Content-type: text/html Dali: PF14616

Results: PF14616

Query: s001A

Select neighbours (check boxes) for viewing as multiple structural alignment or 3D superimposition. The list of neighbours is sorted by Z-score. Similarities with a Z-score lower than 2 are spurious. Each neighbour has links to pairwise structural alignment with the query structure, and to the PDB format coordinate file where the neighbour is superimposed onto the query structure.

Expand gaps

Summary

    No:  Chain   Z    rmsd lali nres  %id PDB  Description
1:  2lt7-A  3.0  3.8   45   133   18 PDB  MOLECULE: TRANSCRIPTIONAL REGULATOR KAISO;                           


Pairwise Structural Alignments

Notation: three-state secondary structure definitions by DSSP (reduced to H=helix, E=sheet, L=coil) are shown above the amino acid sequence. Structurally equivalent residues are in uppercase, structurally non-equivalent residues (e.g. in loops) are in lowercase. Amino acid identities are marked by vertical bars.

No 1: Query=s001A Sbjct=2lt7A Z-score=3.0

back to top
DSSP  lLLLLLllllleelllllllllllllleeelllllllleeellllhhhhhhhhhhlllll
Query nFKKTSyeaqyiltkldksrkpdnttraglcpycetieffglknssygnhlaykhgiltn   60
ident    |                                                        
Sbjct -ANKRM------------------------------------------------------    5
DSSP  -LLLLL------------------------------------------------------


DSSP  lLLLLLLEeEEEEEeellllllllllllllllleeEEEEEELLLLLLEEELllllllllL
Query gCSVPDPKyYGKYKfkkgeydepekkkrrtnahilEREGVLCTNCWQILEVnctsrssvL  120
ident      |                              |    |  |              |
Sbjct kVKHDDHY-ELIVD---------------------GRVYYICIVCKRSYVC--------L   35
DSSP  lLLLLLEE-EEEEL---------------------LEEEEEELLLLLEELL--------H


DSSP  HHHHHHHHHHL-------------------------------------------------
Query GHYLRHYRDSH-------------------------------------------------  131
ident     ||                                                      
Sbjct TSLRRHFNIHSwekkypcrycekvfplaeyrtkheihhtgerryqclacgksfinyqfms   95
DSSP  HHHHHHHHHHHlllleelllllleellhhhhhhhhhhhhlllleeellllleellhhhhh


DSSP  --------------------------------------
Query --------------------------------------  131
ident                                       
Sbjct shiksvhsqdpsgdsklyrlhpcrslqirqyaylsdrs  133
DSSP  hhhhhhllllllllllleeelllllllllllhhhhlll



PF14616

Dali logos

Dali logos