VVYVEVRYSPHLL  104
ident                  |                  |          |          | 
Sbjct -------------fsEAVRQqwphLYNE-deefrNAVNEVKRAMqfgVKTIVDPTVMGLG   73
DSSP  -------------llHHHHHhlhhHLLH-hhhhhHHHHHHHHHHhllLLEEEELLLLLLL


DSSP  llllllllhhhlllllllhhhhhhhHHHHHHHHHHHHLLEEEEEEEEEL-LLHH------
Query anskvdpmpwnqtegdvtpddvvdlVNQGLQEGEQAFGIKVRSILCCMR-HQPS------  157
ident                                    | ||                     
Sbjct ------------------------rDIRFMEKVVKATGINLVAGTGIYIyIDLPfyflnr  109
DSSP  ------------------------lLHHHHHHHHHLLLLEEEELEELLLlLLLLhhhlll


DSSP  ----HHHHHHHHHHHL---llLLEEEEEEEllLLLLLH-hHLHHHHHHHHHHHHHLLEEE
Query ----WSLEVLELCKKY---nqKTVVAMDLAgdETIEGS-sLFPGHVEAYEGAVKNGIHRT  209
ident              |               |                 |            
Sbjct sideIADLFIHDIKEGiqgtlNKAGFVXIA-aDEPGITkdVEKVIRAAAIANKETKVPII  168
DSSP  lhhhHHHHHHHHHHLLlllllLLLLLEEEE-lLLLLLLhhHHHHHHHHHHHHHHHLLLEE


DSSP  EEELllLLHHHHHHHHHLLL-------lLEEEELHhhHHLHhHHHHHHHLLLEEEE-LHH
Query VHAGevGSPEVVREAVDILK-------tERVGHGYhtIEDEaLYNRLLKENMHFEV-CPW  261
ident  |           |   ||            ||                           
Sbjct THSN--AHNNTGLEQQRILTeegvdpgkILIGHLGdtDNID-YIKKIADKGSFIGLdRYG  225
DSSP  EELL--LLLLHHHHHHHHHHhllllhhhEEELLHHhlLLHH-HHHHHHHLLLEEEElLLL


DSSP  HhhHLLLLLLlllLHHHHHHHLLL--LEEELLLLLL---------------lLLLLHHHH
Query SsyLTGAWDPkttHAVVRFKNDKA--NYSLNTDDPL---------------iFKSTLDTD  304
ident                  |   |          |                           
Sbjct L--DLFLPVDkrnETTLRLIKDGYsdKIMISHDYCCtidwgtakpeykpklaPRWSITLI  283
DSSP  L--LLLLLHHhhhHHHHHHHHLLLllLEEELLLLLLllllllllhhhhhhhlLLLLLLHH


DSSP  HHHHHHLLL---LLHHHHHHHH-HHHHHLLlllhhhhhhhhhhhhhhll
Query YQMTKKDMG---FTEEEFKRLN-INAAKSSflpeeekkellerlyreyq  349
ident    |          ||        |  |                     
Sbjct FEDTIPFLKrngVNEEVIATIFkENPKKFF------------------s  314
DSSP  HHLHHHHHHlllLLHHHHHHHHlHHHHHHL------------------l


No 33: Query=1a4mA Sbjct=4hk5D Z-score=14.2

back to top
DSSP  llllLLLEEEEEEEHHhlllhhhhhhhHHHH--llLLLL--LLHH---------------
Query tpafNKPKVELHVHLDgaikpetilyfGKKR--giALPA--DTVE---------------   41
ident         |  | |              |                               
Sbjct ----TPVVVDIHTHMY---ppsyiamlEKRQtiplVRTFpqADEPrlillsselaaldaa   53
DSSP  ----LLLLEEEEEEEL---lhhhhhhhHLLLllleEEEEllEEEEeeellhhhhhhhhhh


DSSP  -----hhhHHHLllllllhhhhhllhhhhhhhhlllhhhhhHHHHHHHHHHHHLLEEEEE
Query -----elrNIIGmdkplslpgflakfdyympviagcreaikRIAYEFVEMKAKEGVVYVE   96
ident                                                       |     
Sbjct ladpaaklPGRP------------------------lsthfASLAQKMHFMDTNGIRVSV   89
DSSP  hhllllllLLEE------------------------llhhhLLHHHHHHHHHHLLLLEEE


DSSP  EEEllhhhllllLLLLHhhlllllLLHHHHHHHHHHHHHHHHhhhlLEEEEEEEEelLLH
Query VRYsphllanskVDPMPwnqtegdVTPDDVVDLVNQGLQEGEqafgIKVRSILCCmrHQP  156
ident               |            | |                             |
Sbjct ISL--anpwfdfLAPDE-----apGIADAVNAEFSDMCAQHV----GRLFFFAALplSAP  138
DSSP  EEE--lllllllLLLLL-----hhHHHHHHHHHHHHHHHLLL----LLEEEEEELllLLL


DSSP  H-HHHHHHHHHHHLllLLEEEEEEELLllllLHHHLHHHHHHHHHHHHHLLEEEEEE---
Query S-WSLEVLELCKKYnqKTVVAMDLAGDetieGSSLFPGHVEAYEGAVKNGIHRTVHA---  212
ident         |  |    |      |            |      |           |    
Sbjct VdAVKASIERVKNL--KYCRGIILGTS-glgKGLDDPHLLPVFEAVADAKLLVFLHPhyg  195
DSSP  HhHHHHHHHHHHLL--LLEEEEEELLL-lllLLLLLHHHHHHHHHHHHLLLEEEELLlll


DSSP  ---------------------lLLLL-HHHHHHHH-------hllLLLEEEE-LHHH-HH
Query ---------------------gEVGS-PEVVREAV-------dilKTERVGH-GYHT-IE  241
ident                               |                    | |      
Sbjct lpnevygprseeyghvlplalgFPMEtTIAVARMYmagvfdhvrnLQMLLAHsGGTLpFL  255
DSSP  llhhhhlllhhhlllhhhhhlhHHHHhHHHHHHHHhllhhhhlllLLEEEHHhHLLHhHH


DSSP  LHH----------------------hHHHHHHLlLEEEELHHhhhhlllllllllLHHHH
Query DEA----------------------lYNRLLKEnMHFEVCPWssyltgawdpkttHAVVR  279
ident                               |||                           
Sbjct AGRiescivhdghlvktgkvpkdrrtIWTVLKEqIYLDAVIY-----------seVGLQA  304
DSSP  HHHhhhhhhllhhhhhllllllllllHHHHHHHlEEEELLLL-----------lhHHHHH


DSSP  HHHLLL--LEEELLLLLLLLL---------LLHHHHHHHHHhLLLLL-HHHHHHH-HHHH
Query FKNDKA--NYSLNTDDPLIFK---------STLDTDYQMTKkDMGFT-EEEFKRL-NINA  326
ident              || |                    |                    ||
Sbjct AIASSGadRLMFGTDHPFFPPieedvqgpwDSSRLNAQAVI-KAVGEgSSDAAAVmGLNA  363
DSSP  HHHHHLhhHEELLLLLLLLLLlllllllllHHHHHHHHHHH-HHHLLlLHHHHHHhLHHH


DSSP  HHLlLLLHHHHHHhhhhhhhhll
Query AKSsFLPEEEKKEllerlyreyq  349
ident          |             
Sbjct VRV-LSLKAELEH-----hhhhh  380
DSSP  HHH-LLLHHHHHH-----hhhhl


No 34: Query=1a4mA Sbjct=4mupB Z-score=13.8

back to top
DSSP  --------lLLLLLL--EEEEEEEHHhlllhhhhhhhhhhhllllllllhhhhhhhhlll
Query --------tPAFNKP--KVELHVHLDgaikpetilyfgkkrgialpadtveelrniigmd   50
ident          |    |   |    |                                    
Sbjct lvrklsgtaPNPAFPrgAVDTQMHMY--------------------------------lp   28
DSSP  lllllllllLLLLLLllLEELLLLLL--------------------------------ll


DSSP  llllhhhhHLLHHHHHhhhlllhhhhhhHHHHHHHHHHHLLEEEEEEEEL--LHHHllll
Query kplslpgfLAKFDYYMpviagcreaikrIAYEFVEMKAKEGVVYVEVRYS--PHLLansk  108
ident                                         |   |               
Sbjct gypalpggPGLPPGAL-----------pGPEDYRRLMQWLGIDRVIITQGnaHQRD----   73
DSSP  llllllllLLLLLLLL-----------lLHHHHHHHHHHHLLLEEEEELLhhHLLL----


DSSP  llllhhhlllllllhhHHHHHHHHHHHhhhhhhllEEEEEEEEelllhhhHHHH-hhHHH
Query vdpmpwnqtegdvtpdDVVDLVNQGLQegeqafgiKVRSILCCmrhqpswSLEV-leLCK  167
ident                                                             
Sbjct ---------------nGNTLACVAEMG-------eAAHAVVII-------DATTtekDME  104
DSSP  ---------------lHHHHHHHHHHH-------hHEEEEELL-------LLLLlhhHHH


DSSP  HLLLLLEEEEEEElLLLL-llHHHLhhHHHHHHHHHHHLLEEEEEELLlLLHH-HHHHhH
Query KYNQKTVVAMDLAgDETI-egSSLFpgHVEAYEGAVKNGIHRTVHAGEvGSPE-VVREaV  225
ident |      |      |                 | |        |                
Sbjct KLTAAGTVGARIM-DLPGgavNLSE--LDAVDERAHAADWMVAVQFDG-NGLLdHLPR-L  159
DSSP  HHHHLLEEEEEEE-LLLLlllLHHH--HHHHHHHHHHLLLEEEEELLH-HHHHhHHHH-H


DSSP  HLLLL-LEEEE-LHHH------hHLHHHHHHHHHLL-LEEEELhhHHHHllLLLL----L
Query DILKT-ERVGH-GYHT------iEDEALYNRLLKEN-MHFEVCpwSSYLtgAWDP----K  272
ident           | |             |    |       |       |            
Sbjct QKIRSrWVFDHhGKFFkgirtdgPEMAALLKLIDRGnLWFKFA--GVYE--SSRKswpyA  215
DSSP  HLLLLeEEELHhHHLLlllllllHHHHHHHHHHHHLlEEEEEL--LHHH--LLLLllllH


DSSP  LLL-HHHHHHHLLL-LEEELLLLLLL-------LLLLhHHHHHHHhhLLLLLHHHHHHHH
Query TTH-AVVRFKNDKA-NYSLNTDDPLI-------FKSTlDTDYQMTkkDMGFTEEEFKRLN  323
ident                     |  |                    |       |    |  
Sbjct DVAaFSRVIAAHAPeRIVWGTNWPHNsvretaaYPDD-ARLAELT-lGWLPDEAARHRAL  273
DSSP  HHHhHHHHHHHHLHhHEEELLLLLLLllllhhhLLLH-HHHHHHH-hLLLLLHHHHHHHH


DSSP  -HHHHHLLLllhhhHHHHhhhhhhhll
Query -INAAKSSFlpeeeKKELlerlyreyq  349
ident   |                        
Sbjct vENPEALFK-----LSPV---------  286
DSSP  lHHHHHHHL-----LLLL---------


No 35: Query=1a4mA Sbjct=3pnuA Z-score=13.8

back to top
DSSP  --------LLLLlLLEEEEEEEHHhlllhhhhhhhhhhhllllllllhhhhhhhhlllll
Query --------TPAFnKPKVELHVHLDgaikpetilyfgkkrgialpadtveelrniigmdkp   52
ident              |     | ||                                     
Sbjct enlyfqsnAMKL-KNPLDMHLHLR------------------------------------   23
DSSP  llllllllLEEE-ELLEEEEELLL------------------------------------


DSSP  llhhhhhllhhhhhhhhlllhhhHHHHHHHHHHHHHHLlEEEEEEEELLHHHllllllll
Query lslpgflakfdyympviagcreaIKRIAYEFVEMKAKEgVVYVEVRYSPHLLanskvdpm  112
ident                                    |                        
Sbjct -----------------------DNQMLELIAPLSARD-FCAAVIMPNLIPP--------   51
DSSP  -----------------------LHHHHHHHHHHHHLL-LLEEEELLLLLLL--------


DSSP  hhhlllllllHHHHHHHHHHHHHHHHHHHLLEEEEEEEEelllhhHHHHhhHHHHHLLLL
Query pwnqtegdvtPDDVVDLVNQGLQEGEQAFGIKVRSILCCmrhqpsWSLEvlELCKKYNQK  172
ident                                     |                       
Sbjct --------lcNLEDLKAYKMRILKACKDENFTPLMTLFF------KNYD-eKFLYSAKDE   96
DSSP  --------llLHHHHHHHHHHHHHHHLLLLLEEEEEEEL------LLLL-hHHHHHHLLL


DSSP  lEEEEEEELLLL------llLHHHLHHHHHHHHHHHHHLLEEEEEE--------lLLLLH
Query tVVAMDLAGDET------ieGSSLFPGHVEAYEGAVKNGIHRTVHA--------gEVGSP  218
ident       |              |          |      |   ||          |    
Sbjct -IFGIXLYPAGIttnsnggvSSFDIEYLKPTLEAMSDLNIPLLVHGetndfvmdrESNFA  155
DSSP  -LLEEEELLLLLllllllllLLLLHHHHHHHHHHHHHLLLLEEELLlllllhhhlLHHHH


DSSP  HHHHHHHHLL--LLLEEEELH--HHHHlhhHHHHHhhllLEEEELHH-------------
Query EVVREAVDIL--KTERVGHGY--HTIEdeaLYNRLlkenMHFEVCPW-------------  261
ident                   |       |   |                             
Sbjct KIYEKLAKHFprLKIVMEHITtkTLCE---LLKDY--enLYATITLHhliitlddviggk  210
DSSP  HHHHHHHHHLllLLEEELLLLlhHHHH---HHHHL--llEEEEELLHhhlllhhhhhlll


DSSP  ---hhhHLLLLLLLLLL-HHHHHHHLLL-LEEELLLLLL-------LLLL--LHHHHHHH
Query ---ssyLTGAWDPKTTH-AVVRFKNDKA-NYSLNTDDPL-------IFKS--TLDTDYQM  307
ident                   |                |             |          
Sbjct mnphlfCKPIAKRYEDKeALCELAFSGYeKVMFGSDSAPhpkgcaaGVFSapVILPVLAE  270
DSSP  llhhhlLLLLLLLHHHHhHHHHHHHLLLlLEEELLLLLLlllllllLLLLhhHHHHHHHH


