Content-type: text/html
Select neighbours (check boxes) for viewing as multiple structural alignment or 3D superimposition.
The list of neighbours is sorted by Z-score. Similarities with a Z-score lower than 2 are spurious.
Each neighbour has links to pairwise structural alignment with the query structure,
and to the PDB format coordinate file where the neighbour
is superimposed onto the query structure.
Expand gaps
Summary
No: Chain Z rmsd lali nres %id PDB Description
1
: 2zx0-A 3.9 3.4 62 195 19 PDB MOLECULE: CSL3;
Pairwise Structural Alignments
Notation: three-state secondary structure definitions by DSSP (reduced to H=helix, E=sheet, L=coil) are shown above the amino acid sequence. Structurally equivalent residues are in uppercase, structurally non-equivalent residues (e.g. in loops) are in lowercase. Amino acid identities are marked by vertical bars.
No 1: Query=s001A Sbjct=2zx0A Z-score=3.9
back to top
DSSP lhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhHHLLLLEEEEEEE Query plmkkkeqkkimekkekyadqarkakrkaemditlvkqlvenkvlkeKTKNGLIIQEAVY 60 ident | | | Sbjct ---------------------------------aisitcegsdallqCDGAKIHIKRANY 27 DSSP ---------------------------------leeeeellleeeeeLLLLEEEEEEEEE DSSP ELLLLL---lllllhhhhhllLEEE-LHHHHHHLL-lLLLEEElllllHHHLllLLLLLL Query GKLDEK---vdhsdpfsvefpPTID-VTIPLQYLV-eDSKLVLhgnnkKSDLlgFWDPRI 115 ident | | | | || Sbjct GRRQHDvcsigrpdnqltdtnCLSQsSTSKMAERCggKSECIV---paSNFV--FGDPCV 82 DSSP ELLLLLlllllllhhhlllllLLLLlHHHHHHHHHllLLEEEE---elLHHH--HLLLLL DSSP LLLLEEEEEEEELL---------------------------------------------- Query SEEKQLKVTYFFQN---------------------------------------------- 129 ident | | | Sbjct GTYKYLDTKYSCVQqqetissiicegsdsqllcdrgeiriqranygrrqhdvcsigrphq 142 DSSP LLLLEEEEEEEEELlllleeeeeellleeeeellllleeeeeeeeellllllllllllhh DSSP -------------------------------------eeeeeeeelllleeel Query -------------------------------------rlhritvndidqllip 145 ident Sbjct qlkntnclsqsttskmaercdgkrqcivkvsnsvfgdpcvgtykyldvaytcd 195 DSSP hllllllllllhhhhhhhhhlllleeeeellhhhhllllllllleeeeeeeel