Content-type: text/html
Select neighbours (check boxes) for viewing as multiple structural alignment or 3D superimposition.
The list of neighbours is sorted by Z-score. Similarities with a Z-score lower than 2 are spurious.
Each neighbour has links to pairwise structural alignment with the query structure,
and to the PDB format coordinate file where the neighbour
is superimposed onto the query structure.
Expand gaps
Summary
No: Chain Z rmsd lali nres %id PDB Description
1
: 6ion-A 5.4 8.5 71 185 23 PDB MOLECULE: ANTI-C4.4A ANTIBODY 11H10, LIGHT CHAIN;
Pairwise Structural Alignments
Notation: three-state secondary structure definitions by DSSP (reduced to H=helix, E=sheet, L=coil) are shown above the amino acid sequence. Structurally equivalent residues are in uppercase, structurally non-equivalent residues (e.g. in loops) are in lowercase. Amino acid identities are marked by vertical bars.
No 1: Query=s001A Sbjct=6ionA Z-score=5.4
back to top
DSSP --LLLEEH---HHHHlLLLLLLLLLLLLLLLEEEEEEL-------leeEEEEELLlllhh Query --CIYCRD---INCQrSSYDADEQCSEKLDACVSVFKA-------gviQAQGCLEsledd 48 ident | | | | | | | || Sbjct leCYSCVQkadDGCS-PNKMKTVKCAPGVDVCTEAVGAvetihgqfslAVRGCGS----- 54 DSSP leEEEEEEellLLLL-HHHLEEEELLLLLLLEEEEEEEeeelleeeeeEEEEELL----- DSSP hhhhhhlLLLL------LLEEEEEELLLLLLLLLLhhheelleelllllhhhhlhhhlll Query wrekcedKDKG------NEIDCEICVTERCNNVAAkrtsciqcnntedaqcaespgllta 102 ident | | ||| Sbjct -glpgknDRGLdlhgllAFIQLQQCAQDRCNAKLN------------------------- 88 DSSP -llleeeEEEEeelleeEEEEEEEELLLLLLLLLL------------------------- DSSP eellllllllleeeeeeeLLEEeeeeellhhhhhhhhlllLEEEEL-------------- Query vqcpiarsgrsfcyaslvGDDLkrgcsltlsdqvkcladpNCHLCD-------------- 148 ident | | Sbjct ------------------PPNG-----------------vECYSCVglsreacqgtsppv 113 DSSP ------------------LLLL-----------------lEEELLLllllllllllllle DSSP ------------------------------------------------------------ Query ------------------------------------------------------------ 148 ident Sbjct vscynasdhvykgcfdgnvtltaanvtvslpvrgcvqdefctrdgvtgpgftlsgsccqg 173 DSSP eelllhhhlllleeeeeeeeeeelleeeeeeeeeeellllllleeeeelleeeeeeeell DSSP ------------ Query ------------ 148 ident Sbjct srcnsdlrnkty 185 DSSP llhhhlllllll