DSSP  HHHLlLLLHHHHHHH-HHHHHHLLlllhhHHHHhhHHHH---------------------
Query TKKDmGFTEEEFKRL-NINAAKSSflpeeEKKEllERLY---------------------  345
ident   |     ||        |  |        |    |                        
Sbjct LFKQ-NSSEENLQKFlSDNTCKIY----dLKFK--EDKIltleekewqvpnvyedkynqv  323
DSSP  HHHH-HLLHHHHHHHhLHHHHHHH----lLLLL--LLLEeeeellleelllleellllee


DSSP  -----------hhll
Query -----------reyq  349
ident                
Sbjct vpymageilkfqlkh  338
DSSP  llllllleelleell


No 36: Query=1a4mA Sbjct=4dlfA Z-score=13.7

back to top
DSSP  lllllLLEEEEEEEHHhlllhhHHHHhhhhhllllllllhhhhhhhhlllllllhhhhhL
Query tpafnKPKVELHVHLDgaikpeTILYfgkkrgialpadtveelrniigmdkplslpgflA   60
ident            | |                                              
Sbjct -----ALRIDSHQHFW-----rYRAA-------------------------------dyP   19
DSSP  -----LLLEEEEELLL-----lLLHH-------------------------------hlL


DSSP  LHHHhhhhhlllhhhhhhhhhHHHHHHHHLL----EEEEEEE-ELLHhhllllllllhhh
Query KFDYympviagcreaikriayEFVEMKAKEG----VVYVEVR-YSPHllanskvdpmpwn  115
ident                                                             
Sbjct WIGA---------gmgvlardYLPDALHPLMhaqaLGASIAVqARAG-------------   57
DSSP  LLLL---------llhhhlllLLHHHHHHHHhhllLLEEEEElLLLL-------------


DSSP  lllllllhHHHHHHHHHHHHHHHhhhlLEEEEEEEeelllhhHHHH--hhHHHHHLLLLL
Query qtegdvtpDDVVDLVNQGLQEGEqafgIKVRSILCcmrhqpsWSLE--vlELCKKYNQKT  173
ident          |                                        |         
Sbjct --------RDETAFLLELACDEA----RIAAVVGW------eDLRApqlaERVAEWRGTK   99
DSSP  --------HHHHHHHHHHHLLLL----LEEEEEEL------lLLLLllhhHHHHLLLLLL


DSSP  EEEEEEE-LLLLLLL-HHHLHHHHHHHHHHHHHLLEEEEEElLLLLHHHHHHHHHLLL--
Query VVAMDLA-GDETIEG-SSLFPGHVEAYEGAVKNGIHRTVHAgEVGSPEVVREAVDILK--  229
ident          ||                     |     |          |          
Sbjct LRGFRHQlQDEADVRaFVDDADFARGVAWLQANDYVYDVLV-FERQLPDVQAFCARHDah  158
DSSP  EEEEEELhHHLLLHHhHHHLHHHHHHHHHHHHLLLEEEELL-LHHHHHHHHHHHHHLLll


DSSP  lLEEE-ELHH--------------HHHLhhhHHHHHHLL-LEEEELhhHHHHLL------
Query tERVG-HGYH--------------TIEDealYNRLLKEN-MHFEVCpwSSYLTG------  267
ident        |                          |                         
Sbjct wLVLDhAGKPalaefdrddtalarWRAA---LRELAALPhVVCKLS--GLVTEAdwrrgl  213
DSSP  lEEEHhHHLLlhhhllllllhhhhHHHH---HHHHHLLLlEEEEEL--LLLLLLllllll


DSSP  -llLLLL-LLHHHHHHHLLL--LEEELLL--LLLLLLLLhHHHHHHHHHLL--LLLHHHH
Query -awDPKT-THAVVRFKNDKA--NYSLNTD--DPLIFKSTlDTDYQMTKKDM--GFTEEEF  319
ident    |                        |    |   |  |                 | 
Sbjct rasDLRHiEQCLDAALDAFGpqRLMFGSDwpVCLLAASY-DEVASLVERWAesRLSAAER  272
DSSP  lhhHHHHhHHHHHHHHHHHLhhHEEELLLllHHHHLLLH-HHHHHHHHHHHhhHLLHHHH


DSSP  HHHH-HHHHHLLLLLhhhhhhhhhhhhhhll
Query KRLN-INAAKSSFLPeeekkellerlyreyq  349
ident   |    ||    ||                
Sbjct SALWgGTAARCYALP----------------  287
DSSP  HHHLlHHHHHHLLLL----------------


No 37: Query=1a4mA Sbjct=3irsA Z-score=13.7

back to top
DSSP  lllllLLEEEEEEEHHhlllhhhhhhhhhhhllllllllhhhhHHHHL--LLLLLlhhhh
Query tpafnKPKVELHVHLDgaikpetilyfgkkrgialpadtveelRNIIG--MDKPLslpgf   58
ident                                              |              
Sbjct -----LKIIDFRLRPP---------------amgflnariytrPDIRNrfTRQLG-----   35
DSSP  -----LLLEELLLLLL---------------lhhhhhlhhhhlHHHHHhhHHHHL-----


DSSP  hllhhhhhhhhlllhhhhhhhhhHHHHHHHHLLEEEEEEEELLhhhllllllllhhhlll
Query lakfdyympviagcreaikriayEFVEMKAKEGVVYVEVRYSPhllanskvdpmpwnqte  118
ident                           |  |  |                           
Sbjct ----------fepapsaeeksleLMFEEMAAAGIEQGVCVGRN-----------------   68
DSSP  ----------llllhhhhhllhhHHHHHHHHLLLLEEEEELLE-----------------


DSSP  llllhhhHHHHHHHHHHHHHhhhlLEEEEEEEEEllLHHHHHHHHHHHHHLLlllEEEEE
Query gdvtpddVVDLVNQGLQEGEqafgIKVRSILCCMrhQPSWSLEVLELCKKYNqktVVAMD  178
ident            |             |                                  
Sbjct ssvlgsvSNADVAAVAKAYP----DKFHPVGSIEaaTRKEAMAQMQEILDLG---IRIVN  121
DSSP  ellleelLHHHHHHHHHHLL----LLEEEEEELLllLHHHHHHHHHHHHHLL---LLLEE


DSSP  EELLL--lLLLHHHLHhHHHHHHHHHHHLLEEEEEELLL-------LLHHHHHHHHHLL-
Query LAGDE--tIEGSSLFPgHVEAYEGAVKNGIHRTVHAGEV-------GSPEVVREAVDIL-  228
ident |                    |     |||      |           ||          
Sbjct LEPGVwatPMHVDDRR-LYPLYAFCEDNGIPVIMMTGGNagpdityTNPEHIDRVLGDFp  180
DSSP  ELHHHlllLLLLLLHH-HHHHHHHHHHLLLLEEEELLLLllllhhhHLHHHHHHHHHHLl


DSSP  -LLLEEEE-LHHHHHLhhHHHHHHHLL-LEEEELhHHHHhllLLLLlllLHHHHHHHLLL
Query -KTERVGH-GYHTIEDeaLYNRLLKEN-MHFEVCpWSSYltgAWDPkttHAVVRFKNDKA  285
ident   |    |                              |                 |   
Sbjct dLTVVSSHgNWPWVQE--IIHVAFRRPnLYLSPD-MYLY---NLPG--hADFIQAANSFL  232
DSSP  lLLEEEEHhHLLLHHH--HHHHHHHLLlEEEELH-HHHL---LLLL--hHHHHHHHLLHH


DSSP  --LEEELLLLlLLLL--LLHHHHHHHhhhllLLLHHHHHHH-HHHHHHlLLLLhhhhhhh
Query --NYSLNTDDpLIFK--STLDTDYQMtkkdmGFTEEEFKRL-NINAAKsSFLPeeekkel  340
ident        |                                    ||              
Sbjct adRMLFGTAY-PMCPlkEYTEWFLTL-----PIKPDAMEKIlHGNAER-LLAQ-------  278
DSSP  hhLLLLLLLL-LLLLhhHHHHHHHLL-----LLLHHHHHHHhLHHHHH-HHHH-------


DSSP  hhhhhhhll
Query lerlyreyq  349
ident          
Sbjct ------agr  281
DSSP  ------lll


No 38: Query=1a4mA Sbjct=4ofcA Z-score=13.5

back to top
DSSP  llllllLEEEEEEEHH-------------------hlllhHHHHhhhhhhLLLLllllhh
Query tpafnkPKVELHVHLD-------------------gaikpETILyfgkkrGIALpadtve   41
ident        |   | |                                              
Sbjct ------MKIDIHSHILpkewpdlkkrfgyggwvqlqhhskGEAK---llkDGKV------   45
DSSP  ------LLEEEEEELLllllllhhhhhllllleeeeeeelLEEE---eeeLLEE------


DSSP  hhhhhhlllllllhhhhhllhHHHHhhhlllhhhhhhHHHH--HHHHHHHLLEEEEEEEE
Query elrniigmdkplslpgflakfDYYMpviagcreaikrIAYE--FVEMKAKEGVVYVEVRY   99
ident                                                    ||       
Sbjct ---------------------FRVV---------renCWDPevRIREMDQKGVTVQALST   75
DSSP  ---------------------EEEE---------ehhHLLHhhHHHHHHHHLLLEEEEEL


DSSP  llhhhlllLLLLLhhhllllllLHHHHHHHHHHHHHHHHhhhlLEEEEEEEEelllHHHH
Query sphllansKVDPMpwnqtegdvTPDDVVDLVNQGLQEGEqafgIKVRSILCCmrhqPSWS  159
ident                                                             
Sbjct vpvmfsywAKPED------tlnLCQLLNNDLASTVVSYP----RRFVGLGTL---pMQAP  122
DSSP  lhhhhlllLLHHH------hhhHHHHHHHHHHHHHHHLL----LLEEEEELL---lLLLH


DSSP  HHHHHHHHHLL-lLLEEEEEEEllllLLLHHHLHHHHHHHHHHHHHLLEEEEEE------
Query LEVLELCKKYN-qKTVVAMDLAgdetIEGSSLFPGHVEAYEGAVKNGIHRTVHA------  212
ident                            |           |  |        ||       
Sbjct ELAVKEMERCVkeLGFPGVQIG-thvNEWDLNAQELFPVYAAAERLKCSLFVHPwdmqmd  181
DSSP  HHHHHHHHHHHhlLLLLEEEEE-leeLLEELLLHHHHHHHHHHHHHLLEEEEELllllll


DSSP  ------------lLLLL-HHHHHHHH-HLLL------lLEEEE-LHHH-HHLHHH-----
Query ------------gEVGS-PEVVREAV-DILK------tERVGH-GYHT-IEDEAL-----  245
ident                                           | |               
Sbjct grmakywlpwlvgMPAEtTIAICSMImGGVFekfpklkVCFAHgGGAFpFTVGRIshgfs  241
DSSP  hhhhlllhhhhlhHHHHhHHHHHHHHlLLHHhhlllllEEELHhHLLHhHHHHHHhhhhh


DSSP  -------------hHHHHhLLLEEEELHHhhhhlllllllllLHHHHHHHLLL--LEEEL
Query -------------yNRLLkENMHFEVCPWssyltgawdpkttHAVVRFKNDKA--NYSLN  290
ident                  |                                        | 
Sbjct mrpdlcaqdnpmnpKKYL-GSFYTDALVH-----------dpLSLKLLTDVIGkdKVILG  289
DSSP  hlhhhhlllllllhHHHL-LLLEEELLLL-----------lhHHHHHHHHHHLllLEELL


DSSP  LLLLLLL-lLLHHHHHHHHHhllLLLHHHHHHH-HHHHHHLlLLLHhhHHHHhhhhhhhl
Query TDDPLIF-kSTLDTDYQMTKkdmGFTEEEFKRL-NINAAKSsFLPEeeKKELlerlyrey  348
ident || |                    | ||    |   ||       |   |          
Sbjct TDYPFPLgeLEPGKLIESME---EFDEETKNKLkAGNALAF-LGLE--RKQF--------  335
DSSP  LLLLLLLllLLLLHHHHHLL---LLLHHHHHHHhLHHHHHH-HLLL--HHHL--------


DSSP  l
Query q  349
ident  
Sbjct -  335
DSSP  -


No 39: Query=1a4mA Sbjct=4qrnA Z-score=13.5

back to top
DSSP  --------lllLLLLEEEEEEEHHhlllhhhhhhhhhhhllllllllhhhhhhhhlllll
Query --------tpaFNKPKVELHVHLDgaikpetilyfgkkrgialpadtveelrniigmdkp   52
ident                                                             
Sbjct smtqdlktggeQGYLRIATEEAFA----------------------treiidvylrmird   38
DSSP  lllllllllllLLLLLEEEEEEEL----------------------lhhhhhhhhhhhhh


DSSP  llhHHHH-LLHHHHHH---hhlllhhhhhhHHHH-HHHHHHHLLEEEEEEEEllhhhlll
Query lslPGFL-AKFDYYMP---viagcreaikrIAYE-FVEMKAKEGVVYVEVRYsphllans  107
ident              |                   |         |                
Sbjct gtaDKGMvSLWGFYAQspseratqilerllDLGErRIADMDATGIDKAILALtspgvqpl   98
DSSP  lllLHHHhHHHHHHHHlllhhhhhhhhhhhLLLHhHHHHHHHLLLLEEEEEEllllllll


DSSP  lLLLLhhhlllllLLHHHHHHHHHHHHHHHHhhhlLEEEEEEEEellLHHHHHHHHHHHH
Query kVDPMpwnqtegdVTPDDVVDLVNQGLQEGEqafgIKVRSILCCmrhQPSWSLEVLELCK  167
ident                     |      |                    |           
Sbjct hDLDE------arTLATRANDTLADACQKYP----DRFIGMGTV---APQDPEWSAREIH  145
DSSP  lLHHH------hhHHHHHHHHHHHHHHHHLL----LLEEELLLL---LLLLHHHHHHHHH


