Content-type: text/html
Select neighbours (check boxes) for viewing as multiple structural alignment or 3D superimposition. 
The list of neighbours is sorted by Z-score. Similarities with a Z-score lower than 2 are spurious.
Each neighbour has links to pairwise structural alignment with the query structure, 
 and to the PDB format coordinate file where the neighbour
is superimposed onto the query structure. 
 
 
 
 Expand gaps 
 
Summary
    No:  Chain   Z    rmsd lali nres  %id PDB  Description
1:  4x9v-A 11.8  1.6   77   217   13 PDB  MOLECULE: SERINE/THREONINE-PROTEIN KINASE PLK1;                      
Pairwise Structural Alignments 
Notation: three-state secondary structure definitions by DSSP (reduced to H=helix, E=sheet, L=coil) are shown above the amino acid sequence. Structurally equivalent residues are in uppercase, structurally non-equivalent residues (e.g. in loops) are in lowercase. Amino acid identities are marked by vertical bars.
 No 1: Query=s001A Sbjct=4x9vA Z-score=11.8
back to top
DSSP -----------------------------------LLLLEEEEEEE-LLLEEEEEELLLE Query -----------------------------------ILPVLLKESLI-PGVGRFLAYSDDK 24 ident | | | Sbjct chlsdmlqqlhsvnaskpserglvrqeeaedpaciPIFWVSKWVDYsDKYGLGYQLCDNS 60 DSSP llhhhhhhhhhhhhhllllllllllhhhhllhhhlLLLLEEEEEEElLLLEEEEEELLLL DSSP EEEEELLLLEEEEELlllllllllllllllLLLEEEEELLLLLEEEEELLLLH-HHHHHH Query VHAVFLDGVTVTLNWhlsssaekkqvdqglSFGWCRLTFPDGQDQLIPTEHPG-AYERYV 83 ident | | | | || Sbjct VGVLFNDSTRLILYN---------------DGDSLQYIERDGTESYLTVSSHPnSLMKKI 105 DSSP EEEEELLLLEEEELL---------------LLLEEEEELLLLLEEEEELLLLLhHHHHHH DSSP HHHHHHHHL--------------------------------------------------- Query TSVISWCRG--------------------------------------------------- 92 ident | Sbjct TLLKYFRNYmsehllkaganitarlpylrtwfrtrsaiilhlsngsvqinffqdhtklil 165 DSSP HHHHHHHHHhhhllllllllllllllleeeeeellleeeeeelllleeeeellllleeee DSSP ---------------------------------------------------- Query ---------------------------------------------------- 92 ident Sbjct cplmaavtyidekrdfrtyrlslleeygcckelasrlryartmvdkllssrs 217 DSSP elllleeeeellllleeeeehhhhhhhlllhhhhhhhhhhhhhhhhhhhlll