DSSP  HLLL-LLEEEEEEELLllLLLHHHLHHHHHHHHHHHHHLLEEEEE---------------
Query KYNQ-KTVVAMDLAGDetIEGSSLFPGHVEAYEGAVKNGIHRTVH---------------  211
ident                                    |        |               
Sbjct RGAReLGFKGIQINSH-tQGRYLDEEFFDPIFRALVEVDQPLYIHpatspdsmidpmlea  204
DSSP  HHHHlLLLLLEEELLL-lLLLLLLLHHHHHHHHHHHHHLLLEEELlllllllllhhhhhh


DSSP  ------elLLLL-HHHHHHHHH-------llLLLEEEE-LHHH-HHLHHH----------
Query ------agEVGS-PEVVREAVD-------ilKTERVGH-GYHT-IEDEAL----------  245
ident                                    ||| |         |          
Sbjct gldgaifgFGVEtGMHLLRLITigifdkypsLQIMVGHmGEALpYWLYRLdymhqagvrs  264
DSSP  lllllllhHHHHhHHHHHHHHHhlhhhhlllLLEEELHhHHLHhHHHHHHhhhhhhhhhl


DSSP  ------------hHHHHHLlLEEEELHHhhhhlllllllllLHHHHHHHL--LLLEEELL
Query ------------yNRLLKEnMHFEVCPWssyltgawdpkttHAVVRFKND--KANYSLNT  291
ident                 ||                        |                 
Sbjct qryermkplkktiEGYLKSnVLVTNSGV----------awePAIKFCQQVmgEDRVMYAM  314
DSSP  llllllllllllhHHHHHHlEEEELLLL----------llhHHHHHHHHHhlHHHEELLL


DSSP  LLLLlllLLHHHHHHHHHHlLLLLHHHHHHH-HHHHHHLLLLlhhhhhhhhhhhhhhll
Query DDPLifkSTLDTDYQMTKKdMGFTEEEFKRL-NINAAKSSFLpeeekkellerlyreyq  349
ident | |                 |       |     || |   |                 
Sbjct DYPY---QYVADEVRAMDA-MDMSAQTKKKFfQTNAEKWFKL-----------------  352
DSSP  LLLL---LLLHHHHHHHHL-LLLLHHHHHHHhLHHHHHHLLL-----------------


No 40: Query=1a4mA Sbjct=2dvtA Z-score=13.5

back to top
DSSP  llllLLLEEEEEEEHHhlllhhhhhhhhhhhllllllllHHHHHHHHLllllllhhhhhl
Query tpafNKPKVELHVHLDgaikpetilyfgkkrgialpadtVEELRNIIGmdkplslpgfla   60
ident        || |  |                         |                    
Sbjct ----MQGKVALEEHFA------------ipetlqdsagfVPGDYWKEL------------   32
DSSP  ----LLLEEEEEEEEL------------lhhhhhhhlllLLLLHHHHH------------


DSSP  lhhhhhhhhlllhhhhhhHHHH-HHHHHHHLLEEEEEEEEllhhhlllllLLLHhhllll
Query kfdyympviagcreaikrIAYE-FVEMKAKEGVVYVEVRYsphllanskvDPMPwnqteg  119
ident                                |                  |         
Sbjct -------------qhrllDIQDtRLKLMDAHGIETMILSL-napavqaipDRRK-----a   73
DSSP  -------------hhhhhLLLLhHHHHHHHLLEEEEEEEE-lllhhhhllLHHH-----h


DSSP  llLHHHHHHHHHHHHHHHHhhhlLEEEEEEEEELLLHHHHHHHHHH-HHHLLlllEEEEE
Query dvTPDDVVDLVNQGLQEGEqafgIKVRSILCCMRHQPSWSLEVLEL-CKKYNqktVVAMD  178
ident         |                           |    | |            |   
Sbjct ieIARRANDVLAEECAKRP----DRFLAFAALPLQDPDAATEELQRcVNDLG---FVGAL  126
DSSP  hhHHHHHHHHHHHHHHHLL----LLEEEEELLLLLLHHHHHHHHHHhHHLLL---LLEEE


DSSP  EELL-----lllLLHH-HLHHhHHHHHHHHHHLLEEEEE---------------------
Query LAGD-----etiEGSS-LFPGhVEAYEGAVKNGIHRTVH---------------------  211
ident   |              |            |       |                     
Sbjct VNGFsqegdgqtPLYYdLPQY-RPFWGEVEKLDVPFYLHprnplpqdsriydghpwllgp  185
DSSP  EELLllllllllLLLLlLHHH-HHHHHHHHHHLLLEEEElllllhhhlhhhlllhhhlhh


DSSP  -elLLLL-HHHHHHHHHL-------lLLLEEEE-LHHHH-HLHH----------------
Query -agEVGS-PEVVREAVDI-------lKTERVGH-GYHTI-EDEA----------------  244
ident                                || |                         
Sbjct twaFAQEtAVHALRLMASglfdehprLNIILGHmGEGLPyMMWRidhrnawvklpprypa  245
DSSP  hlhHHHHhHHHHHHHHHLlhhhhlllLLEEELHhHLLHHhHHHHhhhlllllllllllll


DSSP  ---HHHHHHhLLLEEEELHHhhhhlllllllllLHHHHHHHLLL--LEEELLLLLLlllL
Query ---LYNRLLkENMHFEVCPWssyltgawdpkttHAVVRFKNDKA--NYSLNTDDPLifkS  299
ident           || |                                     || |     
Sbjct krrFMDYFN-ENFHITTSGN----------frtQTLIDAILEIGadRILFSTDWPF---E  291
DSSP  lllHHHHHH-HHEEEELLLL----------llhHHHHHHHLLLLhhHEELLLLLLL---L


DSSP  LHHHHHHHHhhLLLLLHHHHHHH-HHHHHHLlLLLHhhhhhhhhhhhhhll
Query TLDTDYQMTkkDMGFTEEEFKRL-NINAAKSsFLPEeekkellerlyreyq  349
ident   |             |         ||    |                  
Sbjct NIDHASDWF-nATSIAEADRVKIgRTNARRL-FKLD---------------  325
DSSP  LHHHHHHHH-hHLLLLHHHHHHHhLHHHHHH-LLLL---------------


No 41: Query=1a4mA Sbjct=3gg7A Z-score=13.5

back to top
DSSP  llllllLEEEEEEEHHHLLlhhhhhhhhhhhllllllllhhhhhhhhlllllllhhhhhl
Query tpafnkPKVELHVHLDGAIkpetilyfgkkrgialpadtveelrniigmdkplslpgfla   60
ident            |||||                                            
Sbjct ------SLIDFHVHLDLYP-----------------------------------------   13
DSSP  ------LLEEEEELHHHLL-----------------------------------------


DSSP  lhhhhhhhhlllhhhhhhHHHHHHHHHHHLLEeEEEEEELLhhhllllllllhhhlllll
Query kfdyympviagcreaikrIAYEFVEMKAKEGVvYVEVRYSPhllanskvdpmpwnqtegd  120
ident                                   |                         
Sbjct ------------------DPVAVARACEERQL-TVLSVTTT-------------------   35
DSSP  ------------------LHHHHHHHHHHLLL-EEEELLLL-------------------


DSSP  llhhhHHHHHHHHHHHHhhhhlLEEEEEEEEELLLH----HHHHHHHHHhHHLLllleEE
Query vtpddVVDLVNQGLQEGeqafgIKVRSILCCMRHQP----SWSLEVLELcKKYNqktvVA  176
ident                         |   |                               
Sbjct ---paAWRGTLALAAGR-----PHVWTALGFHPEVVseraADLPWFDRY-LPET----RF   82
DSSP  ---hhHHHHHHHHHLLL-----LLEEELLLLLHHHLlllhHHLHHHHHH-HHHL----LE


DSSP  EE-EELLLL-----LLLHHHLhHHHHHHHHHHHHLLE-EEEEEllLLLHHHHHHHHHLLL
Query MD-LAGDET-----IEGSSLFpGHVEAYEGAVKNGIH-RTVHAgeVGSPEVVREAVDILK  229
ident       |                           |      |         |        
Sbjct VGeVGLDGSpslrgTWTQQFA-VFQHILRRCEDHGGRiLSIHS--RRAESEVLNCLEANP  139
DSSP  EEeEELLLLhhhhhHHHHHHH-HHHHHHHHHHHLLLEeEEEEL--LLLHHHHHHHHHHLH


DSSP  ---LLEEEELHHHHHlhhHHHHHHHLLLEEEELhHHHHhllllllLLLL--HHHHHhhLL
Query ---TERVGHGYHTIEdeaLYNRLLKENMHFEVCpWSSYltgawdpKTTH--AVVRFknDK  284
ident    |                 |       | |                            
Sbjct rsgTPILHWYSGSVT---ELRRAISLGCWFSVG-PTMV------rTQKGaaLIRSM--PR  187
DSSP  hheEEEEELLLLLHH---HHHHHHHLLLEEEEL-HHHH------lLHHHhhHHHHL--LH


DSSP  LLEEELLLLLLLLL-------lLHHHHHHHHHHLLLLL-HHHHHHHHHHHHHLLlllhhh
Query ANYSLNTDDPLIFK-------sTLDTDYQMTKKDMGFT-EEEFKRLNINAAKSSflpeee  336
ident       || |                      |       |       |           
Sbjct DRVLTETDGPFLELdgqaalpwDVKSVVEGLSKIWQIPaSEVERIVKENVSRLL------  241
DSSP  HHEEELLLLLLLEElleellhhHHHHHHHHHHHHHLLLhHHHHHHHHHHHHHHH------


DSSP  hhhhhhhhhhhll
Query kkellerlyreyq  349
ident              
Sbjct -----------gt  243
DSSP  -----------hl


No 42: Query=1a4mA Sbjct=1itqA Z-score=13.1

back to top
DSSP  ----LLLLL----LLEEEEEEEHHhlllhhhhhhhhhhhllllllllhhhhhhhhlllll
Query ----TPAFN----KPKVELHVHLDgaikpetilyfgkkrgialpadtveelrniigmdkp   52
ident       |       |    |  |                                     
Sbjct dffrDEAERimrdSPVIDGHNDLP------------------------------------   24
DSSP  lhhhHHHHHhhllLLEEEEEELHH------------------------------------


DSSP  llhhhhhllhhhhHHHHllLHHH--------hhhhhhhHHHHHHHLLEEEEEEEELLHhh
Query lslpgflakfdyyMPVIagCREA--------ikriayeFVEMKAKEGVVYVEVRYSPHll  104
ident                                                |            
Sbjct ----------wqlLDMF--NNRLqderanlttlagthtNIPKLRAGFVGGQFWSVYTP--   70
DSSP  ----------hhhHHHH--LLLLllhhhllllllllllLHHHHHHLLEEEEEEEELLL--


DSSP  llllLLLLHhhlllllllHHHHHHHHHHHHHHhHHHH-----------------LLEEEE
Query anskVDPMPwnqtegdvtPDDVVDLVNQGLQEgEQAF-----------------GIKVRS  147
ident                        | |                                  
Sbjct --cdTQNKD-----avrrTLEQMDVVHRMCRM-YPETflyvtssagirqafregKVASLI  122
DSSP  --hhHLLLL-----hhhhHHHHHHHHHHHHHH-LLLLeeelllhhhhhhhhhllLEEEEE


DSSP  EEEEElllhHHHHHHHHHHHHLLlllEEEEEEELL--------LLLL-------LHHHLH
Query ILCCMrhqpSWSLEVLELCKKYNqktVVAMDLAGD--------ETIE-------GSSLFP  192
ident            || ||               |                         | |
Sbjct GVEGG-hsiDSSLGVLRALYQLG---MRYLTLTHScntpwadnWLVDtgdsepqSQGLSP  178
DSSP  EEELH-hhlLLLHHHHHHHHHLL---EEEEELLLLllllllllHHHLlllllllLLLLLH


DSSP  HHHHHHHHHHHHLLEEEEEElllllHHHHHHHHHLLL-LLEE-EELH--------HHHHl
Query GHVEAYEGAVKNGIHRTVHAgevgsPEVVREAVDILK-TERV-GHGY--------HTIEd  242
ident             |                                               
Sbjct FGQRVVKELNRLGVLIDLAH---vsVATMKATLQLSRaPVIFsHSSAysvcasrrNVPD-  234
DSSP  HHHHHHHHHHHHLLEEELLL---llHHHHHHHHHHLLlLLEElLLLLllllllllLLLH-


DSSP  hHHHHHHHHLLLEEEELhhHHHHllLLLLL-------llLHHHHHHH--LLLLEEELLLL
Query eALYNRLLKENMHFEVCpwSSYLtgAWDPK-------ttHAVVRFKN--DKANYSLNTDD  293
ident                |                             |            | 
Sbjct -DVLRLVKQTDSLVMVN--FYNN--YISCTnkanlsqvaDHLDHIKEvaGARAVGFGGDF  289
DSSP  -HHHHHHHHHLLEEEEL--LLHH--HHLLLllllhhhhhHHHHHHHHhlLHHHEEELLLL


DSSP  L------llLLLL--HHHHHHHHHHLlLLLHHHHHHH-HHHHHHLL--------------
Query P------liFKST--LDTDYQMTKKDmGFTEEEFKRL-NINAAKSS--------------  330
ident                              || | |     |                   
Sbjct DgvprvpegLEDVskYPDLIAELLRR-NWTEAEVKGAlADNLLRVFeaveqasnltqape  348
DSSP  LllllllllLLLLllHHHHHHHHHHL-LLLHHHHHHHhLHHHHHHHhhhhhlllllllll


DSSP  --lllhhhhhhhhhhhhhhll
Query --flpeeekkellerlyreyq  349
ident                      
Sbjct eepipldqlggscrthygyss  369
DSSP  lllllhhhlllllllllllll


No 43: Query=1a4mA Sbjct=2gwgA Z-score=12.9

back to top
DSSP  llllllLEEEEEEEHHhlllhhhhhhhhhhhllllllllhhhhhhhhlllllllhhhhhl
Query tpafnkPKVELHVHLDgaikpetilyfgkkrgialpadtveelrniigmdkplslpgfla   60
ident            | |                                              
Sbjct ------XIIDIHGHYT--------------------------------------------   10
DSSP  ------LLEEEEEELL--------------------------------------------


DSSP  lhhhhHHHHL---------------------LLHH--hhhHHHH-HHHHHHHHLLEEEEE
Query kfdyyMPVIA---------------------GCRE--aikRIAY-EFVEMKAKEGVVYVE   96
ident                                                       |     
Sbjct ---taPKALEdwrnrqiagikdpsvxpkvseLKISddelqASIIeNQLKKXQERGSDLTV   67
DSSP  ---llLHHHHhhhhhhhhhhhlhhhlllhhhLLLLhhhhhHHHHlLHHHHHHHHLLLEEE


DSSP  EEELlhhhlllLLLLlhhhllllllLHHHHHHHHHHHHHHHHhhhlLEEEEEEEEelllh
Query VRYSphllansKVDPmpwnqtegdvTPDDVVDLVNQGLQEGEqafgIKVRSILCCmrhqp  156
ident                                 |     |                     
Sbjct FSPR-----agDFNV-------sstWAAICNELCYRVSQLFP----DNFIGAAXLpqspg  111
DSSP  EELL-----llLHHH-------hhhHHHHHHHHHHHHHHHLL----LLEEEEEELlllll


DSSP  HHHHHHHHHHHHLLL-LLEEEEEEELL--LLLL--LHHHLHHHHHHHHHHHhHLLE-EEE
Query SWSLEVLELCKKYNQ-KTVVAMDLAGD--ETIE--GSSLFPGHVEAYEGAVkNGIH-RTV  210
ident            |       ||  |  |                   ||  |         
Sbjct VDPKTCIPELEKCVKeYGFVAINLNPDpsGGHWtsPPLTDRIWYPIYEKXV-ELEIpAXI  170
DSSP  LLHHHHHHHHHHHHHlLLLLEEEELLLllLLLLllLLLLLHHHHHHHHHHH-HHLLlEEE


DSSP  E-----eLLLLlHHHHHH-------hhhllLLLEEEE-LHHH-HHLHHH-----------
Query H-----aGEVGsPEVVRE-------avdilKTERVGH-GYHT-IEDEAL-----------  245
ident |                                   | |                     
Sbjct HvstgahYLNAdTTAFXQcvagdlfkdfpeLKFVIPHgGGAVpYHWGRFrglaqexkkpl  230
DSSP  LlllllhHHHHhHHHHHHhhhllhhhhlllLLEEELHhHLLLhHHHHHHhhhhhhlllll


DSSP  -hHHHHhLLLEEEELHHhhhhlllllllllLHHHHHHHLLL--LEEELLLLLLLL-----
Query -yNRLLkENMHFEVCPWssyltgawdpkttHAVVRFKNDKA--NYSLNTDDPLIF-----  297
ident      |  |  |  |                            |                
Sbjct leDHVL-NNIFFDTCVY-----------hqPGIDLLNTVIPvdNVLFASEXIGAVrgidp  278
DSSP  hhHHLL-LLEEEELLLL-----------lhHHHHHHHHHLLhhHEELLLLLLLLLlleel


DSSP  ----LLLHhhHHHHHHHLLLLLHHHHHHH-HHHHHHLL-LLLHhHHHHhhhhhhhhll
Query ----KSTLdtDYQMTKKDMGFTEEEFKRL-NINAAKSS-FLPEeEKKEllerlyreyq  349
ident                      | ||       ||      |     |           
Sbjct rtgfYYDD--TKRYIEASTILTPEEKQQIyEGNARRVYpRLDA-ALKA----kgkleh  329
DSSP  llleELLL--LHHHHHHLLLLLHHHHHHHhLHHHHHHLhHHHH-HHHH----hhhhll


No 44: Query=1a4mA Sbjct=2qpxA Z-score=12.6

back to top
DSSP  ------LLLLLLLEEEEEEEhhHLLLhhHHHHhhhhhllllllllHHHHHHHHLLlllll
Query ------TPAFNKPKVELHVHldGAIKpeTILYfgkkrgialpadtVEELRNIIGMdkpls   54
ident             |    | |    |                        |          
Sbjct gxddlsEFVDQVPLLDHHCH--FLID--GKVP-------------NRDDRLAQVS-----   38
DSSP  lllllhHHHHHLLEEEEEEL--LLLL--LLLL-------------LHHHHHHHHL-----


DSSP  hhhHHLL----------------------hhhhhhhhlllhhhhhhhhhHHHHHHHHLLE
Query lpgFLAK----------------------fdyympviagcreaikriayEFVEMKAKEGV   92
ident      |                                                      
Sbjct ---TEADkdypladtknrlayhgflalakefaldannplaaxndpgyatYNHRIFGHFHF   95
DSSP  ---LLLLllllhhhhlllhhhhhhhhhhhhhllllllllllllhhhhhhHHHHHHHHLLE


DSSP  EEEEEEELlhhhllllllllhhhlllllllhhhhhhhhhhHHHHHHHHHLLEEEEEEEEE
Query VYVEVRYSphllanskvdpmpwnqtegdvtpddvvdlvnqGLQEGEQAFGIKVRSILCCM  152
ident                                          |       || |  |    
Sbjct KELLIDTG------------------------fvpddpilDLDQTAELVGIPVKAIYRLE  131
DSSP  EEEEEELL------------------------llllllllLHHHHHHHHLLLEEEEEEHH


DSSP  -------------lllhhhhhhHHHHHHHLLlllEEEEEEElLLLLLL------------
Query -------------rhqpswsleVLELCKKYNqktVVAMDLAgDETIEG------------  187
ident                            |       |           |            
Sbjct thaedfxlehdnfaawwqafsnDVKQAKAHG---FVGFXSI-AAYRVGlhlepvnvieaa  187
DSSP  hhhhhhhlllllhhhhhhhhhhHHHLLLLLL---LLLEEEL-HHHHLLlllllllhhhhh


DSSP  -----------------hhHLHHHHHHHHHHHHHLLEEEEEELLL--------LLHHHHH
Query -----------------ssLFPGHVEAYEGAVKNGIHRTVHAGEV--------GSPEVVR  222
ident                                         | |          | |   |
Sbjct agfdtwkhsgekrltskplIDYXLYHVAPFIIAQDXPLQFHVGYGdadtdxylGNPLLXR  247
DSSP  hhhhhhhhhlllllllhhhHHHHHHHHHHHHHHHLLLEEEEELLLlllllhhhLLHHHHH


DSSP  HHHHLL----LLLEEEELH-HHHHlhhhHHHHHHL-LLEEEEL-HHHHHHlllllllllL
Query EAVDIL----KTERVGHGY-HTIEdealYNRLLKE-NMHFEVC-PWSSYLtgawdpkttH  275
ident                 | |    |            |  |                    
Sbjct DYLKAFtkkgLKVVLLHCYpYHRE---aGYLASVFpNLYFDISlLDNLGP-----sgasR  299
DSSP  HHHHHHhhhlLLEEEEELLlLHHH---hHHHHHHLlLEEEELLlHHHHLH-----hhhhH


DSSP  HHHHHHHLLL--LEEELLLLLL---lllLLHHHHHHHHhHLLL---------lLHHHHHH
Query AVVRFKNDKA--NYSLNTDDPL---ifkSTLDTDYQMTkKDMG---------fTEEEFKR  321
ident                   |                |                        
Sbjct VFNEAVELAPytRILFASDASTypexygLAARQFKQAL-VAHFnqlpfvdlaqKKAWINA  358
DSSP  HHHHHLLLLLhhHEELLLLLLLlhhhhhHHHHHHHHHH-HHHHhllllllhhhHHHHHHH


DSSP  H-HHHHHHLLLLlhhhHHHHHHhhhhhll
Query L-NINAAKSSFLpeeeKKELLErlyreyq  349
ident       ||          ||         
Sbjct IcWQTSAKLYHQ----ERELRV-------  376
DSSP  HhLHHHHHHLLL----HHHHLL-------


No 45: Query=1a4mA Sbjct=3ooqA Z-score=12.5

back to top
DSSP  ----------------------------------------------llllLLLEEEEEEE
Query ----------------------------------------------tpafNKPKVELHVH   14
ident                                                       |  | |
Sbjct kilfknatvfpitsrpfkgdvlvsngkvekvgeniedpdaeivdltgkflFPGFVDAHSH   60
DSSP  leeeeeeeellllllleeeeeeeelleeeeeelllllllleeeelllleeEELEEEEEEL


DSSP  HHHLLLHHHhhhhhhhhllllllllhhhhhhhhlllllllhhhhhllhHHHH--------
Query LDGAIKPETilyfgkkrgialpadtveelrniigmdkplslpgflakfDYYM--------   66
ident                                                  ||         
Sbjct IGLFEEGVG---------------------------------------YYYSdgneatdp   81
DSSP  LLLLLLLLL---------------------------------------HHHLllllllll


DSSP  --hhhlllhhhHHHHhhHHHHHHHHLLEEEEEEEELlhhhllllllllhhhlllllllhh
Query --pviagcreaIKRIayEFVEMKAKEGVVYVEVRYSphllanskvdpmpwnqtegdvtpd  124
ident                     |     ||  |                             
Sbjct vtphvkaldgfNPQD--PAIERALAGGVTSVXIVPG------------------------  115
DSSP  llllllhhhhlLLLL--HHHHHHHLLLEEEEEELLL------------------------


DSSP  hhhhhhhhhhhhhhhhhlleeeeeeEEEL--llhhhhhhhhhhhhhllLLLEEEEEEE-l
Query dvvdlvnqglqegeqafgikvrsilCCMR--hqpswslevlelckkynQKTVVAMDLA-g  181
ident                                                  |       |  
Sbjct -------------------------SANPvggqgsvikfrsiiveeciVKDPAGLKXAfg  150
DSSP  -------------------------LLLLeeeeeeeeelllllhhhheEEEEEEEEEEll


DSSP  LLLL-------------LLHH--HLHHH--------------------------hhHHHH
Query DETI-------------EGSS--LFPGH--------------------------veAYEG  200
ident                   |                                       | 
Sbjct ENPKrvygerkqtpstrXGTAgvIRDYFtkvknyxkkkelaqkegkeftetdlkxeVGEX  210
DSSP  HHHHhhhhhlllllllhHHHHhhHHHHHhhhhhhhhhhhhhhhlllllllllhhhhHHHH


DSSP  HHHHLLEEEEEELlllLHHHHHHHHHLL----LLLEEEELHHHHHlhhHHHHHHHLLLEE
Query AVKNGIHRTVHAGevgSPEVVREAVDIL----KTERVGHGYHTIEdeaLYNRLLKENMHF  256
ident      |    ||           |  |           ||            |       
Sbjct VLRKKIPARXHAH---RADDILTAIRIAeefgFNLVIEHGTEAYK---ISKVLAEKKIPV  264
DSSP  HHLLLLLEEEEEL---LHHHHHHHHHHHhhhlLLEEEEELLLHHH---HHHHHHHHLLLE


DSSP  E-ELHHhhHHLL--LLLLlllLHHHHHHHLLLLEEELLLLLlllllLHHHHHHHHHhLLL
Query E-VCPWssYLTG--AWDPkttHAVVRFKNDKANYSLNTDDPlifksTLDTDYQMTKkDMG  313
ident                              |     |  | |                  |
Sbjct VvGPLL--TFRTklELKDltxETIAKLLKDGVLIALXCDHPvipleFATVQAATAX-RYG  321
DSSP  EeLLLL--LLLLlhHHLLlllLHHHHHHHLLLLEEELLLLLlllhhHHHHHHHHHH-HHL


DSSP  LLHHHHHHH-HHHHHHLLLLlhhhHHHHHhhHHHH-------------------------
Query FTEEEFKRL-NINAAKSSFLpeeeKKELLerLYRE-------------------------  347
ident   ||        | ||   |                                        
Sbjct AKEEDLLKIlTVNPAKILGL----EDRIG--SIEPgkdadlvvwsghpfdxksvvervyi  375
DSSP  LLHHHHHHLlLHHHHHHLLL----LLLLL--LLLLllllleeeelllllllllleeeeee


DSSP  -------ll
Query -------yq  349
ident          
Sbjct dgvevfrre  384
DSSP  lleeeeell


No 46: Query=1a4mA Sbjct=1a5kC Z-score=12.4

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct snisrqayadmfgptvgdkvrladtelwieveddlttygeevkfgggkvirdgmgqgqml   60
DSSP  leeehhhhhhhhlllllleeelllllleeelleellllllllllllllllllllllllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct aadcvdlvltnalivdhwgivkadigvkdgrifaigkagnpdiqpnvtipigaateviaa  120
DSSP  hhhllleeeeeeeeeelleeeeeeeeeelleeeeeeleellllllllleellllleeeel


DSSP  -llllLLLEEEEEEEHHhlllhhhhhhhhhhhllllllllhhhhhhhhlllllllhhhhh
Query -tpafNKPKVELHVHLDgaikpetilyfgkkrgialpadtveelrniigmdkplslpgfl   59
ident             | |                                             
Sbjct egkivTAGGIDTHIHWI-------------------------------------------  137
DSSP  llleeEELEEEEEEELL-------------------------------------------


DSSP  llhhhhhhhhlllhhhhhhhhHHHHHHHHHLLEEEEEE------------EELLhhhlll
Query akfdyympviagcreaikriaYEFVEMKAKEGVVYVEV------------RYSPhllans  107
ident                          |     ||                    |      
Sbjct --------------------cPQQAEEALVSGVTTMVGggtgpaagthatTCTP------  171
DSSP  --------------------lLLHHHHHHHHLEEEEEEelllllhhhhhlLLLL------


DSSP  lllllhhhlllllllHHHHHHHHHHHHHHHhhhhLLEEEEEEEEElllHHHHHHHHHHHH
Query kvdpmpwnqtegdvtPDDVVDLVNQGLQEGeqafGIKVRSILCCMrhqPSWSLEVLELCK  167
ident                         |                        |      |   
Sbjct ---------------GPWYISRMLQAADSL----PVNIGLLGKGN---VSQPDALREQVA  209
DSSP  ---------------HHHHHHHHHHHHLLL----LLEEEEEEELL---LLLHHHHHHHHH


DSSP  HLllllEEEEEEELLlllllHHHLhHHHHHHHHHHHHLLEEEEEE----lllLLHHHHHH
Query KYnqktVVAMDLAGDetiegSSLFpGHVEAYEGAVKNGIHRTVHA----gevGSPEVVRE  223
ident       |       |              |   |    |    |                
Sbjct AG----VIGLEIHED---wgATPA-AIDCALTVADEMDIQVALHSdtlnesgFVEDTLAA  261
DSSP  HL----LLEEEEEHH---hlLLHH-HHHHHHHHHHHHLLEEEEELlllllllLHHHHHHH


DSSP  HHHllLLLEEEELH--------HHHHlhhhhhhHHHLlLEEEELHHH-------------
Query AVDilKTERVGHGY--------HTIEdealynrLLKEnMHFEVCPWS-------------  262
ident       |    |            |                                   
Sbjct IGG--RTIHTFHTEgaggghapDIIT------aCAHPnILPSSTNPTlpytlntidehld  313
DSSP  HLL--LLEEELLLLllllllllLHHH------hHHLLlEEEEEEHHHllllllhhhhhhh


DSSP  ----------------hhhlLLLLLLL-LLHHHHHHHlLLLEEELLLLLLLL-llLHHHH
Query ----------------syltGAWDPKT-THAVVRFKNdKANYSLNTDDPLIF-ksTLDTD  304
ident                           |     |      |      |             
Sbjct mlmvchhldpdiaedvafaeSRIRRETiAAEDVLHDL-GAFSLTSSDSQAMGrvgEVILR  372
DSSP  hhhhhhllllllhhhhhlllLLLLHHHhHHHHHHHHL-LLLLEEELLLLLLLlllLHHHH


DSSP  HHHHHHLLL---------------lLHHHHHHH-HHHHHHLLLLlhhhHHHHhhHHHH--
Query YQMTKKDMG---------------fTEEEFKRL-NINAAKSSFLpeeeKKELleRLYR--  346
ident        |                           || |           |         
Sbjct TWQVAHRMKvqrgalaeetgdndnfRVKRYIAKyTINPALTHGI----AHEV--GSIEvg  426
DSSP  HHHHHHHHHhhhlllllllllllhhHHHHHHHLlLHHHHHHLLL----LLLL--LLLLll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  346
ident                                                             
Sbjct kladlvvwspaffgvkpatvikggmiaiapmgdinasiptpqpvhyrpmfgalgsarhhc  486
DSSP  lllleeeelhhhlllllleeeelleeeeeeellllllllllllleeeelhhhlhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  346
ident                                                             
Sbjct rltflsqaaaangvaerlnlrsaiavvkgcrtvqkadmvhnslqpnitvdaqtyevrvdg  546
DSSP  leeeelhhhhhhlhhhhllllleeeellllllllhhhllllllllleeelllllleeell


DSSP  -----------------hll
Query -----------------eyq  349
ident                     
Sbjct elitsepadvlpmaqryflf  566
DSSP  eellllllllllllllllll


No 47: Query=1a4mA Sbjct=4dziC Z-score=12.2

back to top
DSSP  llLLLLLEEEEEEEHHhlllhhhhhhhhhhhllllllllhhhhhhhhlllllllhhhhhl
Query tpAFNKPKVELHVHLDgaikpetilyfgkkrgialpadtveelrniigmdkplslpgfla   60
ident   | |        |                                              
Sbjct --ALNYRVIDVDNHYY--------------------------------------------   14
DSSP  --LLLLLEEEEEEELL--------------------------------------------


DSSP  lhhhhhHHHLLLH-----------------------------------------------
Query kfdyymPVIAGCR-----------------------------------------------   73
ident       |     |                                               
Sbjct -----ePLDSFTRhldkkfkrrgvqmlsdgkrtwavigdrvnhfipnptfdpiivpgcld   69
DSSP  -----lLLLLLLLlllhhhlllleeeeelllleeeeelleellllllllllleelllllh


DSSP  ------------------------hhhhHHHHHHHHHHHHLLEEEEEEEE----------
Query ------------------------eaikRIAYEFVEMKAKEGVVYVEVRY----------   99
ident                                                             
Sbjct llfrgeipdgvdpaslmkverladhpeyQNRDARIAVMDEQDIETAFMLPtfgcgveeal  129
DSSP  hhhhllllllllhhhllleelhhhlhhhLLHHHHHHHHHHHLEEEEEEELlhhhhhhhhl


DSSP  ---------lLHHHllllllllhhhlllllllHHHHHHHHHhhhhhhhhhhLLEEEEEEE
Query ---------sPHLLanskvdpmpwnqtegdvtPDDVVDLVNqglqegeqafGIKVRSILC  150
ident            |                                                
Sbjct khdieatmasVHAF------------------NLWLDEDWG------fdrpDHRIIAAPI  165
DSSP  lllhhhhhhhHHHH------------------HHHHHHHLL------llllLLLEEELLL


DSSP  EELLLHHHHHHHHHHHHHLLlllEEEEEEElLLLL-----LLHH-HLHHhHHHHHHHHHH
Query CMRHQPSWSLEVLELCKKYNqktVVAMDLAgDETI-----EGSS-LFPGhVEAYEGAVKN  204
ident      |    |                               |                 
Sbjct VSLADPTRAVEEVDFVLARG---AKLVLVR-PAPVpglvkPRSLgDRSH-DPVWARLAEA  220
DSSP  LLLLLHHHHHHHHHHHHHLL---LLLEELL-LLLLlllllLLLLlLHHH-HHHHHHHHHH


DSSP  LLEEEEE------------------------elLLLLHHHHHHHH-HLLL------lLEE
Query GIHRTVH------------------------agEVGSPEVVREAV-DILK------tERV  233
ident |     |                                                     
Sbjct GVPVGFHlsdsgylhiaaawggakdpldqvlldDRAIHDTMASMIvHGVFtrhpklkAVS  280
DSSP  LLLEEEEllllllhhhhhhllllllhhhhhhhlLHHHHHHHHHHHhLLHHhhlllllEEE


DSSP  E-ELHHHH-HLHH----------------HHHHHHhLLLEEEELHhhhhhlllllllllL
Query G-HGYHTI-EDEA----------------LYNRLLkENMHFEVCPwssyltgawdpkttH  275
ident    |                             |   |                      
Sbjct IeNGSYFVhRLIKrlkkaantqpqyfpedPVEQLR-NNVWIAPYY-------------eD  326
DSSP  ElLLLLHHhHHHHhhhhhhhhlhhhllllHHHHHH-HHEEELLLL-------------lL


DSSP  HHHHHHHLLL--LEEELLLLLLLL-lLLHHHHHHHHHhllLLLHHHHHHH-HHHHHHLlL
Query AVVRFKNDKA--NYSLNTDDPLIF-kSTLDTDYQMTKkdmGFTEEEFKRL-NINAAKSsF  331
ident                   | |               |   || |         ||     
Sbjct DLPELARVIGvdKILFGSDWPHGEglASPVSFTAELK---GFSESDIRKImRDNALDL-L  382
DSSP  LHHHHHHHHLhhHLLLLLLLLLLLllLLHHHHHHHHL---LLLHHHHHHHhLHHHHHH-H


DSSP  LLHHhhhhhhhhhhhhll
Query LPEEekkellerlyreyq  349
ident                   
Sbjct GVQV------------gs  388
DSSP  LLLL------------ll


No 48: Query=1a4mA Sbjct=1v77A Z-score=11.8

back to top
DSSP  lllllLLEEEEEEEHHhlllhhhhhhhhhhhllllllllhhhhhhhhlllllllhhhhhl
Query tpafnKPKVELHVHLDgaikpetilyfgkkrgialpadtveelrniigmdkplslpgfla   60
ident          |                                                  
Sbjct -----VKFIEMDIRDK--------------------------------------------   11
DSSP  -----LLLEEEEELLH--------------------------------------------


DSSP  lhhhhhhhhlllhhhhhhhhhHHHHHHHHLlEEEEEEEellhhhllllllllhhhlllll
Query kfdyympviagcreaikriayEFVEMKAKEgVVYVEVRysphllanskvdpmpwnqtegd  120
ident                      |  |         | |                       
Sbjct ---------------------EAYELAKEW-FDEVVVS----------------------   27
DSSP  ---------------------HHHHHHHHH-LLEEEEE----------------------


DSSP  llhhhhhhhhhhhhhhhhhhhlleeeeeEEEELllhhHHHHhhHHHHHLLLLLE-EEEEE
Query vtpddvvdlvnqglqegeqafgikvrsiLCCMRhqpsWSLEvlELCKKYNQKTV-VAMDL  179
ident                                            |           ||  |
Sbjct ----------------------------IKFNE----EVDK--EKLREARKEYGkVAILL   53
DSSP  ----------------------------EEELL----LLLH--HHHHHHHHHHLlEEEEE


DSSP  ElllllllHHHLhhHHHHHHHHHhhLLEEEEEElllLLHHHHHHHHHLlLLLEEEEL---
Query AgdetiegSSLFpgHVEAYEGAVknGIHRTVHAgevGSPEVVREAVDIlKTERVGHG---  236
ident                               |         | |                 
Sbjct S-----npKPSL--VRDTVQKFK--SYLIYVES---NDLRVIRYSIEK-GVDAIISPwvn  100
DSSP  E-----llLHHH--HHHHHHHLL--LLEEEEEL---LLHHHHHHHHHL-LLLEEELLlll


DSSP  ---HHHHhlHHHHHHHHHLLLEEEELHhHHHHLL-llLLLL-----LLHHHHHHHLLLLE
Query ---YHTIedEALYNRLLKENMHFEVCPwSSYLTG-awDPKT-----THAVVRFKNDKANY  287
ident            |     | |           |                |       |   
Sbjct rkdPGID--HVLAKLMVKKNVALGFSL-RPLLYSnpyERANllrfmMKAWKLVEKYKVRR  157
DSSP  lllLLLL--HHHHHHHHHHLLEEEEEL-HHHHHLlhhHHHHhhhhhHHHHHHHHHHLLLE


DSSP  EELLLL-LLLLlLLHHHHHHHHHhLLLLLHHHHHHH-HHHHHHLLlllhhhhhhhhhhhh
Query SLNTDD-PLIFkSTLDTDYQMTKkDMGFTEEEFKRL-NINAAKSSflpeeekkellerly  345
ident  |                        |      |                          
Sbjct FLTSSAqEKWDvRYPRDLISLGV-VIGMEIPQAKASiSMYPEIIL---------------  201
DSSP  EEELLLlLHHHlLLHHHHHHHHH-HLLLLHHHHHHLlLHHHHHHH---------------


DSSP  hhll
Query reyq  349
ident     
Sbjct ---k  202
DSSP  ---l


No 49: Query=1a4mA Sbjct=1j5sA Z-score=10.8

back to top
DSSP  -------------------llLLLLLEEEEEEEHH--hlllhHHHHhhhhhhllllllll
Query -------------------tpAFNKPKVELHVHLD--gaikpETILyfgkkrgialpadt   39
ident                          | |  | |||                         
Sbjct hmflgedylltnraavrlfneVKDLPIVDPHNHLDakdivenKPWN--------------   46
DSSP  llllllllllllhhhhhhhhhHLLLLEEELLLLLLhhhhhhlLLLL--------------


DSSP  HHHH-HHHHLLL-------------------------------------LLLL-------
Query VEEL-RNIIGMD-------------------------------------KPLS-------   54
ident                                                   |         
Sbjct DIWEvEGATDHYvwelmrrcgvseeyitgsrsnkekwlalakvfprfvgNPTYewihldl  106
DSSP  LHHHhHLLLLHHhhhhhhhllllhhhllllllhhhhhhhhhhhhhhhllLHHHhhhhhhh


DSSP  --hhhhhllhhhhhhhhlllhhhhhhhhhhhhHHHHHLLEEEEEEEELLHhhllllllll
Query --lpgflakfdyympviagcreaikriayefvEMKAKEGVVYVEVRYSPHllanskvdpm  112
ident                                        |        |           
Sbjct wrrfnikkviseetaeeiweetkkklpemtpqKLLRDMKVEILCTTDDPV----------  156
DSSP  hhhllllllllhhhhhhhhhhhhhhlllllhhHHHHHLLEEEEELLLLLL----------


DSSP  hhhlllllllhhhHHHHHHHHHHHhhHHHLLEEEEEEEEElLLHH---------------
Query pwnqtegdvtpddVVDLVNQGLQEgeQAFGIKVRSILCCMrHQPS---------------  157
ident                        |     |                              
Sbjct -------------STLEHHRKAKE--AVEGVTILPTWRPD-RAMNvdkegwreyvekmge  200
DSSP  -------------LLLHHHHHHHH--HLLLLEEELLLLLH-HHHLlllllhhhhhhhhhh


DSSP  -----------hhhHHHHHHHHLLLLLEEEEEEEllLLLLL-------------------
Query -----------wslEVLELCKKYNQKTVVAMDLAgdETIEG-------------------  187
ident                             || | |                          
Sbjct rygedtstldgflnALWKSHEHFKEHGCVASDHA--LLEPSvyyvdenraravhekafsg  258
DSSP  hhllllllhhhhhhHHHHHHHHHHLLLLLEEEEE--ELLLLlllllhhhhhhhhhhhlll


DSSP  ---------hhhLHHHHHHHHHHHhHLLE-EEEEE------------------------l
Query ---------sslFPGHVEAYEGAVkNGIH-RTVHA------------------------g  213
ident                 |                |                          
Sbjct ekltqdeindykAFMMVQFGKMNQ-ETNWvTQLHIgalrdyrdslfktlgpdsggdistn  317
DSSP  llllhhhhhhhhHHHHHHHHHHHH-HHLLeEEEEEleellllhhhhhhlllllllleell


DSSP  lllLHHHHHHHHHLL---LLLEEEE--lhHHHHlhHHHHHHhhLLLEEEELH-HHHHhll
Query evgSPEVVREAVDIL---KTERVGH--gyHTIEdeALYNRLlkENMHFEVCP-WSSYltg  267
ident      |  |                    |              |               
Sbjct flrIAEGLRYFLNEFdgkLKIVLYVldptHLPTisTIARAF--PNVYVGAPWwFNDS---  372
DSSP  lllHHHHHHHHHHHLlllLLEEEEEllhhHHHHhhHHHHHL--LLEEELLLLlLLLL---


DSSP  llllllLLHHHHHHH--LLLLE-EELLLLLL--lllLLHHHHHHHHHhLLLL--------
Query awdpktTHAVVRFKN--DKANY-SLNTDDPL--ifkSTLDTDYQMTKkDMGF--------  314
ident                     |     ||        |                       
Sbjct --pfgmEMHLKYLASvdLLYNLaGMVTDSRKllsfgSRTEMFRRVLS-NVVGemvekgqi  429
DSSP  --hhhhHHHHHHHHLllLHHHLlLLLLLLLLllhhhHHHHHHHHHHH-HHHHhhhhllll


DSSP  ----LHHHHHHH-HHHHHHLLLllhhhhhhhhhhhhhhll
Query ----TEEEFKRL-NINAAKSSFlpeeekkellerlyreyq  349
ident       |  |           |                  
Sbjct pikeARELVKHVsYDGPKALFF------------------  451
DSSP  lhhhHHHHHHHHhLHHHHHHHL------------------


No 50: Query=1a4mA Sbjct=3qy6A Z-score=10.4

back to top
DSSP  lllllllEEEEEEEH----HHLLLhhhhhhhhhhhllllllllhhhhhhhhlllllllhh
Query tpafnkpKVELHVHL----DGAIKpetilyfgkkrgialpadtveelrniigmdkplslp   56
ident            | |     |                                        
Sbjct -------MIDIHCHIlpamDDGAG------------------------------------   17
DSSP  -------LEELLLLLllllLLLLL------------------------------------


DSSP  hhhllhhhhhhhhlllhhhHHHHHHHHHHHHHHLLEEEEEEEEL----lHHHLlllllll
Query gflakfdyympviagcreaIKRIAYEFVEMKAKEGVVYVEVRYS----pHLLAnskvdpm  112
ident                          |        |                         
Sbjct -------------------DSADSIEMARAAVRQGIRTIIATPHhnngvYKNE-------   51
DSSP  -------------------LHHHHHHHHHHHHHLLLLEEELLLEellllLLLL-------


DSSP  hhhlllllllhhHHHHHHHHHHHHHHH--HHLLEEEEEEeeelllhhhhhhhhhhhhhll
Query pwnqtegdvtpdDVVDLVNQGLQEGEQ--AFGIKVRSILccmrhqpswslevlelckkyn  170
ident               |      |            |                         
Sbjct -----------pAAVREAADQLNKRLIkeDIPLHVLPGQ---------------------   79
DSSP  -----------hHHHHHHHHHHHHHHHhlLLLLEEELLL---------------------


DSSP  llleeeeEEELllllllhhhlhHHHHHHHHH----hhhlLEEEEEEllLLLHH-hhHHHH
Query qktvvamDLAGdetiegsslfpGHVEAYEGA----vkngIHRTVHAgeVGSPE-vvREAV  225
ident                                                             
Sbjct -------EIRI---------ygEVEQDLAKRqllslndtKYILIEF-pFDHVPryaEQLF  122
DSSP  -------EEEL---------llLHHHHHHLLllllhhhlLEEEEEL-lLLLLLllhHHHH


DSSP  HLLL----LLEEEELH---HHHHLHHHHHHHHHLLLEEEELHHH-hHHLLllllLLLL-H
Query DILK----TERVGHGY---HTIEDEALYNRLLKENMHFEVCPWS-sYLTGawdpKTTH-A  276
ident   |          |        |   |   |            |     |    |     
Sbjct YDLQlkgyIPVIAHPErnrEIRENPSLLYHLVEKGAASQITSGSlaGIFG----KQLKaF  178
DSSP  HHHHhlllEEEEELHHhlhHHHHLLHHHHHHHHLLLEEEEEHHHhlLLLL----HHHHhH


DSSP  HHHHHHLLLLEEELLLLLL-LLLL-LHHHHHHHHHHllLLLHHHHHHHHHHHHHlLLLLH
Query VVRFKNDKANYSLNTDDPL-IFKS-TLDTDYQMTKKdmGFTEEEFKRLNINAAKsSFLPE  334
ident   |            |                   |   |  |    |  ||        
Sbjct SLRLVEANLIHFVASDAHNvKTRNfHTQEALYVLEK--EFGSELPYMLTENAEL-LLRNQ  235
DSSP  HHHHHHLLLLLEEELLLLLlLLLLlLHHHHHHHHHH--HHLLHHHHHHHHHHHH-HHLLL


DSSP  hhhhhhhhhhhhhll
Query eekkellerlyreyq  349
ident                
Sbjct ---tifrqppqpvkr  247
DSSP  ---llllllllllll


No 51: Query=1a4mA Sbjct=3iacA Z-score=9.7

back to top
DSSP  --------------------LLLLLLLEEEEEEEHH-----hlLLHHhhhhhhhhhllll
Query --------------------TPAFNKPKVELHVHLD-----gaIKPEtilyfgkkrgial   35
ident                       |   |    | ||                         
Sbjct atfxtedfllkndiartlyhKYAAPXPIYDFHCHLSpqeiaddRRFD-------------   47
DSSP  llllllllllllhhhhhhhhHLLLLLLEEELLLLLLhhhhhhlLLLL-------------


DSSP  llllHHHHHhHHLL--LLLL----------------------------------------
Query padtVEELRnIIGM--DKPL----------------------------------------   53
ident                  |                                          
Sbjct ----NLGQI-WLEGdhYKWRalrsagvdeslitgketsdyekyxawantvpktlgnplyh  102
DSSP  ----LHHHH-HHLLllHHHHhhhhllllhhhlllllllhhhhhhhhhhhhhhllllhhhh


DSSP  ----------lhhhhhllhhhhhhhhlllhhhhhhhhhhhhHHHHHLLEEEEEEEELLhh
Query ----------slpgflakfdyympviagcreaikriayefvEMKAKEGVVYVEVRYSPhl  103
ident                                                 |  |     |  
Sbjct wthlelrrpfgitgtlfgpdtaesiwtqcneklatpafsarGIXQQXNVRXVGTTDDP--  160
DSSP  hhhhhhhlllllllllllhhhhhhhhhhhhhhhllhhhlhhHHHHHLLEEEEELLLLL--


DSSP  hllllllllhhhlllllllhhhHHHHhhHHHHHHHHH--HLLEEEEEEEEElLLHH----
Query lanskvdpmpwnqtegdvtpddVVDLvnQGLQEGEQA--FGIKVRSILCCMrHQPS----  157
ident                          |               | |                
Sbjct ----------------------IDSL--EYHRQIAADdsIDIEVAPSWRPD-KVFKield  195
DSSP  ----------------------LLLL--HHHHHHHHLllLLLEEELLLLLH-HHHLllll


DSSP  ----------------------hhhHHHHHHHHLLLLLEEEEEEEllLLLLL--------
Query ----------------------wslEVLELCKKYNQKTVVAMDLAgdETIEG--------  187
ident                                         | |                 
Sbjct gfvdylrkleaaadvsitrfddlrqALTRRLDHFAACGCRASDHG--IETLRfapvpdda  253
DSSP  lhhhhhhhhhhhhllllllhhhhhhHHHHHHHHHHHLLLLEEEEE--ELLLLllllllhh


DSSP  ---------------------hhHLHHHHHHHHHHHhHLLE-EEEEELLL----------
Query ---------------------ssLFPGHVEAYEGAVkNGIH-RTVHAGEV----------  215
ident                             |                | |            
Sbjct qldailgkrlagetlseleiaqfTTAVLVWLGRQYA-ARGWvXQLHIGAIrnnntrxfrl  312
DSSP  hhhhhhhhhhllllllhhhhhhhHHHHHHHHHHHHH-HHLLeEEEEELEEllllhhhhhh


DSSP  -------------lLHHHHHHHHHLL------LLLEEeELHHhHHLHHHHHHHHHL----
Query -------------gSPEVVREAVDIL------KTERVgHGYHtIEDEALYNRLLKE----  252
ident                        |                     |              
Sbjct lgpdtgfdsigdnnISWALSRLLDSXdvtnelPKTIL-YCLN-PRDNEVLATXIGNfqgp  370
DSSP  hllllllleellllLHHHHHHHHHHHhlllllLEEEE-EELL-HHHHHHHHHHHHHllll


DSSP  ----lLEEEElhhHHHHllllllllLLHHHHHHHLL-------lLEEELLLLLLllLLLH
Query ----nMHFEVcpwSSYLtgawdpktTHAVVRFKNDK-------aNYSLNTDDPLifKSTL  301
ident        |                      |                  ||         
Sbjct giagkVQFGS--gWWFN------dqKDGXLRQLEQLsqxgllsqFVGXLTDSRS--FLSY  420
DSSP  lllllEEELL--lLHHH------llHHHHHHHHHHHhhhllhhhLLLLLLLLLL--LLLL


DSSP  hHHHHHHHHllLLLH-------------------HHHHHH-HHHHHHLlLLLHhhhhhhh
Query dTDYQMTKKdmGFTE-------------------EEFKRL-NINAAKSsFLPEeekkell  341
ident  |                                         ||    |          
Sbjct -TRHEYFRR--ILCNllgqwaqdgeipddeaxlsRXVQDIcFNNAQRY-FTIK-------  469
DSSP  -HHHHHHHH--HHHHhhhhhhhlllllllhhhhhHHHHHHhLHHHHHH-LLLL-------


DSSP  hhhhhhll
Query erlyreyq  349
ident         
Sbjct --------  469
DSSP  --------


No 52: Query=1a4mA Sbjct=3dcpA Z-score=9.1

back to top
DSSP  llllllLEEEEEEEHH----HLLLhhhhhhhhhhhllllllllhhhhhhhhlllllllhh
Query tpafnkPKVELHVHLD----GAIKpetilyfgkkrgialpadtveelrniigmdkplslp   56
ident        |   | |      |                                       
Sbjct ------XKRDGHTHTEfcphGTHD------------------------------------   18
DSSP  ------LLEEEEELLLllllLLLL------------------------------------


DSSP  hhhllhhhhhhhhlllhhhhhhHHHHHHHHHHHLLEEEEEEEE-----------------
Query gflakfdyympviagcreaikrIAYEFVEMKAKEGVVYVEVRY-----------------   99
ident                          | |                                
Sbjct ----------------------DVEEXVLKAIELDFDEYSIVEhaplssefxkntagdke   56
DSSP  ----------------------LHHHHHHHHHHLLLLEEEEEEellllhhhhhllllllh


DSSP  -----LLHHHLlllllllhhhlllllllHHHHHHHHHHHHHHHHHhhLLEEEEEeeeell
Query -----SPHLLAnskvdpmpwnqtegdvtPDDVVDLVNQGLQEGEQafGIKVRSIlccmrh  154
ident      |                              |                       
Sbjct avttaSXAXSD-----------------LPYYFKKXNHIKKKYAS--DLLIHIG------   91
DSSP  hhhllLLLHHH-----------------HHHHHHHHHHHHHHLLL--LLEEEEE------


DSSP  lhhhhhhhhhhhhhllllleeEEEEelllllllhHHLHhhHHHHHHHHHHLL----eeEE
Query qpswslevlelckkynqktvvAMDLagdetiegsSLFPghVEAYEGAVKNGI----hrTV  210
ident                                                             
Sbjct ---------------------FEVD--------yLIGY--EDFTRDFLNEYGpqtddgVL  120
DSSP  ---------------------EEEE--------lLLLL--HHHHHHHHHHHHhhlleeEE


DSSP  EE--------------------------------llllLHHHHHHHHHLL----LLLEEE
Query HA--------------------------------gevgSPEVVREAVDIL----KTERVG  234
ident                                         | |           |  | |
Sbjct SLhflegqggfrsidfsaedynegivqfyggfeqaqlaYLEGVKQSIEADlglfKPRRXG  180
DSSP  ELleeeelleeeellllhhhhhhhlhhhhllhhhhhhhHHHHHHHHHHLLllllLLLEEL


DSSP  ELH-------------------hhhHLHHHHHHHHHLLLEEEELHhHHHHL--LLLLlll
Query HGY-------------------htiEDEALYNRLLKENMHFEVCPwSSYLT--GAWDpkt  273
ident |                                  |                        
Sbjct HISlcqkfqqffgedtsdfseevxeKFRVILALVKKRDYELDFNT-AGLFKplCGETypp  239
DSSP  LLLhhhllhhhhlllhhhllhhhhhHHHHHHHHHHHHLLEEEEEL-HHHHLllLLLLlll


DSSP  LLHHHHHHHLLLLEEELLLLLLllLLLHhHHHHHHHhLLLLlhhhhhhhhhhhhhlllll
Query THAVVRFKNDKANYSLNTDDPLifKSTLdTDYQMTKkDMGFteeefkrlninaakssflp  333
ident    |              |            |                            
Sbjct KKIVTLASELQIPFVYGSDSHG-vQDIG-RGYSTYC-QKLE-------------------  277
DSSP  HHHHHHHHHLLLLEEEELLLLL-hHHLL-LLHHHHH-HHLL-------------------


DSSP  hhhhhhhhhhhhhhll
Query eeekkellerlyreyq  349
ident                 
Sbjct ----------------  277
DSSP  ----------------


No 53: Query=1a4mA Sbjct=3au2A Z-score=8.7

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct mrnqelarifeeiglmseflgdnpfrvrayhqaartlydldtpieeiaekgkealmelpg   60
DSSP  llhhhhhhhhhhhhhhhhhllllhhhhhhhhhhhhhhhhllllhhhhhlllhhhhlllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct vgpdlaekileflrtgkvrkheelsrkvprgvlevmevpgvgpktarllyeglgidslek  120
DSSP  llhhhhhhhhhhhhhlllhhhhhhhhhllhhhhhhhllllllhhhhhhhhhhhllllhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct lkaaldrgdltrlkgfgpkraerireglalaqaagkrrplgavlslarslleairalpgv  180
DSSP  hhhhhhhlhhhhlllllhhhhhhhhhhhhhhhhlllleehhhhhhhhhhhhhhhhlllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct eraelcgsarrykdtvgdldflvasregeravegfvrlpqvkevyakgkeratvflkngl  240
DSSP  leeeelhhhhlllleelleeeeeelllhhhhhhhhhlllleeeeeeellleeeeeellll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct qvdlrvvppesygaglqyltgskahsirlralaqekglklseygvfrgekriageteeev  300
DSSP  eeeeeeelhhhhhhhhhhhhllhhhhhhhhhhhhhllleeelleeeelleeeelllhhhh


DSSP  ------------------------------llLLLLlEEEEEEEH---HHLLlhhhhhhh
Query ------------------------------tpAFNKpKVELHVHL---DGAIkpetilyf   27
ident                                      |  | ||    ||          
Sbjct yaalglpwippplredqgeveaalegrlpkllELPQvKGDLQVHStysDGQN--------  352
DSSP  hhhlllllllhhhlllllhhhhhhllllllllLHHHlLEEEEELLlllLLLL--------


DSSP  hhhhllllllllhhhhhhhhlllllllhhhhhllhhhhhhhhlllhhhhhhHHHHHHHHH
Query gkkrgialpadtveelrniigmdkplslpgflakfdyympviagcreaikrIAYEFVEMK   87
ident                                                       |  |  
Sbjct ---------------------------------------------------TLEELWEAA  361
DSSP  ---------------------------------------------------LHHHHHHHH


DSSP  HHLLEEEEEEEEllhhhllllllllhhhlllllllhhhhhhhhhhhhhhhhhhhlleeee
Query AKEGVVYVEVRYsphllanskvdpmpwnqtegdvtpddvvdlvnqglqegeqafgikvrs  147
ident    |  |  |                                                  
Sbjct KTMGYRYLAVTD------------------------------------------------  373
DSSP  HHHLLLEEEEEE------------------------------------------------


DSSP  eeEEEL-lLHHHhhHHHHHHHHLLLLLE------------EEEEEElllllLLHHhlhhh
Query ilCCMR-hQPSWslEVLELCKKYNQKTV------------VAMDLAgdetiEGSSlfpgh  194
ident                  |   |                                      
Sbjct --HSPAvrVAGG--PSPEEALKRVGEIRrfnethgppyllAGAEVD---ihPDGT-----  421
DSSP  --ELHHhhLLLL--LLHHHHHHHHHHHHhhhhhhllleeeEEEEEE---llLLLL-----


DSSP  hhHHHHHHhHLLE-EEEEE------llllLHHHHHHHHHLLLLLEEEELH---------h
Query veAYEGAVkNGIH-RTVHA------gevgSPEVVREAVDILKTERVGHGY---------h  238
ident                 |                   |          |            
Sbjct ldYPDWVL-RELDlVLVSVhsrfnlpkadQTKRLLKALENPFVHVLAHPTarllgrrapi  480
DSSP  llLLHHHH-LLLLeEEEELlllllllhhhHHHHHHHHHLLLLLLEELLLLllllllllll


DSSP  hHHLHHHHHHHHHLLLEEEELHhHHHHlllllllllLHHHHHHHLLLLEEELLLL-LLLL
Query tIEDEALYNRLLKENMHFEVCPwSSYLtgawdpkttHAVVRFKNDKANYSLNTDD-PLIF  297
ident     ||            |                              || ||      
Sbjct eADWEAVFQKAKEKGVAVEIDG-YYDR----mdlpdDLARMAYGMGLWISLSTDAhQTDH  535
DSSP  lLLHHHHHHHHHHHLLEEEEEL-LLLL----llllhHHHHHHHHLLLLEEEELLLlLHHH


DSSP  lLLHHHHHHHHHhLLLLlhhHHHHHhhHHHHlllllhhhHHHHH-hhhhhhll
Query kSTLDTDYQMTKkDMGFteeEFKRLniNAAKssflpeeeKKELL-erlyreyq  349
ident                        |                  ||         
Sbjct lRFMELAVGTAQ-RAWI---GPERV--LNTL-------dYEDLLswlkarrgv  575
DSSP  hHHHHHHHHHHH-HLLL---LLLLL--HHHL-------lHHHHHhhhhlllll


No 54: Query=1a4mA Sbjct=3f2bA Z-score=8.7

back to top
DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------    0
ident                                                             
Sbjct vrrletiveeerrvvvqgyvfdaevselksgrtlltmkitdytnsilvkmfsrdkedael   60
DSSP  lllhhhlllleeeeeeeeeeeeeeeeellllleeeeeeeelllleeeeeeelllhhhhhh


DSSP  ----------------------------------------lLLLL--LLEEEEEEEH---
Query ----------------------------------------tPAFN--KPKVELHVHL---   15
ident                                                   |||| |    
Sbjct msgvkkgmwvkvrgsvqndtfvrdlviiandlneiaanerqDTAPegEKRVELHLHTpms  120
DSSP  hhlllllleeeeeeeeeeelllleeeeeeeeeeeellllllLLLLllLLLLLLLLLLlll


DSSP  --HHLLlhhhhhhhhhhhllllllllhhhhhhhhlllllllhhhhhllhhhhhhhhlllh
Query --DGAIkpetilyfgkkrgialpadtveelrniigmdkplslpgflakfdyympviagcr   73
ident   |                                                         
Sbjct qmDAVT------------------------------------------------------  126
DSSP  llLLLL------------------------------------------------------


DSSP  hhhhhHHHHHHHHHHHLLEEEEEEEELLhhhllllllllhhhlllllllhhhhHHHHHHH
Query eaikrIAYEFVEMKAKEGVVYVEVRYSPhllanskvdpmpwnqtegdvtpddvVDLVNQG  133
ident            |   | |     |                             |      
Sbjct -----SVTKLIEQAKKWGHPAIAVTDHA-------------------------VVQSFPE  156
DSSP  -----LHHHHHHHHHHLLLLLEEELLLL-------------------------LLLLHHH


DSSP  HHHHHHHHLLEEEEEEEEElllhhhhhhhhhhhhhllllleeeeeeelllllllhHHLH-
Query LQEGEQAFGIKVRSILCCMrhqpswslevlelckkynqktvvamdlagdetiegsSLFP-  192
ident         | ||   |                                            
Sbjct AYSAAKKHGMKVIYGLEAN------------------------------------IVDDp  180
DSSP  HHHHHHHHLLLEEEEEEEE------------------------------------EELLl


DSSP  ---------------------------------hHHHHHHHHHhhLLEEEeeelllllhh
Query ---------------------------------gHVEAYEGAVknGIHRTvhagevgspe  219
ident                                                             
Sbjct fhvtllaqnetglknlfklvslshiqyfhrvpriPRSVLVKHR--DGLLV----------  228
DSSP  eeeeeeellhhhhhhhhhhhhhhhllllllllleEHHHHHHLL--LLEEE----------


DSSP  hhhhhhhlllllEEEE----LHHHhhlhhhHHHHHhllLEEEELHHhHHHLL-llLLLLL
Query vvreavdilkteRVGH----GYHTiedealYNRLLkenMHFEVCPWsSYLTG-awDPKTT  274
ident               |                          || |   |      |    
Sbjct ------------GSGCdkgeLFDN------VEDIArfyDFLEVHPPdVYKPLyvkDEEMI  270
DSSP  ------------ELLLllllLLLL------LLLLHhhlLLEEELLHhHHLLLlllLHHHH


DSSP  L-HHHHHHHLLL----LEEELLLLLL----------------------------LLLLLH
Query H-AVVRFKNDKA----NYSLNTDDPL----------------------------IFKSTL  301
ident                                                             
Sbjct KnIIRSIVALGEkldiPVVATGNVHYlnpedkiyrkilihsqgganplnrhelpDVYFRT  330
DSSP  HhHHHHHHHHHHhlllLEEELLLLLLllhhhhhhhhhhhhllhhhlllllllllLLLLLL


DSSP  H-HHHHHHHhllLLLHHHHHHH-HHHHHHL-LLLL-------------------------
Query D-TDYQMTKkdmGFTEEEFKRL-NINAAKS-SFLP-------------------------  333
ident                 |  |     |  |  |                            
Sbjct TnEMLDCFS---FLGPEKAKEIvVDNTQKIaSLIGdvkpikdelytpriegadeeirems  387
DSSP  HhHHHHHHH---HHHHHHHHHHhLHHHHHHhHLLLllllllllllllllllhhhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  333
ident                                                             
Sbjct yrrakeiygdplpklveerlekelksiighgfaviylishklvkkslddgylvgsrgsvg  447
DSSP  hhhhhhhhlllllhhhhhhhhhhhhhhhhlllhhhhhhhhhhhhhhhhllllleelhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  333
ident                                                             
Sbjct ssfvatmteitevnplpphyvcpnckhseffndgsvgsgfdlpdkncprcgtkykkdghd  507
DSSP  hlhhhhhllllllllllleeelllllleeellllllllhhhllllllllllllleeelll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  333
ident                                                             
Sbjct ipfetflgfkgdkvpdidlnfsgeyqprahnytkvlfgednvyragtigtvadktaygfv  567
DSSP  lllhhhhllllllllleeeeeelllhhhhhhhhhhhhlllleeeeeeeeellhhhhhhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  333
ident                                                             
Sbjct kayasdhnlelrgaeidrlaagctgvkrttgqhpggiivvpdymeiydftpiqypaddts  627
DSSP  hhhhhhllllllhhhhhhhhhhhllleeeeeeeeeeeeellllllhhhllleelhhhlll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  333
ident                                                             
Sbjct sewrtthfdfhsihdnllkldilghddptvirmlqdlsgidpktiptddpdvmgifsste  687
DSSP  lllleeeeehhhhllllleeeeeeehhhhhhhhhhhhhlllhhhlllllhhhhhlllllh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  333
ident                                                             
Sbjct plgvtpeqimcnvgtigipefgtrfvrqmleetrpktfselvqisglshgtdvwlgnaqe  747
DSSP  hhlllhhhhllllllllllllllhhhhhhhhhhllllhhhhhhhhhhllllllllllhhh


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  333
ident                                                             
Sbjct liqngtctlsevigcrddimvyliyrglepslafkimesvrkgkgltpefeaemrkhdvp  807
DSSP  hhhlllllhhhllllhhhhhhhhhhllllhhhhhhhhhhhlllllllhhhhhhhhhllll


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  333
ident                                                             
Sbjct ewyidsckkikymfpkahaaayvlmavriayfkvhhpllyyasyftvraedfdldamikg  867
DSSP  hhhhhhhhhllllllhhhhhhhhhhhhhhhhhhhhlhhhhhhhhhhhllllllhhhhhhl


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  333
ident                                                             
Sbjct saairkrieeinakgiqatakekslltvlevalemcergfsfknidlyrsqatefvidgn  927
DSSP  hhhhhhhhhhhhhlhhhllhhhhhhhhhhhhhhhhhhllleellllllllllllleeell


DSSP  ---------------------------------------------------hhhhhhhhh
Query ---------------------------------------------------eeekkelle  342
ident                                                             
Sbjct slippfnaipglgtnvaqaivrareegeflskedlqqrgklsktlleylesrgcldslpd  987
DSSP  eeellhhhlllllhhhhhhhhhhhhllllllhhhhhhhhlllhhhhhhhhhlllllllll


DSSP  hhhhhll
Query rlyreyq  349
ident        
Sbjct hnqlslf  994
DSSP  lllllll


No 55: Query=1a4mA Sbjct=1bksA Z-score=8.2

back to top
DSSP  ---------lllllllEEEEeEEHHhlllhhhhhhhhhhhllllllllhhhhhhhhllll
Query ---------tpafnkpKVELhVHLDgaikpetilyfgkkrgialpadtveelrniigmdk   51
ident                                                             
Sbjct meryenlfaqlndrreGAFV-PFVT-----------------------------------   24
DSSP  lhhhhhhhhhhhhlllLEEE-EEEE-----------------------------------


DSSP  lllhhhhhllhhhhhhhhllLHHHHHHHHHHHHHHHhhlleeeEEEEELLHHhllllllL
Query plslpgflakfdyympviagCREAIKRIAYEFVEMKakegvvyVEVRYSPHLlanskvdP  111
ident                       |    |                                
Sbjct ----------------lgdpGIEQSLKIIDTLIDAG------aDALELGVPF-------S   55
DSSP  ----------------llllLHHHHHHHHHHHHHLL------lLLEEEELLL-------L


DSSP  LHH-----------hllLLLLLHHHHHHHHHHHHHHHHhhhllEEEEEEEEElllHHHHH
Query MPW-----------nqtEGDVTPDDVVDLVNQGLQEGEqafgiKVRSILCCMrhqPSWSL  160
ident  |                  |||                         |           
Sbjct DPLadgptiqnanlrafAAGVTPAQCFEMLALIREKHP-----TIPIGLLMY---ANLVF  107
DSSP  LLLlllhhhhhhhhhhhHHLLLHHHHHHHHHHHHHHLL-----LLLEEEEEL---HHHHH


DSSP  -----hHHHHHHHLLlllEEEEEEELllllllHHHLhhHHHHHHHHHHHLLEEEEEELLL
Query -----eVLELCKKYNqktVVAMDLAGdetiegSSLFpgHVEAYEGAVKNGIHRTVHAGEV  215
ident           |       |     |                    |    |         
Sbjct nngidaFYARCEQVG---VDSVLVAD-----vPVEE--SAPFRQAALRHNIAPIFICPPN  157
DSSP  lllhhhHHHHHHHHL---LLEEEELL-----lLHHH--LHHHHHHHHHLLLEEEEEELLL


DSSP  LLHHHHHHHHHllLLLE-EEELhhhHHLHHHHHHHHHLLL-EEEELHHHhhhllllllll
Query GSPEVVREAVDilKTER-VGHGyhtIEDEALYNRLLKENM-HFEVCPWSsyltgawdpkt  273
ident       |                       |   |                         
Sbjct ADDDLLRQVAS--YGRGyTYLL--aLPLHHLIEKLKEYHAaPALQGFGI-----sspeqv  208
DSSP  LLHHHHHHHHH--HLLLlEEEL--lLLHHHHHHHHHHHLLlLEEELLLL-----llhhhh


DSSP  lLHHHHHhhllllEEELLLLLLLLL--------------------lLHHHhhhhhhhlll
Query tHAVVRFkndkanYSLNTDDPLIFK--------------------sTLDTdyqmtkkdmg  313
ident   ||                                                        
Sbjct sAAVRAG-----aAGAISGSAIVKIieknlaspkqmlaelrsfvsaMKAA----------  253
DSSP  hHHHHHL-----lLEEEELLHHHHHhhhllllhhhhhhhhhhhhhhHHHL----------


DSSP  llhhhhhhhhhhhhhlllllhhhhhhhhhhhhhhll
Query fteeefkrlninaakssflpeeekkellerlyreyq  349
ident                                     
Sbjct ----------------------------------sr  255
DSSP  ----------------------------------ll


No 56: Query=1a4mA Sbjct=1m65A Z-score=7.6

back to top
DSSP  llllllLEEEEEEEH----HHLLlhhhhhhhhhhhllllllllhhhhhhhhlllllllhh
Query tpafnkPKVELHVHL----DGAIkpetilyfgkkrgialpadtveelrniigmdkplslp   56
ident         | || |                                              
Sbjct ------YPVDLHMHTvastHAYS-------------------------------------   17
DSSP  ------LLEELLLLLllllLLLL-------------------------------------


DSSP  hhhllhhhhhhhhlllhhhhhhHHHHHHHHHHHLLEEEEEEEEllhhhllllllllhhhl
Query gflakfdyympviagcreaikrIAYEFVEMKAKEGVVYVEVRYsphllanskvdpmpwnq  116
ident                                   |                         
Sbjct ----------------------TLSDYIAQAKQKGIKLFAITD-----------------   38
DSSP  ----------------------LHHHHHHHHHHHLLLEEEEEE-----------------


DSSP  llllllhhhhhhhhhhhhhhhhhhhlleeeeeeEEELLLhhhhhhHHHHHHhLLLLL---
Query tegdvtpddvvdlvnqglqegeqafgikvrsilCCMRHQpswsleVLELCKkYNQKT---  173
ident                                                             
Sbjct ---------------------------------HGPDME---dapHHWHFI-NMRIWprv   61
DSSP  ---------------------------------ELLLLL---lllLLHHHH-HHHHLlle


DSSP  ------eEEEEEEllllllLHHHlhhhhhhhhhHHHHLL----EEEEEE--------lll
Query ------vVAMDLAgdetieGSSLfpghveayegAVKNGI----HRTVHA--------gev  215
ident                                                             
Sbjct vdgvgilRGIEAN-----iKNVD------geidCSGKMFdsldLIIAGFhepvfaphdka  110
DSSP  elleeeeEEEEEE-----lLLLL------llllLLHHHHhhllEEEEELlllllllllhh


DSSP  lLHHHHHHHHHLlLLLEEEELH-----HHHHLhhHHHHHHHLLLEEEELHHHhhhlllll
Query gSPEVVREAVDIlKTERVGHGY-----HTIEDeaLYNRLLKENMHFEVCPWSsyltgawd  270
ident                    |                    |     |    |        
Sbjct tNTQAMIATIASgNVHIISHPGnpkyeIDVKA--VAEAAAKHQVALEINNSS--------  160
DSSP  hHHHHHHHHHHLlLLLEELLLLlllllLLHHH--HHHHHHHHLLEEEEELLL--------


DSSP  llllLHHHHHHHLLLLEEELLLLLL-llllLHHHHHHHHHhLLLLlhhHHHHHH----HH
Query pkttHAVVRFKNDKANYSLNTDDPL-ifksTLDTDYQMTKkDMGFteeEFKRLN----IN  325
ident                   |  |                      |      |        
Sbjct -ncrEVAAAVRDAGGWVALGSDSHTaftmgEFEECLKILD-AVDF---PPERILnvspRR  215
DSSP  -lhhHHHHHHHHHLLLEEEELLLLLhhhllLLHHHHHHHH-HLLL---LHHHLHhhlhHH


DSSP  HHHLL--llLHHHhHHHHHHhhhhll
Query AAKSS--flPEEEkKELLERlyreyq  349
ident                |          
Sbjct LLNFLesrgMAPI-AEFADL------  234
DSSP  HHHHHhhllLLLL-HHHLLL------


No 57: Query=1a4mA Sbjct=3e38A Z-score=6.9

back to top
DSSP  ---llLLLL--------LEEEEEEEH---HHLLlhhhhhhhhhhhllllllllhhhhhhh
Query ---tpAFNK--------PKVELHVHL---DGAIkpetilyfgkkrgialpadtveelrni   46
ident                   |   | |    ||                             
Sbjct aqrrnEIQVpdldgyttLKCDFHXHSvfsDGLV---------------------------   33
DSSP  lllllLLLLlllllleeEEEELLLLLlllLLLL---------------------------


DSSP  hlllllllhhhhhllhhhhhhhhlllhhhhhhHHHHHHHHHHHLLEEEEEEEELLHHHLL
Query igmdkplslpgflakfdyympviagcreaikrIAYEFVEMKAKEGVVYVEVRYSPHLLAN  106
ident                                      |      |               
Sbjct --------------------------------WPTVRVDEAYRDGLDAISLTEHIEYRPH   61
DSSP  --------------------------------LHHHHHHHHHHLLLLEELLEEELLLLLL


DSSP  llllllhhhlllLLLLhhHHHHHHHHHHHHHHHHHLLEEEEEEEEELL---------lhh
Query skvdpmpwnqteGDVTpdDVVDLVNQGLQEGEQAFGIKVRSILCCMRH---------qps  157
ident              ||              |     ||         |             
Sbjct -----------kQDVV--SDHNRSFDLCREQAEKLGILLIKGSEITRAxapghfnaifls  108
DSSP  -----------lLLLL--LLLLHHHHHHHHHHHHHLLEELLEEEEELLlllleeeeelll


DSSP  hhhHHHHhhhhllllleeeeeeelllllllhhhlhHHHHHHHHHHHHLLEEEEEELLL--
Query wslEVLElckkynqktvvamdlagdetiegsslfpGHVEAYEGAVKNGIHRTVHAGEV--  215
ident                                        |   | | |            
Sbjct dsnPLEQ---------------------------kDYKDAFREAKKQGAFXFWNHPGWds  141
DSSP  llhHHLL---------------------------lLHHHHHHHHHHLLLEEEELLLLLll


DSSP  -----LLHH-hhHHHHHLLLLLEEEE----lHHHHhlhhhHHHHHHLLLEEEElhhhhhh
Query -----GSPE-vvREAVDILKTERVGH----gYHTIedealYNRLLKENMHFEVcpwssyl  265
ident                                |            |  |            
Sbjct qqpdtTKWWpehTALYQEGCXHGIEVanghlYXPE----aIQWCLDKNLTXIG-------  190
DSSP  lllllLLLLhhhHHHHHLLLLLEEEEeelleELLH----hHHHHHHHLLEEEE-------


DSSP  llllllllllhhhhhhhlllleeeLLLL---LLLLL-----LLHHhhhhhhhhlllllhh
Query tgawdpktthavvrfkndkanyslNTDD---PLIFK-----STLDtdyqmtkkdmgftee  317
ident                           |                                 
Sbjct ------------------------TSDIhqpIQTDYdfekgEHRT---------------  211
DSSP  ------------------------ELLLlllHHHHLlhhhlLLLL---------------


DSSP  hhhhHHHHhhhlllllhhHHHHH-------------------------------------
Query efkrLNINaakssflpeeEKKEL-------------------------------------  340
ident                                                             
Sbjct --xtFVFA-------kerSLQGIrealdnrrtaayfhelligredllrpffekcvkieev  262
DSSP  --eeEEEE-------lllLHHHHhhhhhllleeeeelleeellhhhhhhhhhhheeeeee


DSSP  ------------------------------------------------------------
Query ------------------------------------------------------------  340
ident                                                             
Sbjct srneqgvtlsitnvtdlvlklkktahdtllvyfrdxtlkphtrytvrigfkqgikggdvn  322
DSSP  eeelleeeeeeeellllleeeeelllllleellleeeellleeeeeeeeellllllleee


DSSP  -----------hhhhhhhll
Query -----------lerlyreyq  349
ident                     
Sbjct fevtnfivapdkglkytisl  342
DSSP  eeeeeeeeelleeeeeeeel


No 58: Query=1a4mA Sbjct=2anuA Z-score=6.5

back to top
DSSP  llllllLEEEEEEEH--HHLLLhhhhhhhhhhhllllllllhhhhhhhhlllllllhhhh
Query tpafnkPKVELHVHL--DGAIKpetilyfgkkrgialpadtveelrniigmdkplslpgf   58
ident            |||                                              
Sbjct ---tewLLCDFHVHTnxSDGHL--------------------------------------   19
DSSP  ---leeEEEEEEELLllLLLLL--------------------------------------


DSSP  hllhhhhhhhhlllhhhhhhHHHHHHHHHHHLLEEEEEEEELLHhhllllLLLLH-HHLL
Query lakfdyympviagcreaikrIAYEFVEMKAKEGVVYVEVRYSPHllanskVDPMP-WNQT  117
ident                        | |    | ||  |                       
Sbjct --------------------PLGEVVDLFGKHGVDVVSITDHIV-----dRRTLEqRKRN   54
DSSP  --------------------LHHHHHHHHHHLLLLEEEEEEEEE-----lHHHHHhHHHL


DSSP  L--llllHHHHHHHHHHHHHHHHHHHL----LEEEEEEEEELLLH------------hHH
Query E--gdvtPDDVVDLVNQGLQEGEQAFG----IKVRSILCCMRHQP------------sWS  159
ident          |        |                                         
Sbjct GeplgaiTEDKFQDYLKRLWREQKRAWeeygXILIPGVEITNNTDlyhivavdvkeyvDP  114
DSSP  LllllllLLLLHHHHHHHHHHHHHHHHhhhlLEEEEEEEEEELLLleeeeeellllllLL


DSSP  HHhhhhhhhllllleeeeeeelllllllhhhlhHHHHHHHHHHHHLLEEEEEE-----ll
Query LEvlelckkynqktvvamdlagdetiegsslfpGHVEAYEGAVKNGIHRTVHA-----ge  214
ident                                     |  |                    
Sbjct SL-------------------------------PVEEIVEKLKEQNALVIAAHpdrkkls  143
DSSP  LL-------------------------------LHHHHHHHHHHLLLEEEELLlllllll


DSSP  lllHHHHHHHHHllLLLEEEE----lHHHHhlhhhHHHHhhllLEEEElhhhhhhlllll
Query vgsPEVVREAVDilKTERVGH----gYHTIedealYNRLlkenMHFEVcpwssyltgawd  270
ident            |                                                
Sbjct wylWANXERFKD--TFDAWEIanrddLFNS----vGVKK----YRYVA------------  181
DSSP  lhhHHLLLLLLL--LLLEEEEeelleELHH----hHHLL----LLEEE------------


DSSP  lllllhhhhhhhlllleeeLLLLLLllLLLHHHHhhhhhhlllllhhhhhhHHHH---hh
Query pktthavvrfkndkanyslNTDDPLifKSTLDTDyqmtkkdmgfteeefkrLNIN---aa  327
ident                    | |                             |        
Sbjct -------------------NSDFHE--LWHVYSW---------------ktLVKSeknie  205
DSSP  -------------------ELLLLL--HHHHLLE---------------eeEEEElllhh


DSSP  HLLLllhhhhhhhhhhhhhhll
Query KSSFlpeeekkellerlyreyq  349
ident                       
Sbjct AIKE---airkntdvaiylxrk  224
DSSP  HHHH---hhhhllleeeeelll


No 59: Query=1a4mA Sbjct=2yb1A Z-score=5.6

back to top
DSSP  lllllllEEEEEEEH---HHLLlhhhhhhhhhhhllllllllhhhhhhhhlllllllhhh
Query tpafnkpKVELHVHL---DGAIkpetilyfgkkrgialpadtveelrniigmdkplslpg   57
ident           || |    |||                                       
Sbjct ------aNIDLHFHSrtsDGAL--------------------------------------   16
DSSP  ------lLEELLLLLlllLLLL--------------------------------------


DSSP  hhllhhhhhhhhlllhhhhhhHHHHHHHHHHHLLEEEEEEEELLhhhllllllllhhhll
Query flakfdyympviagcreaikrIAYEFVEMKAKEGVVYVEVRYSPhllanskvdpmpwnqt  117
ident                         |     |                             
Sbjct ---------------------TPTEVIDRAAARAPALLALTDHD----------------   39
DSSP  ---------------------LHHHHHHHHHLLLLLEEEELLLL----------------


DSSP  lllllhhhhhhHHHHHHHHHHHHHLLEEEEEEEEELL----------------lhhhhHH
Query egdvtpddvvdLVNQGLQEGEQAFGIKVRSILCCMRH----------------qpswsLE  161
ident                         ||                                  
Sbjct ---------ctGGLAEAAAAAARRGIPFLNGVEVSVSwgrhtvhivglgidpaepalaAG   90
DSSP  ---------llLLHHHHHHHHHHLLLLEEEEEEEEEEelleeeeeeeellllllhhhhHH


DSSP  HHHH-------------------------------------------------hhhllll
Query VLEL-------------------------------------------------ckkynqk  172
ident                                                             
Sbjct LKSIregrlerarqmgasleaagiagcfdgamrwcdnpemisrthfarhlvdsgavkdmr  150
DSSP  HHHHhllhhhhhhhhhhhhhhlllllhhhhhhlllllhhhllhhhhhhhhhhllllllhh


DSSP  leeeeeeelllllllhhhlhHHHHHHHHHHHHLLEEEEE-ELLLLL-HHHHHHHHHLLL-
Query tvvamdlagdetiegsslfpGHVEAYEGAVKNGIHRTVH-AGEVGS-PEVVREAVDILK-  229
ident                         |    |  |        |                  
Sbjct tvfrkyltpgkpgyvshqwaSLEDAVGWIVGAGGMAVIAhPGRYDMgRTLIERLILDFQa  210
DSSP  hhhhhlllllllllllllllLHHHHHHHHHHLLLEEEELlHHHLLLlHHHHHHHHHHHHh


DSSP  --LLEEEelhhhhhlhhhhhhhhhllleeEELHhHHHHlllllllllLHHH----hhhhl
Query --TERVGhgyhtiedealynrllkenmhfEVCPwSSYLtgawdpkttHAVV----rfknd  283
ident                                   |  |                      
Sbjct agGQGIE----------------------VASG-SHSL---------DDMHkfalhadrh  238
DSSP  llLLEEE----------------------EEEL-LLLH---------HHHHhhhhhhhhh


DSSP  llLEEELLLLLLLlLLLHhhhhhhhhhlllllhhhhhhhhhHHHHlLLLLhhhhhhhhhh
Query kaNYSLNTDDPLIfKSTLdtdyqmtkkdmgfteeefkrlniNAAKsSFLPeeekkeller  343
ident     |   |                                                   
Sbjct glYASSGSDFHAP-GEDV------------ghtedlppicrPIWR-ELEA------rilr  278
DSSP  llEEEEELLLLLL-LLLL------------lllllllllllLHHH-HLHH------hlll


DSSP  hhhhll
Query lyreyq  349
ident       
Sbjct padaen  284
DSSP  llhhhl